BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780584|ref|YP_003064997.1| 50S ribosomal protein L28
[Candidatus Liberibacter asiaticus str. psy62]
         (97 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780584|ref|YP_003064997.1| 50S ribosomal protein L28 [Candidatus Liberibacter asiaticus str.
          psy62]
 gi|254040261|gb|ACT57057.1| 50S ribosomal protein L28 [Candidatus Liberibacter asiaticus str.
          psy62]
          Length = 97

 Score =  194 bits (493), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 97/97 (100%), Positives = 97/97 (100%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE
Sbjct: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKSS 97
          RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKSS
Sbjct: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKSS 97


>gi|315121776|ref|YP_004062265.1| 50S ribosomal protein L28 [Candidatus Liberibacter solanacearum
          CLso-ZC1]
 gi|313495178|gb|ADR51777.1| 50S ribosomal protein L28 [Candidatus Liberibacter solanacearum
          CLso-ZC1]
          Length = 103

 Score =  162 bits (411), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 82/97 (84%), Positives = 90/97 (92%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVCELT+KTVMSGNKVS +NNKT+RRFLPNLCRITLISDIM Q+YQLRISK ALRSVE
Sbjct: 1  MSRVCELTRKTVMSGNKVSRSNNKTKRRFLPNLCRITLISDIMGQQYQLRISKHALRSVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKSS 97
          RQGGLD+FL +SKKENLS R R LRSQI+KK+SEKSS
Sbjct: 61 RQGGLDQFLLHSKKENLSDRTRLLRSQIIKKISEKSS 97


>gi|86359399|ref|YP_471291.1| 50S ribosomal protein L28 [Rhizobium etli CFN 42]
 gi|123510611|sp|Q2K3M2|RL28_RHIEC RecName: Full=50S ribosomal protein L28
 gi|86283501|gb|ABC92564.1| 50S ribosomal protein L28 [Rhizobium etli CFN 42]
          Length = 98

 Score =  131 bits (330), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 61/97 (62%), Positives = 77/97 (79%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVCELT K V++GN VSHANNKT+RRFLPNLC++TLISD + Q+Y+LR+S  ALRSVE
Sbjct: 1  MSRVCELTGKAVLTGNNVSHANNKTKRRFLPNLCQVTLISDALNQRYRLRVSAAALRSVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKSS 97
           +GGLD FL  + +  LS R R LR QI+KK +E ++
Sbjct: 61 HRGGLDAFLIKASENELSMRARLLRRQIVKKTAEAAA 97


>gi|114706269|ref|ZP_01439171.1| 50S ribosomal protein L28 [Fulvimarina pelagi HTCC2506]
 gi|114538130|gb|EAU41252.1| 50S ribosomal protein L28 [Fulvimarina pelagi HTCC2506]
          Length = 100

 Score =  131 bits (329), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 64/96 (66%), Positives = 75/96 (78%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVCELT K VMSGN VSHANNKTRRRFLPNLC +TLISD + Q+Y+L++S  ALRSVE
Sbjct: 1  MSRVCELTGKGVMSGNNVSHANNKTRRRFLPNLCSVTLISDALGQRYRLKVSAHALRSVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKS 96
           +GGLD FL  S +  LS R R L+ QI KK++E S
Sbjct: 61 HRGGLDAFLLKSHENELSQRARLLKRQIAKKLAETS 96


>gi|209551162|ref|YP_002283079.1| 50S ribosomal protein L28 [Rhizobium leguminosarum bv. trifolii
          WSM2304]
 gi|226699153|sp|B5ZRX6|RL28_RHILW RecName: Full=50S ribosomal protein L28
 gi|209536918|gb|ACI56853.1| ribosomal protein L28 [Rhizobium leguminosarum bv. trifolii
          WSM2304]
          Length = 99

 Score =  131 bits (329), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 61/96 (63%), Positives = 76/96 (79%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVCELT K V++GN VSHANNKT+RRFLPNLC++TLISD + Q+Y+LR+S  ALRSVE
Sbjct: 1  MSRVCELTGKAVLTGNNVSHANNKTKRRFLPNLCQVTLISDALNQRYRLRVSAAALRSVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKS 96
           +GGLD FL  + +  LS R R LR QI+KK +E +
Sbjct: 61 HRGGLDAFLLKASETELSMRARLLRRQIVKKTAEAA 96


>gi|190893654|ref|YP_001980196.1| 50S ribosomal protein L28 [Rhizobium etli CIAT 652]
 gi|218458580|ref|ZP_03498671.1| 50S ribosomal protein L28 [Rhizobium etli Kim 5]
 gi|218510181|ref|ZP_03508059.1| 50S ribosomal protein L28 [Rhizobium etli Brasil 5]
 gi|218517127|ref|ZP_03513967.1| 50S ribosomal protein L28 [Rhizobium etli 8C-3]
 gi|226699152|sp|B3PPE3|RL28_RHIE6 RecName: Full=50S ribosomal protein L28
 gi|190698933|gb|ACE93018.1| 50S ribosomal protein L28 [Rhizobium etli CIAT 652]
 gi|327188703|gb|EGE55902.1| 50S ribosomal protein L28 [Rhizobium etli CNPAF512]
          Length = 99

 Score =  130 bits (328), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 61/96 (63%), Positives = 76/96 (79%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVCELT K V++GN VSHANNKT+RRFLPNLC++TLISD + Q+Y+LR+S  ALRSVE
Sbjct: 1  MSRVCELTGKAVLTGNNVSHANNKTKRRFLPNLCQVTLISDALNQRYRLRVSAAALRSVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKS 96
           +GGLD FL  + +  LS R R LR QI+KK +E +
Sbjct: 61 HRGGLDAFLLKASENELSMRARLLRRQIVKKTAEAA 96


>gi|218682995|ref|ZP_03530596.1| 50S ribosomal protein L28 [Rhizobium etli CIAT 894]
          Length = 98

 Score =  130 bits (328), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 61/97 (62%), Positives = 77/97 (79%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVCELT K V++GN VSHANNKT+RRFLPNLC++TLISD + Q+Y+LR+S  ALRSVE
Sbjct: 1  MSRVCELTGKAVLTGNNVSHANNKTKRRFLPNLCQVTLISDALNQRYRLRVSAAALRSVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKSS 97
           +GGLD FL  + +  LS R R LR QI+KK +E ++
Sbjct: 61 HRGGLDAFLIKASENELSMRARLLRRQIVKKNAEAAA 97


>gi|90420223|ref|ZP_01228131.1| 50S ribosomal protein L28 [Aurantimonas manganoxydans SI85-9A1]
 gi|90335557|gb|EAS49307.1| 50S ribosomal protein L28 [Aurantimonas manganoxydans SI85-9A1]
          Length = 98

 Score =  129 bits (325), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 61/97 (62%), Positives = 75/97 (77%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT K V SGN VSHANN+TRR+FLPNLC++TLISD M Q+Y+LRIS  ALRSVE
Sbjct: 1  MSRACELTGKAVQSGNNVSHANNRTRRKFLPNLCQVTLISDAMGQRYRLRISAHALRSVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKSS 97
           +GGLD FL+ +    LS R R L+ QI KK++E ++
Sbjct: 61 HRGGLDAFLAKADAAELSQRARLLKRQIAKKIAETAA 97


>gi|121602432|ref|YP_988415.1| 50S ribosomal protein L28 [Bartonella bacilliformis KC583]
 gi|166226544|sp|A1UR12|RL28_BARBK RecName: Full=50S ribosomal protein L28
 gi|120614609|gb|ABM45210.1| ribosomal protein L28 [Bartonella bacilliformis KC583]
          Length = 98

 Score =  129 bits (325), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 61/97 (62%), Positives = 77/97 (79%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT KTV  GN VSHANNKTRRRFLPNLC +TLIS++M+Q Y+LRIS  A+RSVE
Sbjct: 1  MSRACELTGKTVQYGNNVSHANNKTRRRFLPNLCNVTLISEVMQQSYRLRISANAVRSVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKSS 97
           +GGLD FL+ +  + LS R R L+ QI+KK +E+++
Sbjct: 61 HRGGLDNFLTKADDKELSQRARLLKRQIVKKKAEQAA 97


>gi|240851331|ref|YP_002972734.1| 50S ribosomal protein L28 [Bartonella grahamii as4aup]
 gi|240268454|gb|ACS52042.1| 50S ribosomal protein L28 [Bartonella grahamii as4aup]
          Length = 105

 Score =  129 bits (324), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 61/95 (64%), Positives = 75/95 (78%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT KTV+ GN VSHANNKTRRRFLPNLC +TLIS++++Q Y+LRIS  ALRSVE
Sbjct: 1  MSRACELTGKTVLYGNNVSHANNKTRRRFLPNLCNVTLISEVLQQSYRLRISASALRSVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEK 95
           +GGLD FL  +  + LS R R L+ QI+KK +E+
Sbjct: 61 HRGGLDAFLVKADDKELSQRARLLKRQIIKKKAEQ 95


>gi|49476246|ref|YP_034287.1| 50S ribosomal protein L28 [Bartonella henselae str. Houston-1]
 gi|67461407|sp|Q6G5T1|RL28_BARHE RecName: Full=50S ribosomal protein L28
 gi|49239054|emb|CAF28355.1| 50S ribosomal protein l28 [Bartonella henselae str. Houston-1]
          Length = 97

 Score =  129 bits (323), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 61/97 (62%), Positives = 76/97 (78%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT KTV  GN VSHANNKTRRRFLPNLC +TLIS++++Q Y+LR+S  ALRSVE
Sbjct: 1  MSRACELTGKTVQYGNNVSHANNKTRRRFLPNLCNVTLISEVLQQSYRLRVSASALRSVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKSS 97
           +GGLD FL  +  + LS R R L+ QI+KK +EK++
Sbjct: 61 HRGGLDGFLVKADDKELSQRARLLKRQIVKKKAEKAA 97


>gi|49474767|ref|YP_032809.1| 50S ribosomal protein L28 [Bartonella quintana str. Toulouse]
 gi|67461402|sp|Q6FYG6|RL28_BARQU RecName: Full=50S ribosomal protein L28
 gi|49240271|emb|CAF26742.1| 50s ribosomal protein l28 [Bartonella quintana str. Toulouse]
          Length = 97

 Score =  127 bits (320), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 60/97 (61%), Positives = 76/97 (78%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT KTV  GN VSHANNKTRRRFLPNLC +TLIS++++Q Y+LR+S  ALRSVE
Sbjct: 1  MSRACELTGKTVQYGNNVSHANNKTRRRFLPNLCNVTLISEVLQQSYRLRVSASALRSVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKSS 97
           +GGLD FL  +  + LS R R L+ QI+KK +E+++
Sbjct: 61 HRGGLDSFLVRADDKELSQRARLLKRQIVKKKAEQAA 97


>gi|163869259|ref|YP_001610515.1| 50S ribosomal protein L28 [Bartonella tribocorum CIP 105476]
 gi|161018962|emb|CAK02520.1| 50S ribosomal protein L28 [Bartonella tribocorum CIP 105476]
          Length = 105

 Score =  127 bits (320), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 61/97 (62%), Positives = 76/97 (78%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT KTV+ GN VSHANNKTRRRFLPNLC +TLIS++++Q Y+LRIS  ALRSVE
Sbjct: 1  MSRACELTGKTVLYGNNVSHANNKTRRRFLPNLCNVTLISEVLQQSYRLRISANALRSVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKSS 97
           +GGLD FL  +  + LS R R L+ QI+KK +E+ +
Sbjct: 61 HRGGLDGFLVKADDKELSQRARLLKRQIVKKKAEQEN 97


>gi|163759938|ref|ZP_02167022.1| 50S ribosomal protein L28 [Hoeflea phototrophica DFL-43]
 gi|162282896|gb|EDQ33183.1| 50S ribosomal protein L28 [Hoeflea phototrophica DFL-43]
          Length = 98

 Score =  127 bits (318), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 62/94 (65%), Positives = 72/94 (76%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT K V SGN VSHANN+TRRRFLPNLC +TLISD M Q+Y+LRIS  ALR+VE
Sbjct: 1  MSRSCELTGKAVQSGNNVSHANNRTRRRFLPNLCNVTLISDAMGQRYRLRISANALRTVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSE 94
           +GGLD FL+ +K   LS R R L+ QI KK+ E
Sbjct: 61 HRGGLDAFLAKAKDGELSMRARLLKRQIAKKLEE 94


>gi|159185825|ref|NP_356994.2| 50S ribosomal protein L28 [Agrobacterium tumefaciens str. C58]
 gi|332716407|ref|YP_004443873.1| 50S ribosomal protein L28 [Agrobacterium sp. H13-3]
 gi|22096068|sp|Q8U9V8|RL28_AGRT5 RecName: Full=50S ribosomal protein L28
 gi|159140959|gb|AAK89779.2| 50S ribosomal protein L28 [Agrobacterium tumefaciens str. C58]
 gi|325063092|gb|ADY66782.1| 50S ribosomal protein L28 [Agrobacterium sp. H13-3]
          Length = 96

