BLAST/PSIBLAST alignment of GI: 254780584 and GI: 209551162 at iteration 1
>gi|209551162|ref|YP_002283079.1| 50S ribosomal protein L28 [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 99
>gi|226699153|sp|B5ZRX6|RL28_RHILW RecName: Full=50S ribosomal protein L28 Length = 99
>gi|209536918|gb|ACI56853.1| ribosomal protein L28 [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 99
 Score =  131 bits (329), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 61/96 (63%), Positives = 76/96 (79%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVCELT K V++GN VSHANNKT+RRFLPNLC++TLISD + Q+Y+LR+S  ALRSVE
Sbjct: 1  MSRVCELTGKAVLTGNNVSHANNKTKRRFLPNLCQVTLISDALNQRYRLRVSAAALRSVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKS 96
           +GGLD FL  + +  LS R R LR QI+KK +E +
Sbjct: 61 HRGGLDAFLLKASETELSMRARLLRRQIVKKTAEAA 96