BLAST/PSIBLAST alignment of GI: 254780584 and GI: 121602432 at iteration 1
>gi|121602432|ref|YP_988415.1| 50S ribosomal protein L28 [Bartonella bacilliformis KC583] Length = 98
>gi|166226544|sp|A1UR12|RL28_BARBK RecName: Full=50S ribosomal protein L28 Length = 98
>gi|120614609|gb|ABM45210.1| ribosomal protein L28 [Bartonella bacilliformis KC583] Length = 98
 Score =  129 bits (325), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 61/97 (62%), Positives = 77/97 (79%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT KTV  GN VSHANNKTRRRFLPNLC +TLIS++M+Q Y+LRIS  A+RSVE
Sbjct: 1  MSRACELTGKTVQYGNNVSHANNKTRRRFLPNLCNVTLISEVMQQSYRLRISANAVRSVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKSS 97
           +GGLD FL+ +  + LS R R L+ QI+KK +E+++
Sbjct: 61 HRGGLDNFLTKADDKELSQRARLLKRQIVKKKAEQAA 97