 Score =  126 bits (317), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 61/96 (63%), Positives = 74/96 (77%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVCELT K V +GN VSHANNKT+RRFLPNLC++TLISD + Q+++LR+S  ALRSVE
Sbjct: 1  MSRVCELTGKGVQTGNNVSHANNKTKRRFLPNLCQVTLISDALGQRFRLRVSAAALRSVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKS 96
           +GGLD FL  S +  LS R R LR QI KK +E +
Sbjct: 61 HRGGLDAFLLKSGENELSMRARLLRRQIAKKTAEAA 96


>gi|319407804|emb|CBI81455.1| 50S ribosomal protein L28 [Bartonella sp. 1-1C]
          Length = 97

 Score =  126 bits (317), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 62/95 (65%), Positives = 74/95 (77%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVCELT K V  GN VSHANNKTRRRFLPNLC +TLIS++++Q Y+LRIS  ALRSVE
Sbjct: 1  MSRVCELTGKAVQYGNNVSHANNKTRRRFLPNLCNVTLISELLQQSYRLRISANALRSVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEK 95
           +GGLD FL  +  + LS R R L+ QI+KK +EK
Sbjct: 61 HRGGLDNFLVKADDKELSQRGRLLKRQIMKKKAEK 95


>gi|110635403|ref|YP_675611.1| 50S ribosomal protein L28 [Mesorhizobium sp. BNC1]
 gi|122965640|sp|Q11DS9|RL28_MESSB RecName: Full=50S ribosomal protein L28
 gi|110286387|gb|ABG64446.1| LSU ribosomal protein L28P [Chelativorans sp. BNC1]
          Length = 98

 Score =  126 bits (317), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 60/96 (62%), Positives = 74/96 (77%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT K VMSGN VSHANNKTRRRFLPNLC +TL+S+ + Q Y+LR+S  ALRSVE
Sbjct: 1  MSRACELTGKAVMSGNNVSHANNKTRRRFLPNLCDVTLMSEALGQSYRLRVSANALRSVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKS 96
           +GGLD FL  +K   LS R R L+ Q+ KK++E++
Sbjct: 61 HRGGLDAFLLKAKSNELSQRARLLKKQVAKKLTEQT 96


>gi|319409404|emb|CBI83050.1| 50S ribosomal protein L28 [Bartonella schoenbuchensis R1]
          Length = 97

 Score =  125 bits (313), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 60/97 (61%), Positives = 75/97 (77%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT K V  GN VSHANNKTRRRFLPNLC +TLIS++++Q Y+LRIS  ALRSVE
Sbjct: 1  MSRACELTGKAVQYGNNVSHANNKTRRRFLPNLCNVTLISEVLQQSYRLRISAHALRSVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKSS 97
           +GGLD FL  +  + LS R R L+ QI+KK +E+++
Sbjct: 61 HRGGLDCFLVKADDKELSQRARLLKRQIMKKKAEQAA 97


>gi|319899448|ref|YP_004159545.1| 50S ribosomal protein L28 [Bartonella clarridgeiae 73]
 gi|319403416|emb|CBI76984.1| 50S ribosomal protein L28 [Bartonella clarridgeiae 73]
          Length = 97

 Score =  125 bits (313), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 60/95 (63%), Positives = 73/95 (76%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT K V  GN VSHANNKTRRRFLPNLC +TLIS++++Q Y+LRIS  ALRSVE
Sbjct: 1  MSRACELTGKAVQYGNNVSHANNKTRRRFLPNLCNVTLISEVLQQSYRLRISANALRSVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEK 95
           +GGLD FL  +  + LS R R L+ QI+KK +E+
Sbjct: 61 HRGGLDGFLVKADDKELSQRARLLKRQIIKKKAEQ 95


>gi|222087370|ref|YP_002545907.1| ribosomal protein L28 [Agrobacterium radiobacter K84]
 gi|254801493|sp|B9JBS8|RL28_AGRRK RecName: Full=50S ribosomal protein L28
 gi|221724818|gb|ACM27974.1| ribosomal protein L28 [Agrobacterium radiobacter K84]
          Length = 101

 Score =  124 bits (311), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 58/91 (63%), Positives = 72/91 (79%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR+CELT K V+ GN VSHANNKT+RRFLPNLC++TLISD++ Q+Y+LR+S   LRSVE
Sbjct: 1  MSRMCELTGKAVLVGNNVSHANNKTKRRFLPNLCQVTLISDVLGQRYRLRVSAAGLRSVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKK 91
           +GGLD FL  + +  LS R R LR QI+KK
Sbjct: 61 HRGGLDAFLLKASENELSQRARLLRRQIIKK 91


>gi|319406327|emb|CBI79964.1| Ribosomal protein L28 [Bartonella sp. AR 15-3]
          Length = 129

 Score =  124 bits (311), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 60/95 (63%), Positives = 73/95 (76%)

Query: 1   MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
           MSR CELT K V  GN VSHANNKTRRRFLPNLC +TLIS++++Q Y+LR+S  ALRSVE
Sbjct: 33  MSRACELTGKAVQYGNNVSHANNKTRRRFLPNLCNVTLISELLQQSYRLRVSASALRSVE 92

Query: 61  RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEK 95
            +GGLD FL  +  + LS R R L+ QI+KK +EK
Sbjct: 93  HRGGLDNFLIKADDKELSQRGRLLKRQIMKKKAEK 127


>gi|254718063|ref|ZP_05179874.1| 50S ribosomal protein L28 [Brucella sp. 83/13]
 gi|265983010|ref|ZP_06095745.1| LSU ribosomal protein L28P [Brucella sp. 83/13]
 gi|306837624|ref|ZP_07470495.1| ribosomal protein L28 [Brucella sp. NF 2653]
 gi|306842858|ref|ZP_07475496.1| ribosomal protein L28 [Brucella sp. BO2]
 gi|306843444|ref|ZP_07476045.1| ribosomal protein L28 [Brucella sp. BO1]
 gi|264661602|gb|EEZ31863.1| LSU ribosomal protein L28P [Brucella sp. 83/13]
 gi|306276135|gb|EFM57835.1| ribosomal protein L28 [Brucella sp. BO1]
 gi|306286980|gb|EFM58495.1| ribosomal protein L28 [Brucella sp. BO2]
 gi|306407331|gb|EFM63539.1| ribosomal protein L28 [Brucella sp. NF 2653]
          Length = 97

 Score =  123 bits (309), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 61/97 (62%), Positives = 72/97 (74%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT K+V  GN VSHANNKTRRRFLPNLC +TLIS+ + Q Y+LRIS  ALRSVE
Sbjct: 1  MSRACELTGKSVQYGNNVSHANNKTRRRFLPNLCNVTLISETLGQSYRLRISANALRSVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKSS 97
           +GGLD FL  S  + LS R R L+ QI KK +E ++
Sbjct: 61 HRGGLDAFLVKSDDKELSQRARLLKRQIAKKQAEAAA 97


>gi|15966421|ref|NP_386774.1| 50S ribosomal protein L28 [Sinorhizobium meliloti 1021]
 gi|307300541|ref|ZP_07580321.1| ribosomal protein L28 [Sinorhizobium meliloti BL225C]
 gi|307318406|ref|ZP_07597841.1| ribosomal protein L28 [Sinorhizobium meliloti AK83]
 gi|20139560|sp|Q92MF4|RL28_RHIME RecName: Full=50S ribosomal protein L28
 gi|15075692|emb|CAC47247.1| Probable 50S ribosomal protein L28 [Sinorhizobium meliloti 1021]
 gi|306896088|gb|EFN26839.1| ribosomal protein L28 [Sinorhizobium meliloti AK83]
 gi|306904707|gb|EFN35291.1| ribosomal protein L28 [Sinorhizobium meliloti BL225C]
          Length = 96

 Score =  123 bits (309), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 59/96 (61%), Positives = 73/96 (76%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT K V SGN VSHANNKT+R+FLPNLC +TLISD + Q+++LR+S  ALRSVE
Sbjct: 1  MSRSCELTGKGVQSGNNVSHANNKTKRKFLPNLCNVTLISDALGQRFRLRVSAAALRSVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKS 96
           +GGLD FL  + +  LS R R LR QI+KK +E +
Sbjct: 61 HRGGLDAFLLKADENELSMRARLLRRQIVKKAAEAA 96


>gi|222149976|ref|YP_002550933.1| 50S ribosomal protein L28 [Agrobacterium vitis S4]
 gi|254801494|sp|B9JTL3|RL28_AGRVS RecName: Full=50S ribosomal protein L28
 gi|221736958|gb|ACM37921.1| 50S ribosomal protein L28 [Agrobacterium vitis S4]
          Length = 96

 Score =  123 bits (309), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 60/93 (64%), Positives = 71/93 (76%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT K V SGN VSHANNKTRR+FLPNLC +TLISD + Q+Y+LR+S  ALRSVE
Sbjct: 1  MSRSCELTGKGVQSGNNVSHANNKTRRKFLPNLCDVTLISDALGQRYRLRVSAAALRSVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMS 93
           +GGLD FL  + +  LS R R LR QI+KK +
Sbjct: 61 HRGGLDAFLLKANETELSMRARLLRRQIVKKTA 93


>gi|150397754|ref|YP_001328221.1| 50S ribosomal protein L28 [Sinorhizobium medicae WSM419]
 gi|166227338|sp|A6UCK6|RL28_SINMW RecName: Full=50S ribosomal protein L28
 gi|150029269|gb|ABR61386.1| ribosomal protein L28 [Sinorhizobium medicae WSM419]
          Length = 96

 Score =  123 bits (308), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 59/96 (61%), Positives = 73/96 (76%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT K V SGN VSHANNKT+R+FLPNLC +TLISD + Q+++LR+S  ALRSVE
Sbjct: 1  MSRSCELTGKGVQSGNNVSHANNKTKRKFLPNLCNVTLISDALGQRFRLRVSAAALRSVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKS 96
           +GGLD FL  + +  LS R R LR QI+KK +E +
Sbjct: 61 HRGGLDAFLLKADETELSMRARLLRRQIVKKAAEAA 96


>gi|241206565|ref|YP_002977661.1| 50S ribosomal protein L28 [Rhizobium leguminosarum bv. trifolii
          WSM1325]
 gi|240860455|gb|ACS58122.1| ribosomal protein L28 [Rhizobium leguminosarum bv. trifolii
          WSM1325]
          Length = 98

 Score =  122 bits (306), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 57/88 (64%), Positives = 70/88 (79%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVCELT K V++GN VSHANNKT+RRFLPNLC++TLISD + Q+Y+LR+S  ALR+VE
Sbjct: 1  MSRVCELTGKAVLTGNNVSHANNKTKRRFLPNLCQVTLISDALNQRYRLRVSAAALRTVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQI 88
           +GGLD FL  + +  LS R R LR QI
Sbjct: 61 HRGGLDAFLLKASENELSMRARLLRRQI 88


>gi|17986340|ref|NP_538974.1| 50S ribosomal protein L28 [Brucella melitensis bv. 1 str. 16M]
 gi|23502863|ref|NP_698990.1| 50S ribosomal protein L28 [Brucella suis 1330]
 gi|62290860|ref|YP_222653.1| 50S ribosomal protein L28 [Brucella abortus bv. 1 str. 9-941]
 gi|82700772|ref|YP_415346.1| 50S ribosomal protein L28 [Brucella melitensis biovar Abortus
          2308]
 gi|161619931|ref|YP_001593818.1| 50S ribosomal protein L28 [Brucella canis ATCC 23365]
 gi|163844035|ref|YP_001628439.1| 50S ribosomal protein L28 [Brucella suis ATCC 23445]
 gi|189025077|ref|YP_001935845.1| 50S ribosomal protein L28 [Brucella abortus S19]
 gi|225628209|ref|ZP_03786244.1| ribosomal protein L28 [Brucella ceti str. Cudo]
 gi|225853449|ref|YP_002733682.1| 50S ribosomal protein L28 [Brucella melitensis ATCC 23457]
 gi|237816370|ref|ZP_04595363.1| ribosomal protein L28 [Brucella abortus str. 2308 A]
 gi|254690152|ref|ZP_05153406.1| 50S ribosomal protein L28 [Brucella abortus bv. 6 str. 870]
 gi|254694642|ref|ZP_05156470.1| 50S ribosomal protein L28 [Brucella abortus bv. 3 str. Tulya]
 gi|254696267|ref|ZP_05158095.1| 50S ribosomal protein L28 [Brucella abortus bv. 2 str. 86/8/59]
 gi|254700652|ref|ZP_05162480.1| 50S ribosomal protein L28 [Brucella suis bv. 5 str. 513]
 gi|254705022|ref|ZP_05166850.1| 50S ribosomal protein L28 [Brucella suis bv. 3 str. 686]
 gi|254707461|ref|ZP_05169289.1| 50S ribosomal protein L28 [Brucella pinnipedialis M163/99/10]
 gi|254708997|ref|ZP_05170808.1| 50S ribosomal protein L28 [Brucella pinnipedialis B2/94]
 gi|254713576|ref|ZP_05175387.1| 50S ribosomal protein L28 [Brucella ceti M644/93/1]
 gi|254716070|ref|ZP_05177881.1| 50S ribosomal protein L28 [Brucella ceti M13/05/1]
 gi|254731185|ref|ZP_05189763.1| 50S ribosomal protein L28 [Brucella abortus bv. 4 str. 292]
 gi|256030523|ref|ZP_05444137.1| 50S ribosomal protein L28 [Brucella pinnipedialis M292/94/1]
 gi|256045618|ref|ZP_05448496.1| 50S ribosomal protein L28 [Brucella melitensis bv. 1 str. Rev.1]
 gi|256059984|ref|ZP_05450168.1| 50S ribosomal protein L28 [Brucella neotomae 5K33]
 gi|256112342|ref|ZP_05453263.1| 50S ribosomal protein L28 [Brucella melitensis bv. 3 str. Ether]
 gi|256158509|ref|ZP_05456407.1| 50S ribosomal protein L28 [Brucella ceti M490/95/1]
 gi|256253928|ref|ZP_05459464.1| 50S ribosomal protein L28 [Brucella ceti B1/94]
 gi|256258406|ref|ZP_05463942.1| 50S ribosomal protein L28 [Brucella abortus bv. 9 str. C68]
 gi|256263069|ref|ZP_05465601.1| 50S ribosomal protein L28 [Brucella melitensis bv. 2 str. 63/9]
 gi|256370415|ref|YP_003107926.1| 50S ribosomal protein L28 [Brucella microti CCM 4915]
 gi|260169428|ref|ZP_05756239.1| 50S ribosomal protein L28 [Brucella sp. F5/99]
 gi|260546125|ref|ZP_05821865.1| LSU ribosomal protein L28P [Brucella abortus NCTC 8038]
 gi|260567510|ref|ZP_05837980.1| ribosomal protein L28 [Brucella suis bv. 4 str. 40]
 gi|260755689|ref|ZP_05868037.1| LSU ribosomal protein L28P [Brucella abortus bv. 6 str. 870]
 gi|260758914|ref|ZP_05871262.1| LSU ribosomal protein L28P [Brucella abortus bv. 4 str. 292]
 gi|260760637|ref|ZP_05872980.1| LSU ribosomal protein L28P [Brucella abortus bv. 2 str. 86/8/59]
 gi|260884715|ref|ZP_05896329.1| 50S ribosomal protein L28 [Brucella abortus bv. 9 str. C68]
 gi|261214964|ref|ZP_05929245.1| LSU ribosomal protein L28P [Brucella abortus bv. 3 str. Tulya]
 gi|261217836|ref|ZP_05932117.1| LSU ribosomal protein L28P [Brucella ceti M13/05/1]
 gi|261221066|ref|ZP_05935347.1| 50S ribosomal protein L28 [Brucella ceti B1/94]
 gi|261314949|ref|ZP_05954146.1| LSU ribosomal protein L28P [Brucella pinnipedialis M163/99/10]
 gi|261316494|ref|ZP_05955691.1| LSU ribosomal protein L28P [Brucella pinnipedialis B2/94]
 gi|261321314|ref|ZP_05960511.1| LSU ribosomal protein L28P [Brucella ceti M644/93/1]
 gi|261323957|ref|ZP_05963154.1| 50S ribosomal protein L28 [Brucella neotomae 5K33]
 gi|261751158|ref|ZP_05994867.1| LSU ribosomal protein L28P [Brucella suis bv. 5 str. 513]
 gi|261755721|ref|ZP_05999430.1| LSU ribosomal protein L28P [Brucella suis bv. 3 str. 686]
 gi|261758952|ref|ZP_06002661.1| ribosomal protein L28 [Brucella sp. F5/99]
 gi|265987567|ref|ZP_06100124.1| 50S ribosomal protein L28 [Brucella pinnipedialis M292/94/1]
 gi|265992039|ref|ZP_06104596.1| 50S ribosomal protein L28 [Brucella melitensis bv. 1 str. Rev.1]
 gi|265993775|ref|ZP_06106332.1| 50S ribosomal protein L28 [Brucella melitensis bv. 3 str. Ether]
 gi|265997026|ref|ZP_06109583.1| 50S ribosomal protein L28 [Brucella ceti M490/95/1]
 gi|294851247|ref|ZP_06791920.1| large subunit ribosomal protein L28 [Brucella sp. NVSL 07-0026]
 gi|297247245|ref|ZP_06930963.1| large subunit ribosomal protein L28 [Brucella abortus bv. 5 str.
          B3196]
 gi|54039146|sp|P66141|RL28_BRUSU RecName: Full=50S ribosomal protein L28
 gi|54041846|sp|P66140|RL28_BRUME RecName: Full=50S ribosomal protein L28
 gi|75496122|sp|Q57AP2|RL28_BRUAB RecName: Full=50S ribosomal protein L28
 gi|123547363|sp|Q2YR56|RL28_BRUA2 RecName: Full=50S ribosomal protein L28
 gi|189042425|sp|A9M9A0|RL28_BRUC2 RecName: Full=50S ribosomal protein L28
 gi|189042426|sp|B0CJB7|RL28_BRUSI RecName: Full=50S ribosomal protein L28
 gi|226738040|sp|B2S8R7|RL28_BRUA1 RecName: Full=50S ribosomal protein L28
 gi|254801345|sp|C0RFQ6|RL28_BRUMB RecName: Full=50S ribosomal protein L28
 gi|17981927|gb|AAL51238.1| lsu ribosomal protein l28p [Brucella melitensis bv. 1 str. 16M]
 gi|23348891|gb|AAN30905.1| ribosomal protein L28 [Brucella suis 1330]
 gi|62196992|gb|AAX75292.1| RpmB, ribosomal protein L28 [Brucella abortus bv. 1 str. 9-941]
 gi|82616873|emb|CAJ11972.1| Ribosomal protein L28:ATP/GTP-binding site motif A (P-loop)
          [Brucella melitensis biovar Abortus 2308]
 gi|161336742|gb|ABX63047.1| ribosomal protein L28 [Brucella canis ATCC 23365]
 gi|163674758|gb|ABY38869.1| ribosomal protein L28 [Brucella suis ATCC 23445]
 gi|189020649|gb|ACD73371.1| Ribosomal protein L28 [Brucella abortus S19]
 gi|225617034|gb|EEH14081.1| ribosomal protein L28 [Brucella ceti str. Cudo]
 gi|225641814|gb|ACO01728.1| ribosomal protein L28 [Brucella melitensis ATCC 23457]
 gi|237788437|gb|EEP62652.1| ribosomal protein L28 [Brucella abortus str. 2308 A]
 gi|256000578|gb|ACU48977.1| 50S ribosomal protein L28 [Brucella microti CCM 4915]
 gi|260096232|gb|EEW80108.1| LSU ribosomal protein L28P [Brucella abortus NCTC 8038]
 gi|260157028|gb|EEW92108.1| ribosomal protein L28 [Brucella suis bv. 4 str. 40]
 gi|260669232|gb|EEX56172.1| LSU ribosomal protein L28P [Brucella abortus bv. 4 str. 292]
 gi|260671069|gb|EEX57890.1| LSU ribosomal protein L28P [Brucella abortus bv. 2 str. 86/8/59]
 gi|260675797|gb|EEX62618.1| LSU ribosomal protein L28P [Brucella abortus bv. 6 str. 870]
 gi|260874243|gb|EEX81312.1| 50S ribosomal protein L28 [Brucella abortus bv. 9 str. C68]
 gi|260916571|gb|EEX83432.1| LSU ribosomal protein L28P [Brucella abortus bv. 3 str. Tulya]
 gi|260919650|gb|EEX86303.1| 50S ribosomal protein L28 [Brucella ceti B1/94]
 gi|260922925|gb|EEX89493.1| LSU ribosomal protein L28P [Brucella ceti M13/05/1]
 gi|261294004|gb|EEX97500.1| LSU ribosomal protein L28P [Brucella ceti M644/93/1]
 gi|261295717|gb|EEX99213.1| LSU ribosomal protein L28P [Brucella pinnipedialis B2/94]
 gi|261299937|gb|EEY03434.1| 50S ribosomal protein L28 [Brucella neotomae 5K33]
 gi|261303975|gb|EEY07472.1| LSU ribosomal protein L28P [Brucella pinnipedialis M163/99/10]
 gi|261738936|gb|EEY26932.1| ribosomal protein L28 [Brucella sp. F5/99]
 gi|261740911|gb|EEY28837.1| LSU ribosomal protein L28P [Brucella suis bv. 5 str. 513]
 gi|261745474|gb|EEY33400.1| LSU ribosomal protein L28P [Brucella suis bv. 3 str. 686]
 gi|262551494|gb|EEZ07484.1| 50S ribosomal protein L28 [Brucella ceti M490/95/1]
 gi|262764756|gb|EEZ10677.1| 50S ribosomal protein L28 [Brucella melitensis bv. 3 str. Ether]
 gi|263003105|gb|EEZ15398.1| 50S ribosomal protein L28 [Brucella melitensis bv. 1 str. Rev.1]
 gi|263092961|gb|EEZ17122.1| 50S ribosomal protein L28 [Brucella melitensis bv. 2 str. 63/9]
 gi|264659764|gb|EEZ30025.1| 50S ribosomal protein L28 [Brucella pinnipedialis M292/94/1]
 gi|294819836|gb|EFG36835.1| large subunit ribosomal protein L28 [Brucella sp. NVSL 07-0026]
 gi|297174414|gb|EFH33761.1| large subunit ribosomal protein L28 [Brucella abortus bv. 5 str.
          B3196]
 gi|326410012|gb|ADZ67077.1| Ribosomal protein L28 [Brucella melitensis M28]
 gi|326539729|gb|ADZ87944.1| ribosomal protein L28 [Brucella melitensis M5-90]
          Length = 97

 Score =  122 bits (306), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 60/97 (61%), Positives = 72/97 (74%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT K+V  GN VSHANN+TRRRFLPNLC +TLIS+ + Q Y+LRIS  ALRSVE
Sbjct: 1  MSRACELTGKSVQYGNNVSHANNRTRRRFLPNLCNVTLISETLGQSYRLRISANALRSVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKSS 97
           +GGLD FL  S  + LS R R L+ QI KK +E ++
Sbjct: 61 HRGGLDAFLVKSDDKELSQRARLLKRQIAKKQAEAAA 97


>gi|319781255|ref|YP_004140731.1| ribosomal protein L28 [Mesorhizobium ciceri biovar biserrulae
          WSM1271]
 gi|317167143|gb|ADV10681.1| ribosomal protein L28 [Mesorhizobium ciceri biovar biserrulae
          WSM1271]
          Length = 98

 Score =  122 bits (305), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 59/97 (60%), Positives = 73/97 (75%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT K VMSGN VSHANNKT+RRFLPNL  +TLIS+ + Q  +LRIS  ALRSVE
Sbjct: 1  MSRTCELTAKAVMSGNNVSHANNKTKRRFLPNLVNVTLISEALNQNVRLRISANALRSVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKSS 97
           +GGLD FL+ +  + LS R R L+ QI KK +E+++
Sbjct: 61 HRGGLDAFLAKADVKELSQRARLLKKQIAKKTAEQAA 97


>gi|227823244|ref|YP_002827216.1| 50S ribosomal protein L28 [Sinorhizobium fredii NGR234]
 gi|254801373|sp|C3MHW1|RL28_RHISN RecName: Full=50S ribosomal protein L28
 gi|227342245|gb|ACP26463.1| 50S ribosomal protein L28 [Sinorhizobium fredii NGR234]
          Length = 96

 Score =  121 bits (304), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 73/96 (76%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT K V SG+ VSHANNKT+R+FLPNLC +TLISD + Q+++LR+S  ALRSVE
Sbjct: 1  MSRSCELTGKGVQSGHNVSHANNKTKRKFLPNLCNVTLISDALGQRFRLRVSAAALRSVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKS 96
           +GGLD FL  + +  LS R R LR QI+KK +E +
Sbjct: 61 HRGGLDAFLLKADENELSMRARLLRRQIVKKAAEAA 96


>gi|153008253|ref|YP_001369468.1| 50S ribosomal protein L28 [Ochrobactrum anthropi ATCC 49188]
 gi|166226592|sp|A6WXD5|RL28_OCHA4 RecName: Full=50S ribosomal protein L28
 gi|151560141|gb|ABS13639.1| ribosomal protein L28 [Ochrobactrum anthropi ATCC 49188]
          Length = 99

 Score =  121 bits (303), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 59/96 (61%), Positives = 71/96 (73%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT K+V  GN VSHANNKTRRRFLPNLC +TL+S+ + Q Y+LR+S  ALRSVE
Sbjct: 1  MSRACELTGKSVQYGNNVSHANNKTRRRFLPNLCNVTLMSETLGQSYRLRVSANALRSVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKS 96
           +GGLD FL  S  + LS R R L+ QI KK +E +
Sbjct: 61 HRGGLDAFLVKSDDKELSQRARLLKRQIAKKQAEAA 96


>gi|239833067|ref|ZP_04681396.1| ribosomal protein L28 [Ochrobactrum intermedium LMG 3301]
 gi|239825334|gb|EEQ96902.1| ribosomal protein L28 [Ochrobactrum intermedium LMG 3301]
          Length = 118

 Score =  121 bits (303), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 59/94 (62%), Positives = 70/94 (74%)

Query: 1   MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
           MSR CELT K+V  GN VSHANNKTRRRFLPNLC +TL+S+ + Q Y+LR+S  ALRSVE
Sbjct: 21  MSRACELTGKSVQYGNNVSHANNKTRRRFLPNLCNVTLMSETLGQSYRLRVSANALRSVE 80

Query: 61  RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSE 94
            +GGLD FL  S  + LS R R L+ QI KK +E
Sbjct: 81  HRGGLDAFLVKSDDKELSQRARLLKRQIAKKQAE 114


>gi|319404842|emb|CBI78443.1| 50S ribosomal protein L28 [Bartonella rochalimae ATCC BAA-1498]
          Length = 95

 Score =  120 bits (302), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 59/91 (64%), Positives = 70/91 (76%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT K V  GN VSHANNKTRRRFLPNLC +TLIS++++Q Y+LRIS  ALRSVE
Sbjct: 1  MSRACELTGKAVQYGNNVSHANNKTRRRFLPNLCNVTLISELLQQSYRLRISANALRSVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKK 91
           +GGLD FL  +  + LS R R L+ QI+KK
Sbjct: 61 HRGGLDNFLIKADDKELSQRGRLLKRQIMKK 91


>gi|148559224|ref|YP_001259829.1| 50S ribosomal protein L28 [Brucella ovis ATCC 25840]
 gi|166226549|sp|A5VSY2|RL28_BRUO2 RecName: Full=50S ribosomal protein L28
 gi|148370481|gb|ABQ60460.1| 50S ribosomal protein L28 [Brucella ovis ATCC 25840]
          Length = 97

 Score =  118 bits (296), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 59/97 (60%), Positives = 71/97 (73%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT K+V  GN VSHANN+TR RFLPNLC +TLIS+ + Q Y+LRIS  ALRSVE
Sbjct: 1  MSRACELTGKSVQYGNNVSHANNRTRCRFLPNLCNVTLISETLGQSYRLRISANALRSVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKSS 97
           +GGLD FL  S  + LS R R L+ QI KK +E ++
Sbjct: 61 HRGGLDAFLVKSDDKELSQRARLLKRQIAKKQAEAAA 97


>gi|13473066|ref|NP_104633.1| 50S ribosomal protein L28 [Mesorhizobium loti MAFF303099]
 gi|260466651|ref|ZP_05812838.1| ribosomal protein L28 [Mesorhizobium opportunistum WSM2075]
 gi|20139637|sp|Q98FZ7|RL28_RHILO RecName: Full=50S ribosomal protein L28
 gi|14023814|dbj|BAB50419.1| 50S ribosomal protein L28 [Mesorhizobium loti MAFF303099]
 gi|259029514|gb|EEW30803.1| ribosomal protein L28 [Mesorhizobium opportunistum WSM2075]
          Length = 98

 Score =  118 bits (296), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 57/95 (60%), Positives = 71/95 (74%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT K V +GN VSHANNKT+RRFLPNL  +TLIS+ + Q  +LRIS  ALRSVE
Sbjct: 1  MSRTCELTAKAVQTGNNVSHANNKTKRRFLPNLVNVTLISEALNQNVRLRISANALRSVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEK 95
           +GGLD FL+ +  + LS R R L+ QI KK++E+
Sbjct: 61 HRGGLDAFLAKADVKELSQRARLLKKQIAKKLAEQ 95


>gi|77462563|ref|YP_352067.1| 50S ribosomal protein L28 [Rhodobacter sphaeroides 2.4.1]
 gi|126461497|ref|YP_001042611.1| 50S ribosomal protein L28 [Rhodobacter sphaeroides ATCC 17029]
 gi|123592686|sp|Q3J4W8|RL28_RHOS4 RecName: Full=50S ribosomal protein L28
 gi|166226609|sp|A3PHM3|RL28_RHOS1 RecName: Full=50S ribosomal protein L28
 gi|77386981|gb|ABA78166.1| LSU ribosomal protein L28P [Rhodobacter sphaeroides 2.4.1]
 gi|126103161|gb|ABN75839.1| LSU ribosomal protein L28P [Rhodobacter sphaeroides ATCC 17029]
          Length = 96

 Score =  116 bits (291), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 52/90 (57%), Positives = 70/90 (77%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVCEL+ K  M+GN VSHANNK+RRRFLPNL  +TLISD++ Q ++LRIS  ALR+V+
Sbjct: 1  MSRVCELSGKAPMTGNTVSHANNKSRRRFLPNLNDVTLISDVLGQSFKLRISAAALRTVD 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILK 90
           +GGLD FL+ +K + LS + R ++ +I K
Sbjct: 61 HRGGLDAFLAKAKDDELSVKARAIKKEIEK 90


>gi|304394146|ref|ZP_07376069.1| 50S ribosomal protein L28 [Ahrensia sp. R2A130]
 gi|303293586|gb|EFL87963.1| 50S ribosomal protein L28 [Ahrensia sp. R2A130]
          Length = 96

 Score =  115 bits (287), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 53/96 (55%), Positives = 72/96 (75%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT K VM+GN VSHANNKTRRRFLPNL  +TL+S+ +E+  ++RI+  ALR+VE
Sbjct: 1  MSRKCELTGKAVMTGNNVSHANNKTRRRFLPNLVNVTLLSEALEKGVRMRIAASALRTVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKS 96
           +GGLD FL   K+ NLS +   +R ++ KK++E +
Sbjct: 61 HRGGLDAFLMKEKEVNLSPKAALIRKEVAKKLAEAA 96


>gi|328541960|ref|YP_004302069.1| 50S ribosomal protein L28 [polymorphum gilvum SL003B-26A1]
 gi|326411710|gb|ADZ68773.1| 50S ribosomal protein L28 [Polymorphum gilvum SL003B-26A1]
          Length = 96

 Score =  114 bits (285), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 53/96 (55%), Positives = 72/96 (75%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+R CELT K VMSGN VSHANNKTRRRFLPNLC ++LISD + + Y+LRIS  ALRSVE
Sbjct: 1  MARRCELTGKDVMSGNNVSHANNKTRRRFLPNLCNVSLISDALGETYKLRISAHALRSVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKS 96
           +GGLD FL  +    LS + R +++++ ++ ++ +
Sbjct: 61 HRGGLDAFLLKASDTELSNKARLIKAEVKRRQADAA 96


>gi|254472185|ref|ZP_05085585.1| ribosomal protein L28 [Pseudovibrio sp. JE062]
 gi|211958468|gb|EEA93668.1| ribosomal protein L28 [Pseudovibrio sp. JE062]
          Length = 95

 Score =  114 bits (284), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 53/88 (60%), Positives = 68/88 (77%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+R CELT K VM+GN VSHANNK+RRRFLPNLC ++L+SD + + Y+LRIS  ALRSVE
Sbjct: 1  MARRCELTGKDVMTGNNVSHANNKSRRRFLPNLCNVSLMSDTLGETYKLRISAHALRSVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQI 88
           +GGLD FL  + +  LS + R LR++I
Sbjct: 61 HRGGLDAFLMKAAEAELSPKARLLRTEI 88


>gi|294678645|ref|YP_003579260.1| 50S ribosomal protein L28 [Rhodobacter capsulatus SB 1003]
 gi|294477465|gb|ADE86853.1| 50S ribosomal protein L28 [Rhodobacter capsulatus SB 1003]
          Length = 95

 Score =  113 bits (282), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 50/79 (63%), Positives = 62/79 (78%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVCELT K  MSGN +SHANNKTRRRFLPNL  +TLISD++ Q +QLR+S   LR+V+
Sbjct: 1  MSRVCELTGKGPMSGNNISHANNKTRRRFLPNLNEVTLISDVLGQSFQLRVSAAGLRTVD 60

Query: 61 RQGGLDRFLSNSKKENLSA 79
           +GGLD FL+ +  + LSA
Sbjct: 61 HRGGLDAFLAKASDDELSA 79


>gi|260575323|ref|ZP_05843323.1| ribosomal protein L28 [Rhodobacter sp. SW2]
 gi|259022583|gb|EEW25879.1| ribosomal protein L28 [Rhodobacter sp. SW2]
          Length = 94

 Score =  112 bits (281), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 53/90 (58%), Positives = 69/90 (76%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVCEL+ K  MSGN VSHANNK+RRRFLPNL  +TLISD++ Q ++LRIS  ALRSV+
Sbjct: 1  MSRVCELSGKGPMSGNTVSHANNKSRRRFLPNLNEVTLISDVLGQSFKLRISAHALRSVD 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILK 90
           +GGLD FL+ +K + LS +   ++ +I K
Sbjct: 61 HRGGLDAFLAKAKDDELSDKALKIKKEISK 90


>gi|146279144|ref|YP_001169303.1| 50S ribosomal protein L28 [Rhodobacter sphaeroides ATCC 17025]
 gi|166226610|sp|A4WX84|RL28_RHOS5 RecName: Full=50S ribosomal protein L28
 gi|145557385|gb|ABP71998.1| LSU ribosomal protein L28P [Rhodobacter sphaeroides ATCC 17025]
          Length = 96

 Score =  112 bits (281), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 51/90 (56%), Positives = 69/90 (76%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVCEL+ K  M+GN VSHANNK+RRRFLPNL  +TLISD++ Q ++LRIS  ALR+V+
Sbjct: 1  MSRVCELSGKAPMTGNTVSHANNKSRRRFLPNLNDVTLISDVLGQSFKLRISAAALRTVD 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILK 90
           +GGLD FL+ ++ E LS +   ++ +I K
Sbjct: 61 HRGGLDAFLAKARDEELSLKALAIKKEIEK 90


>gi|89055915|ref|YP_511366.1| 50S ribosomal protein L28 [Jannaschia sp. CCS1]
 gi|122497849|sp|Q28LS1|RL28_JANSC RecName: Full=50S ribosomal protein L28
 gi|88865464|gb|ABD56341.1| LSU ribosomal protein L28P [Jannaschia sp. CCS1]
          Length = 96

 Score =  112 bits (279), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 73/96 (76%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVCELT K  M+GN VSHANNKT+RRFLPNL  +TL SD+++++++ RIS  ALR+V+
Sbjct: 1  MSRVCELTGKGPMTGNNVSHANNKTKRRFLPNLSDVTLGSDLLDRRFKFRISNAALRTVD 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKS 96
           +GGLD F++ +K + LS R   ++ +I+K  + ++
Sbjct: 61 HRGGLDAFMAKAKDDELSTRALKIKKEIVKAQAAQA 96


>gi|217976519|ref|YP_002360666.1| 50S ribosomal protein L28 [Methylocella silvestris BL2]
 gi|254801369|sp|B8EQN3|RL28_METSB RecName: Full=50S ribosomal protein L28
 gi|217501895|gb|ACK49304.1| ribosomal protein L28 [Methylocella silvestris BL2]
          Length = 96

 Score =  110 bits (274), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 70/96 (72%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR C+LT K V +GN VSH+N+KTR RFLPNLC +TLISD++++K + R++  ALRSVE
Sbjct: 1  MSRRCDLTGKAVQTGNLVSHSNHKTRTRFLPNLCNVTLISDVLQRKVRFRVAVAALRSVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKS 96
           +GGLD FL+ +    LS   R ++ +ILKK +  S
Sbjct: 61 HRGGLDAFLAKADDAELSLGARAIKREILKKQAAAS 96


>gi|218661315|ref|ZP_03517245.1| 50S ribosomal protein L28 [Rhizobium etli IE4771]
          Length = 85

 Score =  110 bits (274), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 51/82 (62%), Positives = 64/82 (78%)

Query: 15 GNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFLSNSKK 74
          GN VSHANNKT+RRFLPNLC++TLISD + Q+Y+LR+S  ALRSVE +GGLD FL  + +
Sbjct: 1  GNNVSHANNKTKRRFLPNLCQVTLISDALNQRYRLRVSAAALRSVEHRGGLDAFLLKASE 60

Query: 75 ENLSARMRTLRSQILKKMSEKS 96
            LS R R LR QI+KK +E +
Sbjct: 61 NELSMRARLLRRQIVKKTAEAA 82


>gi|119385160|ref|YP_916216.1| 50S ribosomal protein L28 [Paracoccus denitrificans PD1222]
 gi|166226595|sp|A1B4S6|RL28_PARDP RecName: Full=50S ribosomal protein L28
 gi|119374927|gb|ABL70520.1| LSU ribosomal protein L28P [Paracoccus denitrificans PD1222]
          Length = 91

 Score =  109 bits (273), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 53/90 (58%), Positives = 67/90 (74%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVCELT K  MSGN VSHANNKTRRRFLPNL  ++L+S+ + + YQLRIS  ALRSV+
Sbjct: 1  MSRVCELTGKGPMSGNNVSHANNKTRRRFLPNLNEVSLLSEKLGRSYQLRISAAALRSVD 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILK 90
           +GGLD FL+ +K   LS R   ++ ++ K
Sbjct: 61 HRGGLDAFLAKAKDAELSDRALKIKRELAK 90


>gi|154252158|ref|YP_001412982.1| 50S ribosomal protein L28 [Parvibaculum lavamentivorans DS-1]
 gi|171769596|sp|A7HTU2|RL28_PARL1 RecName: Full=50S ribosomal protein L28
 gi|154156108|gb|ABS63325.1| ribosomal protein L28 [Parvibaculum lavamentivorans DS-1]
          Length = 96

 Score =  108 bits (271), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 65/90 (72%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CEL+ K VMSGN VSHAN KTRRRFLPNLC++TLISD + +++ LR+S  ALRSVE
Sbjct: 1  MSRRCELSGKAVMSGNNVSHANRKTRRRFLPNLCQVTLISDALGRQFSLRVSAHALRSVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILK 90
            GGLD FL  +    LS+R   L+  I K
Sbjct: 61 HNGGLDPFLLKASDAQLSSRALKLKRAIEK 90


>gi|307942521|ref|ZP_07657869.1| 50S ribosomal protein L28 [Roseibium sp. TrichSKD4]
 gi|307774160|gb|EFO33373.1| 50S ribosomal protein L28 [Roseibium sp. TrichSKD4]
          Length = 129

 Score =  108 bits (269), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 50/97 (51%), Positives = 71/97 (73%)

Query: 1   MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
           M+R CEL+ K VM+GN VSHANNK+RRRFLPNLC ++L+SD + + ++LRIS  ALRSVE
Sbjct: 32  MARRCELSGKDVMTGNNVSHANNKSRRRFLPNLCNVSLLSDTLGETFKLRISAHALRSVE 91

Query: 61  RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKSS 97
            +GGLD +L  +    LS + R ++  I +K +E ++
Sbjct: 92  HRGGLDNYLMKATDAQLSDKARQVKVAIKRKQAEAAA 128


>gi|220924387|ref|YP_002499689.1| 50S ribosomal protein L28 [Methylobacterium nodulans ORS 2060]
 gi|254801368|sp|B8ICZ4|RL28_METNO RecName: Full=50S ribosomal protein L28
 gi|219948994|gb|ACL59386.1| ribosomal protein L28 [Methylobacterium nodulans ORS 2060]
          Length = 96

 Score =  107 bits (267), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 72/96 (75%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT K V++G+ VSH+N KT+RRFLPNLC++TL+SD + +  +LRIS  ALRSVE
Sbjct: 1  MSRRCELTGKAVLTGHLVSHSNRKTKRRFLPNLCKVTLLSDTLGRSVRLRISANALRSVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKS 96
           +GGLD FL  + ++ LS   R L+ +I KK++E +
Sbjct: 61 HRGGLDAFLVKAGEQELSQNARLLKREIEKKLAEAA 96


>gi|126725204|ref|ZP_01741047.1| 50S ribosomal protein L28 [Rhodobacterales bacterium HTCC2150]
 gi|126706368|gb|EBA05458.1| 50S ribosomal protein L28 [Rhodobacterales bacterium HTCC2150]
          Length = 99

 Score =  107 bits (266), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 52/88 (59%), Positives = 62/88 (70%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVCELT K  MSGN VSHA N+TRRRFLPNL  ITL SD   Q YQLRIS  ALR+V+
Sbjct: 4  MSRVCELTGKGPMSGNNVSHAKNRTRRRFLPNLNAITLQSDATGQSYQLRISAAALRTVD 63

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQI 88
           +GGLD F++ +K   LS +   ++  I
Sbjct: 64 HRGGLDAFMAKAKDTELSTKALKIKKDI 91


>gi|110678983|ref|YP_681990.1| ribosomal protein L28 [Roseobacter denitrificans OCh 114]
 gi|109455099|gb|ABG31304.1| ribosomal protein L28 [Roseobacter denitrificans OCh 114]
          Length = 120

 Score =  105 bits (263), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 49/90 (54%), Positives = 66/90 (73%)

Query: 1   MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
           MSRVCELT K  M+GN VSHANNKTRRRFLPNL  +TL S+ + + ++ RIS  ALR+V+
Sbjct: 22  MSRVCELTGKGPMTGNNVSHANNKTRRRFLPNLNDVTLQSEALGRGFKFRISAAALRTVD 81

Query: 61  RQGGLDRFLSNSKKENLSARMRTLRSQILK 90
            +GGLD+F++ +K  +LSA    ++  I K
Sbjct: 82  HRGGLDKFMAKAKDSDLSANALKVKKAISK 111


>gi|170741827|ref|YP_001770482.1| 50S ribosomal protein L28 [Methylobacterium sp. 4-46]
 gi|226732838|sp|B0UCJ9|RL28_METS4 RecName: Full=50S ribosomal protein L28
 gi|168196101|gb|ACA18048.1| ribosomal protein L28 [Methylobacterium sp. 4-46]
          Length = 96

 Score =  105 bits (261), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 71/96 (73%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT K V++G+ VSH+N KT+RRFLPNLC +TL+SD + +  +LRIS  ALRSVE
Sbjct: 1  MSRRCELTGKAVLTGHLVSHSNRKTKRRFLPNLCNVTLLSDTLGRSVRLRISANALRSVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKS 96
           +GGLD FL  + +++LS   R L+ +I KK++  +
Sbjct: 61 HRGGLDAFLVKAGEQDLSQNARLLKREIEKKLAAAA 96


>gi|118592089|ref|ZP_01549483.1| 50S ribosomal protein L28 [Stappia aggregata IAM 12614]
 gi|118435385|gb|EAV42032.1| 50S ribosomal protein L28 [Stappia aggregata IAM 12614]
          Length = 98

 Score =  105 bits (261), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 47/97 (48%), Positives = 70/97 (72%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+R CEL+ K VM+GN VSHANN++RRRFLPNLC ++LISD + + ++L++   ALRSVE
Sbjct: 1  MARRCELSGKDVMTGNNVSHANNRSRRRFLPNLCNVSLISDTLGETFKLKVCAHALRSVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKSS 97
           +GGLD +L  +   +LS   R ++  I +K +E ++
Sbjct: 61 HRGGLDAYLMKASDADLSDAARKIKVDIKRKQAEAAA 97


>gi|163734100|ref|ZP_02141541.1| ribosomal protein L28 [Roseobacter litoralis Och 149]
 gi|161392636|gb|EDQ16964.1| ribosomal protein L28 [Roseobacter litoralis Och 149]
          Length = 99

 Score =  104 bits (260), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 49/90 (54%), Positives = 65/90 (72%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVCELT K  M+GN VSHANNKTRRRFLPNL  +TL S+ + + ++ RIS  ALR+V+
Sbjct: 1  MSRVCELTGKGPMTGNNVSHANNKTRRRFLPNLNDVTLQSETLGRAFKFRISAAALRTVD 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILK 90
           +GGLD+F+  +K  +LSA    ++  I K
Sbjct: 61 HRGGLDKFMEKAKDSDLSANALKVKKAIGK 90


>gi|103488227|ref|YP_617788.1| 50S ribosomal protein L28 [Sphingopyxis alaskensis RB2256]
 gi|123379514|sp|Q1GPG7|RL28_SPHAL RecName: Full=50S ribosomal protein L28
 gi|98978304|gb|ABF54455.1| LSU ribosomal protein L28P [Sphingopyxis alaskensis RB2256]
          Length = 97

 Score =  104 bits (259), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 49/97 (50%), Positives = 68/97 (70%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR+CELT K    G+ VSHANNKT+R FLPNL  +TL+SD + +  +LR+S   LRSVE
Sbjct: 1  MSRICELTGKGRQIGHNVSHANNKTKRTFLPNLQNVTLLSDALGKSVKLRVSTHGLRSVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKSS 97
            GGLD +L  +  + LSA  R L+ ++ KK++EK++
Sbjct: 61 HNGGLDNWLMKTGDDQLSANARKLKKEVAKKLAEKAA 97


>gi|99080512|ref|YP_612666.1| 50S ribosomal protein L28 [Ruegeria sp. TM1040]
 gi|122398295|sp|Q1GIW2|RL28_SILST RecName: Full=50S ribosomal protein L28
 gi|99036792|gb|ABF63404.1| LSU ribosomal protein L28P [Ruegeria sp. TM1040]
          Length = 96

 Score =  104 bits (259), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 68/96 (70%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT K  M+GN VSHANNKT+RRFLPNL  +TL S+ + +  +LRIS  ALRSV+
Sbjct: 1  MSRRCELTGKGPMTGNNVSHANNKTKRRFLPNLNDVTLQSETLGRGVKLRISAAALRSVD 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKS 96
           +GGLD FL+ +K E LSA    ++ +I K  + ++
Sbjct: 61 HRGGLDAFLAKAKDEELSAAALKVKKEIAKAQAAEA 96


>gi|260427227|ref|ZP_05781206.1| 50S ribosomal protein L28 [Citreicella sp. SE45]
 gi|260421719|gb|EEX14970.1| 50S ribosomal protein L28 [Citreicella sp. SE45]
          Length = 96

 Score =  103 bits (258), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 68/96 (70%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVCELT K  M+G+ VSHANNKT+RRFLPNL  +TL S+ + +  +LRIS  ALRSV+
Sbjct: 1  MSRVCELTGKGPMTGHNVSHANNKTKRRFLPNLNDVTLQSETLGRGVKLRISASALRSVD 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKS 96
           +GGLD+FL+ +K   LS     L+ +I K  + K+
Sbjct: 61 HRGGLDKFLAKAKDTELSTNALKLKKEIAKAQAAKA 96


>gi|260431018|ref|ZP_05784989.1| 50S ribosomal protein L28 [Silicibacter lacuscaerulensis ITI-1157]
 gi|260414846|gb|EEX08105.1| 50S ribosomal protein L28 [Silicibacter lacuscaerulensis ITI-1157]
          Length = 106

 Score =  103 bits (256), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 50/90 (55%), Positives = 65/90 (72%)

Query: 1   MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
           MSR CELT K  M+GN VSHANNKT+RRFLPNL  +TL S+ + +  +LRIS  ALRSV+
Sbjct: 12  MSRRCELTGKGPMTGNNVSHANNKTKRRFLPNLNDVTLQSETLGRGVKLRISAAALRSVD 71

Query: 61  RQGGLDRFLSNSKKENLSARMRTLRSQILK 90
            +GGLD FL+ +K E+LS     ++ +I K
Sbjct: 72  HRGGLDAFLAKAKDEDLSPNALKVKKEIAK 101


>gi|56695875|ref|YP_166226.1| 50S ribosomal protein L28 [Ruegeria pomeroyi DSS-3]
 gi|67461277|sp|Q5LUS9|RL28_SILPO RecName: Full=50S ribosomal protein L28
 gi|56677612|gb|AAV94278.1| ribosomal protein L28 [Ruegeria pomeroyi DSS-3]
          Length = 95

 Score =  103 bits (256), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 51/90 (56%), Positives = 65/90 (72%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT K  M+GN VSHANNKTRRRFLPNL  +TL S+ + +  +LRIS  ALRSV+
Sbjct: 1  MSRRCELTGKGPMTGNNVSHANNKTRRRFLPNLNDVTLQSETLGRGVKLRISAAALRSVD 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILK 90
           +GGLD FL+ +K E+LS     ++ +I K
Sbjct: 61 HRGGLDAFLAKAKDEDLSDAALKVKKEIAK 90


>gi|332185549|ref|ZP_08387297.1| ribosomal protein L28 [Sphingomonas sp. S17]
 gi|332014527|gb|EGI56584.1| ribosomal protein L28 [Sphingomonas sp. S17]
          Length = 102

 Score =  102 bits (255), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 50/92 (54%), Positives = 64/92 (69%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR+CELT K    GN VSHANNKT+R FLPNL  +TLISD +E+  +LR+S   LRSVE
Sbjct: 1  MSRICELTGKGRQVGNNVSHANNKTKRTFLPNLQNVTLISDALEKSVRLRVSTHGLRSVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKM 92
            GGLD +L  +  + LS R R L+  ++KK+
Sbjct: 61 HNGGLDNWLVKTSDDQLSLRARRLKRDVVKKL 92


>gi|84687464|ref|ZP_01015341.1| ribosomal protein L28 [Maritimibacter alkaliphilus HTCC2654]
 gi|84664489|gb|EAQ10976.1| ribosomal protein L28 [Rhodobacterales bacterium HTCC2654]
          Length = 95

 Score =  102 bits (255), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 47/90 (52%), Positives = 66/90 (73%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVCELT K   +GN VSHANNKT+RRFLPNL  ++L+S+ + +  + RIS  ALR+V+
Sbjct: 1  MSRVCELTGKGPATGNNVSHANNKTKRRFLPNLNDVSLVSETLGRPIKFRISASALRTVD 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILK 90
           +GGLD+FL+ +K   LSA+   ++ +I K
Sbjct: 61 HRGGLDKFLAKAKDAELSAKALKVKKEIAK 90


>gi|296447501|ref|ZP_06889424.1| ribosomal protein L28 [Methylosinus trichosporium OB3b]
 gi|296254968|gb|EFH02072.1| ribosomal protein L28 [Methylosinus trichosporium OB3b]
          Length = 98

 Score =  102 bits (255), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 51/97 (52%), Positives = 67/97 (69%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT K V +GN VSH+N KTR RFLPNL  +TL SD + +  +LR+S  ALRSVE
Sbjct: 1  MSRRCELTGKGVQTGNLVSHSNRKTRTRFLPNLVNVTLASDALARSVRLRVSAAALRSVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKSS 97
           +GGLD FL  +++  LS   R L+ +I KK++  +S
Sbjct: 61 HRGGLDAFLLKARETELSDDARALKREIAKKLATAAS 97


>gi|114764005|ref|ZP_01443246.1| ribosomal protein L28 [Pelagibaca bermudensis HTCC2601]
 gi|114543597|gb|EAU46611.1| ribosomal protein L28 [Roseovarius sp. HTCC2601]
          Length = 96

 Score =  102 bits (254), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 50/90 (55%), Positives = 65/90 (72%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVCELT K  M+G+ VSHANNKT+RRFLPNL  +TL S+ + +  +LRIS  ALRSV+
Sbjct: 1  MSRVCELTGKGPMTGHNVSHANNKTKRRFLPNLNDVTLQSETLGRGVKLRISASALRSVD 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILK 90
           +GGLD+FL  +K   LSA    ++ +I K
Sbjct: 61 HRGGLDKFLDKAKDAELSATALKVKKEIAK 90


>gi|254476141|ref|ZP_05089527.1| ribosomal protein L28 [Ruegeria sp. R11]
 gi|214030384|gb|EEB71219.1| ribosomal protein L28 [Ruegeria sp. R11]
          Length = 96

 Score =  102 bits (253), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 50/90 (55%), Positives = 65/90 (72%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT K  M+GN VSHANNKT+RRFLPNL  +TL S+ + +  +LRIS  ALRSV+
Sbjct: 1  MSRRCELTGKGPMTGNNVSHANNKTKRRFLPNLNDVTLQSETLGRGVKLRISAAALRSVD 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILK 90
           +GGLD FL+ +K E LS+    ++ +I K
Sbjct: 61 HRGGLDAFLAKAKDEELSSAALKVKKEIAK 90


>gi|304321693|ref|YP_003855336.1| 50S ribosomal protein L28 [Parvularcula bermudensis HTCC2503]
 gi|303300595|gb|ADM10194.1| ribosomal protein L28 [Parvularcula bermudensis HTCC2503]
          Length = 94

 Score =  101 bits (252), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 49/93 (52%), Positives = 67/93 (72%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVCE T K  ++G+ VSHANNKT+RRF PNLC++TL S+ + ++++ RI+  ALRSV+
Sbjct: 1  MSRVCEFTGKRPITGHNVSHANNKTKRRFEPNLCKVTLESERLSRRFKFRITAHALRSVD 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMS 93
            GGLD FL  +K E LS R R L+ +I+   S
Sbjct: 61 HVGGLDAFLLKAKDERLSDRARRLKREIVAAAS 93


>gi|221638418|ref|YP_002524680.1| 50S ribosomal protein L28 [Rhodobacter sphaeroides KD131]
 gi|332557448|ref|ZP_08411770.1| 50S ribosomal protein L28 [Rhodobacter sphaeroides WS8N]
 gi|221159199|gb|ACM00179.1| 50S ribosomal protein L28 [Rhodobacter sphaeroides KD131]
 gi|332275160|gb|EGJ20475.1| 50S ribosomal protein L28 [Rhodobacter sphaeroides WS8N]
          Length = 84

 Score =  101 bits (252), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 61/78 (78%)

Query: 13 MSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFLSNS 72
          M+GN VSHANNK+RRRFLPNL  +TLISD++ Q ++LRIS  ALR+V+ +GGLD FL+ +
Sbjct: 1  MTGNTVSHANNKSRRRFLPNLNDVTLISDVLGQSFKLRISAAALRTVDHRGGLDAFLAKA 60

Query: 73 KKENLSARMRTLRSQILK 90
          K + LS + R ++ +I K
Sbjct: 61 KDDELSVKARAIKKEIEK 78


>gi|126739957|ref|ZP_01755647.1| ribosomal protein L28 [Roseobacter sp. SK209-2-6]
 gi|126718776|gb|EBA15488.1| ribosomal protein L28 [Roseobacter sp. SK209-2-6]
          Length = 114

 Score =  101 bits (252), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 67/96 (69%)

Query: 1   MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
           MSR CELT K  M+GN VSHANNKT+RRFLPNL  +TL S+ + +  +LRIS  ALRSV+
Sbjct: 19  MSRRCELTGKGPMTGNNVSHANNKTKRRFLPNLNDVTLQSETLGRGIKLRISAAALRSVD 78

Query: 61  RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKS 96
            +GGLD FL+ +K + LS     ++ +I K  + ++
Sbjct: 79  HRGGLDAFLAKAKDDELSTAALKVKKEIAKAQAAEA 114


>gi|323137532|ref|ZP_08072609.1| ribosomal protein L28 [Methylocystis sp. ATCC 49242]
 gi|322397158|gb|EFX99682.1| ribosomal protein L28 [Methylocystis sp. ATCC 49242]
          Length = 97

 Score =  101 bits (252), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 52/97 (53%), Positives = 66/97 (68%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT K V +GN VSH+N KTR RFLPNL  +TL S+ + +  +LRIS  ALRSVE
Sbjct: 1  MSRRCELTGKGVQTGNLVSHSNRKTRTRFLPNLVNVTLASEALARSVRLRISAAALRSVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKSS 97
           +GGLD FL  ++ E LS   R L+ +I KK S  ++
Sbjct: 61 HRGGLDAFLVKARDEELSQNARVLKREIEKKQSAATA 97


>gi|126731524|ref|ZP_01747330.1| ribosomal protein L28 [Sagittula stellata E-37]
 gi|126708060|gb|EBA07120.1| ribosomal protein L28 [Sagittula stellata E-37]
          Length = 95

 Score =  101 bits (251), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 50/90 (55%), Positives = 65/90 (72%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVCELT K  M GN VSHANNKT+RR+LPNL  +TL S+ + +  +LRIS  ALRSV+
Sbjct: 1  MSRVCELTGKGPMVGNNVSHANNKTKRRYLPNLNDVTLQSETLGRGVKLRISAHALRSVD 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILK 90
           +GGLD+FL+ +K   LS R   ++ +I K
Sbjct: 61 HRGGLDKFLAKAKDTELSDRALKVKKEIAK 90


>gi|114769311|ref|ZP_01446937.1| ribosomal protein L28 [alpha proteobacterium HTCC2255]
 gi|114550228|gb|EAU53109.1| ribosomal protein L28 [alpha proteobacterium HTCC2255]
          Length = 96

 Score =  100 bits (250), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 46/96 (47%), Positives = 65/96 (67%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT K  M+GN VSHA N+TRRRFLPNL  +TL SD++ Q ++ +IS  ALR+V+
Sbjct: 1  MSRRCELTGKGPMTGNNVSHAKNRTRRRFLPNLNDVTLASDVLGQAFKFKISAAALRTVD 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKS 96
           +GGLD F++ +K   LS +   ++  I K  +  +
Sbjct: 61 HRGGLDAFMAKAKDAELSEKALKVKRDIAKATAPAA 96


>gi|158422171|ref|YP_001523463.1| 50S ribosomal protein L28 [Azorhizobium caulinodans ORS 571]
 gi|172048038|sp|A8IMG3|RL28_AZOC5 RecName: Full=50S ribosomal protein L28
 gi|158329060|dbj|BAF86545.1| ribosomal protein L28 [Azorhizobium caulinodans ORS 571]
          Length = 99

 Score =  100 bits (249), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 47/90 (52%), Positives = 69/90 (76%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR C+LT K V++G+ VSH+N KT+RRFLPNLC +TL SD++++  ++RIS  AL+SV+
Sbjct: 1  MSRRCDLTGKAVLTGHLVSHSNRKTKRRFLPNLCNVTLQSDVLQRSIRVRISANALKSVD 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILK 90
           +GGLD FL  ++ E L+ R+  L+ QI+K
Sbjct: 61 HRGGLDAFLLKARDEELAPRVLELKRQIVK 90


>gi|159045123|ref|YP_001533917.1| 50S ribosomal protein L28 [Dinoroseobacter shibae DFL 12]
 gi|189029438|sp|A8LHY2|RL28_DINSH RecName: Full=50S ribosomal protein L28
 gi|157912883|gb|ABV94316.1| 50S ribosomal protein L28 [Dinoroseobacter shibae DFL 12]
          Length = 95

 Score =  100 bits (249), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 48/90 (53%), Positives = 64/90 (71%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT K V  GN VSHANNKT+RRFLPNL  +TL+S+ + + ++LRIS  ALR+V+
Sbjct: 1  MSRRCELTGKGVQVGNNVSHANNKTKRRFLPNLNDVTLMSETLGRGFKLRISAAALRTVD 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILK 90
           +GGLD FL+ +K   LS +   ++  I K
Sbjct: 61 HRGGLDSFLAKAKDAELSEKALKIKKDIAK 90


>gi|84499546|ref|ZP_00997834.1| ribosomal protein L28 [Oceanicola batsensis HTCC2597]
 gi|84392690|gb|EAQ04901.1| ribosomal protein L28 [Oceanicola batsensis HTCC2597]
          Length = 95

 Score =  100 bits (248), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 49/90 (54%), Positives = 65/90 (72%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT K  M+GN VSHANNKTRRRFLPNL  ++L S+ + +  +LRIS  ALR+V+
Sbjct: 1  MSRRCELTGKGPMTGNNVSHANNKTRRRFLPNLNDVSLRSEALGRNIKLRISAAALRTVD 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILK 90
           +GGLD+FL+ +K   LSA    ++ +I K
Sbjct: 61 HRGGLDKFLAKAKDSELSANALKVKKEIAK 90


>gi|89069017|ref|ZP_01156398.1| ribosomal protein L28 [Oceanicola granulosus HTCC2516]
 gi|89045386|gb|EAR51451.1| ribosomal protein L28 [Oceanicola granulosus HTCC2516]
          Length = 93

 Score =  100 bits (248), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 45/79 (56%), Positives = 60/79 (75%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT K  M+GN VSHA+NKTRRRFLPNL  +TL SD++ + ++ R+S  ALR+V+
Sbjct: 1  MSRRCELTGKGPMTGNNVSHAHNKTRRRFLPNLQDVTLQSDVLGRSFKFRVSSAALRTVD 60

Query: 61 RQGGLDRFLSNSKKENLSA 79
           +GGLD F++ +K   LSA
Sbjct: 61 HRGGLDAFMARAKDAELSA 79


>gi|84514439|ref|ZP_01001803.1| ribosomal protein L28 [Loktanella vestfoldensis SKA53]
 gi|84511490|gb|EAQ07943.1| ribosomal protein L28 [Loktanella vestfoldensis SKA53]
          Length = 95

 Score = 99.8 bits (247), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 47/90 (52%), Positives = 64/90 (71%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT K  MSGN VSHA N TRRRFLPNL  +TL SD++ + ++L+IS  ALR+V+
Sbjct: 1  MSRRCELTGKGPMSGNNVSHAKNHTRRRFLPNLQDVTLQSDVLGRSFKLKISNAALRTVD 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILK 90
           +GGLD F++ +K+  LS     ++ +I K
Sbjct: 61 HRGGLDAFMAKAKEAELSPDALKIKKEIAK 90


>gi|149913435|ref|ZP_01901968.1| ribosomal protein L28 [Roseobacter sp. AzwK-3b]
 gi|149812555|gb|EDM72384.1| ribosomal protein L28 [Roseobacter sp. AzwK-3b]
          Length = 96

 Score = 99.8 bits (247), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 51/90 (56%), Positives = 64/90 (71%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT K  MSG   SHANNKT+RR+LPNL  +TL S+I+ +  +LRIS  ALRSV+
Sbjct: 1  MSRRCELTGKGPMSGFNSSHANNKTKRRYLPNLQDVTLQSEILNRGVKLRISAAALRSVD 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILK 90
           +GGLD FL+ +K E LSA    L+ +I K
Sbjct: 61 HRGGLDAFLAKAKDEELSANALKLKKEISK 90


>gi|254511086|ref|ZP_05123153.1| ribosomal protein L28 [Rhodobacteraceae bacterium KLH11]
 gi|221534797|gb|EEE37785.1| ribosomal protein L28 [Rhodobacteraceae bacterium KLH11]
          Length = 95

 Score = 99.4 bits (246), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 49/90 (54%), Positives = 64/90 (71%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT K  M+GN VSHA N+TRRRFLPNL  +TL S+ + +  +LRIS  ALRSV+
Sbjct: 1  MSRRCELTGKGPMTGNNVSHAKNRTRRRFLPNLNDVTLQSETLGRGVKLRISAAALRSVD 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILK 90
           +GGLD FL+ +K + LSA    ++ +I K
Sbjct: 61 HRGGLDAFLAKAKDDELSANALKVKKEIAK 90


>gi|259419342|ref|ZP_05743259.1| 50S ribosomal protein L28 [Silicibacter sp. TrichCH4B]
 gi|259345564|gb|EEW57418.1| 50S ribosomal protein L28 [Silicibacter sp. TrichCH4B]
          Length = 96

 Score = 99.4 bits (246), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 66/96 (68%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT K  M+GN VSHANNKT+RRFLPNL  +TL S+ + +  +LRIS  ALRSV+
Sbjct: 1  MSRRCELTGKGPMTGNNVSHANNKTKRRFLPNLNDVTLQSETLGRGVKLRISAAALRSVD 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKS 96
           +GGLD FL+ +K   LS     ++ +I K  + ++
Sbjct: 61 HRGGLDAFLAKAKDAELSDAALKVKKEIAKAQAAQA 96


>gi|298293653|ref|YP_003695592.1| ribosomal protein L28 [Starkeya novella DSM 506]
 gi|296930164|gb|ADH90973.1| ribosomal protein L28 [Starkeya novella DSM 506]
          Length = 102

 Score = 99.0 bits (245), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 46/90 (51%), Positives = 66/90 (73%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT K V++GN VSH+N KTRRRFLPNL  +TL SD++++  +LR+S  AL++V+
Sbjct: 1  MSRRCELTGKAVLTGNLVSHSNRKTRRRFLPNLVNVTLTSDVLKRSVKLRVSANALKTVD 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILK 90
           +GGLD FL  ++ E LS +   L+  ++K
Sbjct: 61 HRGGLDAFLIKARTEELSPKAAELKRAVVK 90


>gi|163737710|ref|ZP_02145127.1| GTP-binding protein LepA [Phaeobacter gallaeciensis BS107]
 gi|163744072|ref|ZP_02151439.1| ribosomal protein L28 [Phaeobacter gallaeciensis 2.10]
 gi|161382688|gb|EDQ07090.1| ribosomal protein L28 [Phaeobacter gallaeciensis 2.10]
 gi|161389236|gb|EDQ13588.1| GTP-binding protein LepA [Phaeobacter gallaeciensis BS107]
          Length = 96

 Score = 99.0 bits (245), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 67/96 (69%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT K  M+GN VSHANNKT+RRFLPNL  +TL S+ + +  +LRIS  ALR+V+
Sbjct: 1  MSRRCELTGKGPMTGNNVSHANNKTKRRFLPNLNDVTLQSETLNRGIKLRISAAALRTVD 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKS 96
           +GGLD FL+ +K + LS     ++ +I K  + ++
Sbjct: 61 HRGGLDAFLAKAKDDELSNTALKVKKEIAKAQAAEA 96


>gi|83859714|ref|ZP_00953234.1| ribosomal protein L28 [Oceanicaulis alexandrii HTCC2633]
 gi|83852073|gb|EAP89927.1| ribosomal protein L28 [Oceanicaulis alexandrii HTCC2633]
          Length = 95

 Score = 98.6 bits (244), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 46/79 (58%), Positives = 60/79 (75%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT    +SGN VSHANNKT+RRFLPNLC++TL S+ + + ++LRI+  ALRSV+
Sbjct: 1  MSRRCELTGTGPVSGNNVSHANNKTKRRFLPNLCQVTLASEALGRSFRLRIAAKALRSVD 60

Query: 61 RQGGLDRFLSNSKKENLSA 79
            GGLD+FL  ++ E LS 
Sbjct: 61 HVGGLDQFLLKARDEQLSG 79


>gi|83943974|ref|ZP_00956431.1| ribosomal protein L28 [Sulfitobacter sp. EE-36]
 gi|83954547|ref|ZP_00963258.1| ribosomal protein L28 [Sulfitobacter sp. NAS-14.1]
 gi|83840831|gb|EAP80002.1| ribosomal protein L28 [Sulfitobacter sp. NAS-14.1]
 gi|83845221|gb|EAP83101.1| ribosomal protein L28 [Sulfitobacter sp. EE-36]
          Length = 99

 Score = 98.6 bits (244), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 46/90 (51%), Positives = 63/90 (70%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVCELT K  M+GN VSHA N+TRRRFLPNL  +TL S+ + + ++ RIS  ALR+V+
Sbjct: 1  MSRVCELTGKGPMTGNNVSHAKNRTRRRFLPNLNDVTLQSEALGRGFKFRISAAALRTVD 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILK 90
           +GGLD+F++ +K   LS     ++  I K
Sbjct: 61 HRGGLDKFMAKAKDTELSVNALKVKKAIAK 90


>gi|254451826|ref|ZP_05065263.1| ribosomal protein L28 [Octadecabacter antarcticus 238]
 gi|198266232|gb|EDY90502.1| ribosomal protein L28 [Octadecabacter antarcticus 238]
          Length = 96

 Score = 98.6 bits (244), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 47/90 (52%), Positives = 62/90 (68%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT K  MSGN VSHA N+TRRRFLPNL  ++L+SD + + ++ RIS  ALR+V+
Sbjct: 1  MSRRCELTGKGPMSGNNVSHAKNRTRRRFLPNLQDVSLMSDSLGRSFKFRISNAALRTVD 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILK 90
           +GGLD F + SK   LS     ++  I+K
Sbjct: 61 HRGGLDAFFAKSKDAELSPAALKVKKDIVK 90


>gi|254486876|ref|ZP_05100081.1| ribosomal protein L28 [Roseobacter sp. GAI101]
 gi|214043745|gb|EEB84383.1| ribosomal protein L28 [Roseobacter sp. GAI101]
          Length = 100

 Score = 98.2 bits (243), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 46/90 (51%), Positives = 63/90 (70%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVCELT K  M+GN VSHA N+TRRRFLPNL  +TL S+ + + ++ RIS  ALR+V+
Sbjct: 1  MSRVCELTGKGPMTGNNVSHAKNRTRRRFLPNLNDVTLQSESLGRSFKFRISAAALRTVD 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILK 90
           +GGLD+F++ +K   LS     ++  I K
Sbjct: 61 HRGGLDKFMAKAKDTELSGNALKVKKAIAK 90


>gi|294085472|ref|YP_003552232.1| 50S ribosomal protein L28P [Candidatus Puniceispirillum marinum
          IMCC1322]
 gi|292665047|gb|ADE40148.1| LSU ribosomal protein L28P [Candidatus Puniceispirillum marinum
          IMCC1322]
          Length = 95

 Score = 98.2 bits (243), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 43/89 (48%), Positives = 68/89 (76%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M++ C++T KTVM+GN VSHANN+TRRRFLPNL + ++ S+I+++K  LRIS  A+R+VE
Sbjct: 1  MAKRCQITGKTVMAGNNVSHANNRTRRRFLPNLQQASMQSEILDRKISLRISTSAIRTVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQIL 89
          + GG+D FL  ++   L+   R+L+ +++
Sbjct: 61 KHGGIDAFLMQARNSELADEARSLKREMM 89


>gi|241760862|ref|ZP_04758951.1| ribosomal protein L28 [Zymomonas mobilis subsp. mobilis ATCC
          10988]
 gi|260753168|ref|YP_003226061.1| 50S ribosomal protein L28 [Zymomonas mobilis subsp. mobilis NCIMB
          11163]
 gi|283856227|ref|YP_162029.2| 50S ribosomal protein L28 [Zymomonas mobilis subsp. mobilis ZM4]
 gi|48474640|sp|Q9FDL9|RL28_ZYMMO RecName: Full=50S ribosomal protein L28
 gi|9931340|gb|AAG02150.1|AF212041_6 50S ribosomal protein L28 [Zymomonas mobilis subsp. mobilis ZM4]
 gi|241374481|gb|EER63942.1| ribosomal protein L28 [Zymomonas mobilis subsp. mobilis ATCC
          10988]
 gi|258552531|gb|ACV75477.1| ribosomal protein L28 [Zymomonas mobilis subsp. mobilis NCIMB
          11163]
 gi|283775222|gb|AAV88918.2| ribosomal protein L28 [Zymomonas mobilis subsp. mobilis ZM4]
          Length = 95

 Score = 98.2 bits (243), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 48/93 (51%), Positives = 63/93 (67%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR+CELT K    GN VSHANN+T+R FLPNL  +TLISD + +   LR+S   LRSVE
Sbjct: 1  MSRICELTGKGRQVGNNVSHANNRTKRTFLPNLQNVTLISDALGKGVTLRVSTHGLRSVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMS 93
            GGLD +L  +K E LS R   ++ ++ KK++
Sbjct: 61 HVGGLDNWLLKTKNEKLSTRALKVKREVAKKLA 93


>gi|182680325|ref|YP_001834471.1| 50S ribosomal protein L28 [Beijerinckia indica subsp. indica ATCC
          9039]
 gi|226738033|sp|B2IEP2|RL28_BEII9 RecName: Full=50S ribosomal protein L28
 gi|182636208|gb|ACB96982.1| ribosomal protein L28 [Beijerinckia indica subsp. indica ATCC
          9039]
          Length = 98

 Score = 97.8 bits (242), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 45/89 (50%), Positives = 62/89 (69%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT K V++GN VSH+N KTR RFLPNLC +TLISD ++++   R++   LRSVE
Sbjct: 1  MSRRCELTGKAVLTGNLVSHSNRKTRTRFLPNLCNVTLISDTLQRRIHFRVAAATLRSVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQIL 89
           +GGLD FL  +    LS    +++ +I+
Sbjct: 61 HRGGLDAFLVKAADAQLSPGALSVKREIV 89


>gi|297182661|gb|ADI18819.1| ribosomal protein l28 [uncultured SAR11 cluster bacterium
           HF4000_37C10]
          Length = 108

 Score = 97.4 bits (241), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 46/91 (50%), Positives = 65/91 (71%)

Query: 1   MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
           MSR CELT K+ + G+KVSHANNKT+R+F PNL ++T  S I+ +  +L++S  ALR+V+
Sbjct: 17  MSRKCELTGKSPLKGHKVSHANNKTKRKFFPNLKKVTFKSKILRRNIKLQVSNAALRTVD 76

Query: 61  RQGGLDRFLSNSKKENLSARMRTLRSQILKK 91
            +GGLD FL   K   LS R + L++QI+ K
Sbjct: 77  YKGGLDNFLKTVKTHKLSKRAKGLKNQIITK 107


>gi|163747248|ref|ZP_02154603.1| ribosomal protein L28 [Oceanibulbus indolifex HEL-45]
 gi|161379523|gb|EDQ03937.1| ribosomal protein L28 [Oceanibulbus indolifex HEL-45]
          Length = 99

 Score = 97.4 bits (241), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 47/90 (52%), Positives = 64/90 (71%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT K  M+GN VSHANN+TRRRFLPNL  ++L S+ + + ++LRIS  ALR+V+
Sbjct: 1  MSRRCELTGKGPMTGNNVSHANNRTRRRFLPNLNDVSLQSEALGRAFKLRISAAALRTVD 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILK 90
           +GGLD+FL+ +K   LS     ++  I K
Sbjct: 61 HRGGLDKFLAKAKDVELSDNALKIKKAIAK 90


>gi|163852395|ref|YP_001640438.1| ribosomal protein L28 [Methylobacterium extorquens PA1]
 gi|218531154|ref|YP_002421970.1| 50S ribosomal protein L28 [Methylobacterium chloromethanicum CM4]
 gi|240139729|ref|YP_002964206.1| 50S ribosomal protein L28 [Methylobacterium extorquens AM1]
 gi|254562142|ref|YP_003069237.1| 50S ribosomal protein L28 [Methylobacterium extorquens DM4]
 gi|226732834|sp|A9W6T5|RL28_METEP RecName: Full=50S ribosomal protein L28
 gi|254801367|sp|B7KT12|RL28_METC4 RecName: Full=50S ribosomal protein L28
 gi|163664000|gb|ABY31367.1| ribosomal protein L28 [Methylobacterium extorquens PA1]
 gi|218523457|gb|ACK84042.1| ribosomal protein L28 [Methylobacterium chloromethanicum CM4]
 gi|240009703|gb|ACS40929.1| 50S ribosomal protein L28 [Methylobacterium extorquens AM1]
 gi|254269420|emb|CAX25386.1| 50S ribosomal protein L28 [Methylobacterium extorquens DM4]
          Length = 101

 Score = 97.4 bits (241), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 49/97 (50%), Positives = 69/97 (71%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT K V  G+ VSH+N KT+ RFLPNLC +TL SD + ++ +LR++  ALRSVE
Sbjct: 1  MSRRCELTGKAVQVGHLVSHSNRKTKCRFLPNLCNVTLQSDTLNRRVRLRVTAHALRSVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKSS 97
           +GGLD FL  +++  LS   R L+ +I KK++E ++
Sbjct: 61 HRGGLDAFLVKAREIELSQTARLLKREIEKKIAEPAT 97


>gi|149202032|ref|ZP_01879005.1| 50S ribosomal protein L28 [Roseovarius sp. TM1035]
 gi|149144130|gb|EDM32161.1| 50S ribosomal protein L28 [Roseovarius sp. TM1035]
          Length = 96

 Score = 97.4 bits (241), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 49/90 (54%), Positives = 63/90 (70%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT K  M GN  SHANNKTRRR+LPNL  +TL S+ + +  +LRIS  ALRSV+
Sbjct: 1  MSRRCELTGKGPMVGNNSSHANNKTRRRYLPNLNDVTLQSETLNRGIKLRISAHALRSVD 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILK 90
           +GGLD FL+ +K + LSA    ++ +I K
Sbjct: 61 HRGGLDAFLAKAKDDELSASALKVKKEIAK 90


>gi|310816617|ref|YP_003964581.1| 50S ribosomal protein L28 [Ketogulonicigenium vulgare Y25]
 gi|308755352|gb|ADO43281.1| 50S ribosomal protein L28 [Ketogulonicigenium vulgare Y25]
          Length = 98

 Score = 97.4 bits (241), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 47/88 (53%), Positives = 61/88 (69%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT K  M GN VSHANNKT+RRFLPNL  +TL SD++ + + LR+S   LRSV+
Sbjct: 1  MSRRCELTGKGPMVGNNVSHANNKTKRRFLPNLQDVTLQSDVLGRSFTLRVSAAGLRSVD 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQI 88
           +GGLD +L+ +K   LS     L+ +I
Sbjct: 61 HRGGLDAYLARAKDVELSDNALKLKKEI 88


>gi|170750100|ref|YP_001756360.1| ribosomal protein L28 [Methylobacterium radiotolerans JCM 2831]
 gi|226732837|sp|B1LW27|RL28_METRJ RecName: Full=50S ribosomal protein L28
 gi|170656622|gb|ACB25677.1| ribosomal protein L28 [Methylobacterium radiotolerans JCM 2831]
          Length = 100

 Score = 97.1 bits (240), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 48/97 (49%), Positives = 68/97 (70%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+R CELT K V  G+ VSH+N KT+ RFLPNLC +TL SD + ++ +LR++  ALRSVE
Sbjct: 1  MARRCELTGKAVQVGHLVSHSNRKTKCRFLPNLCNVTLQSDALGKRVRLRVTAHALRSVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKSS 97
           +GGLD FL  + + +LS   R L+ +I KK++E  +
Sbjct: 61 HRGGLDAFLIKAGEGDLSQTARLLKREIHKKLAETPA 97


>gi|86136561|ref|ZP_01055140.1| ribosomal protein L28 [Roseobacter sp. MED193]
 gi|85827435|gb|EAQ47631.1| ribosomal protein L28 [Roseobacter sp. MED193]
          Length = 96

 Score = 97.1 bits (240), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 48/93 (51%), Positives = 64/93 (68%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT K  M+GN VSHA N+TRRRFLPNL  +TL S+ + +  +L+IS  ALR+V+
Sbjct: 1  MSRRCELTGKGPMTGNNVSHAKNRTRRRFLPNLNDVTLQSETLGRGIKLKISAAALRTVD 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMS 93
           +GGLD FL+ +K E LS     ++ +I K  S
Sbjct: 61 HRGGLDAFLAKAKDEELSTAALKVKKEIAKAQS 93


>gi|85703478|ref|ZP_01034582.1| ribosomal protein L28 [Roseovarius sp. 217]
 gi|85672406|gb|EAQ27263.1| ribosomal protein L28 [Roseovarius sp. 217]
          Length = 96

 Score = 97.1 bits (240), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 49/90 (54%), Positives = 63/90 (70%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT K  M GN  SHANNKTRRR+LPNL  +TL S+ + +  +LRIS  ALRSV+
Sbjct: 1  MSRRCELTGKGPMVGNNSSHANNKTRRRYLPNLNDVTLQSETLNRGIKLRISAHALRSVD 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILK 90
           +GGLD FL+ +K + LSA    ++ +I K
Sbjct: 61 HRGGLDAFLAKAKDDELSATALKVKKEIAK 90


>gi|312113448|ref|YP_004011044.1| ribosomal protein L28 [Rhodomicrobium vannielii ATCC 17100]
 gi|311218577|gb|ADP69945.1| ribosomal protein L28 [Rhodomicrobium vannielii ATCC 17100]
          Length = 102

 Score = 96.7 bits (239), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 49/90 (54%), Positives = 65/90 (72%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT K  + G+ VSH+N KT+RR+LPNLC +TLISD + +  +LRIS  ALRSVE
Sbjct: 1  MSRQCELTGKGGLVGHLVSHSNIKTKRRYLPNLCNVTLISDSLGRGVRLRISANALRSVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILK 90
           +GGLD FL  ++ E LS + R L+ ++ K
Sbjct: 61 HRGGLDAFLLKARDEELSLKARRLKKEVSK 90


>gi|262277628|ref|ZP_06055421.1| 50S ribosomal protein L28 [alpha proteobacterium HIMB114]
 gi|262224731|gb|EEY75190.1| 50S ribosomal protein L28 [alpha proteobacterium HIMB114]
          Length = 97

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 44/97 (45%), Positives = 73/97 (75%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+ +CELT K  MSG+KVSHANNKT+R+F PNL +++L S+++++   L+IS  AL++V+
Sbjct: 1  MANICELTGKRPMSGHKVSHANNKTKRKFFPNLKKVSLKSELLKKNVSLKISTRALKAVD 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKSS 97
           +GGLD+FL  +K +NL+ R++ L+  ++ K   K++
Sbjct: 61 FRGGLDQFLIRAKNKNLAPRIKKLKKALMVKTKAKAN 97


>gi|163796313|ref|ZP_02190274.1| LSU ribosomal protein L28P [alpha proteobacterium BAL199]
 gi|159178455|gb|EDP62997.1| LSU ribosomal protein L28P [alpha proteobacterium BAL199]
          Length = 99

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 46/90 (51%), Positives = 64/90 (71%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+R CELT K V++GN VSHANN+TRRRFLPN+    L+SD++ Q  +L++   A+R+VE
Sbjct: 1  MARRCELTGKGVLTGNNVSHANNRTRRRFLPNIQETALLSDVLGQMVRLKLCTGAIRTVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILK 90
            GGLD FL+ +K  +LS   R L+ +I K
Sbjct: 61 HNGGLDAFLAKAKVSDLSQEARRLKKRIEK 90


>gi|188582402|ref|YP_001925847.1| 50S ribosomal protein L28 [Methylobacterium populi BJ001]
 gi|226732836|sp|B1ZHJ4|RL28_METPB RecName: Full=50S ribosomal protein L28
 gi|179345900|gb|ACB81312.1| ribosomal protein L28 [Methylobacterium populi BJ001]
          Length = 101

 Score = 95.9 bits (237), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 49/97 (50%), Positives = 68/97 (70%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT K V  G+ VSH+N KT+ RFLPNLC +TL SD + ++ +LR++  ALRSVE
Sbjct: 1  MSRRCELTGKAVQVGHLVSHSNRKTKCRFLPNLCNVTLQSDALNRRVRLRVTAHALRSVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKSS 97
           +GGLD FL  +++  LS   R L+  I KK++E ++
Sbjct: 61 HRGGLDAFLIKAREIELSQTARLLKRDIEKKIAETAT 97


>gi|254440022|ref|ZP_05053516.1| ribosomal protein L28, putative [Octadecabacter antarcticus 307]
 gi|198255468|gb|EDY79782.1| ribosomal protein L28, putative [Octadecabacter antarcticus 307]
          Length = 96

 Score = 95.9 bits (237), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 46/96 (47%), Positives = 64/96 (66%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT K  MSGN VSHA N+TRRRFLPNL  ++L+S+ + + ++ RIS  ALR+V+
Sbjct: 1  MSRRCELTGKGPMSGNNVSHAKNRTRRRFLPNLQDVSLMSESLGRSFKFRISNAALRTVD 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKS 96
           +GGLD F + SK   LS     ++  I K  + ++
Sbjct: 61 HRGGLDAFFAKSKDAELSPSALKVKKDIAKAATAEA 96


>gi|209883222|ref|YP_002287079.1| 50S ribosomal protein L28 [Oligotropha carboxidovorans OM5]
 gi|226732842|sp|B6J9Z3|RL28_OLICO RecName: Full=50S ribosomal protein L28
 gi|209871418|gb|ACI91214.1| 50S ribosomal protein L28 [Oligotropha carboxidovorans OM5]
          Length = 97

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 48/91 (52%), Positives = 63/91 (69%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT K    G+KVSH+N K++RRFLPNLC +TL+S+ + Q  +LR+S  AL+SV+
Sbjct: 1  MSRRCELTAKGPQVGHKVSHSNIKSKRRFLPNLCNVTLMSETLGQSVRLRVSTNALKSVD 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKK 91
            GGLD FL  +   NLS +   L+ QI KK
Sbjct: 61 HNGGLDAFLLKANIANLSPKAADLKRQIEKK 91


>gi|91974765|ref|YP_567424.1| 50S ribosomal protein L28 [Rhodopseudomonas palustris BisB5]
 gi|123722228|sp|Q13EG6|RL28_RHOPS RecName: Full=50S ribosomal protein L28
 gi|91681221|gb|ABE37523.1| LSU ribosomal protein L28P [Rhodopseudomonas palustris BisB5]
          Length = 101

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 46/91 (50%), Positives = 63/91 (69%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT K V +G+KVSH+N KT+RRFLPNL  +T +SD + +  +LR+S  AL+SV+
Sbjct: 1  MSRRCELTAKGVQTGHKVSHSNIKTKRRFLPNLVNVTFLSDALGRPVRLRVSTNALKSVD 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKK 91
           +GGLD FL+ +    LS +   L+  I KK
Sbjct: 61 HRGGLDAFLAKASIAELSPKAAELKRAIAKK 91


>gi|299132820|ref|ZP_07026015.1| ribosomal protein L28 [Afipia sp. 1NLS2]
 gi|298592957|gb|EFI53157.1| ribosomal protein L28 [Afipia sp. 1NLS2]
          Length = 97

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 48/91 (52%), Positives = 62/91 (68%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT K    G++VSH+N KT+RRFLPNLC +TLIS+ + Q  +LR+S  AL+SV+
Sbjct: 1  MSRRCELTAKGPQVGHRVSHSNIKTKRRFLPNLCNVTLISETLGQSVRLRVSTNALKSVD 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKK 91
            GGLD FL  +    LS +   L+ QI KK
Sbjct: 61 HNGGLDAFLLKANVATLSPKAADLKRQIEKK 91


>gi|255263970|ref|ZP_05343312.1| 50S ribosomal protein L28 [Thalassiobium sp. R2A62]
 gi|255106305|gb|EET48979.1| 50S ribosomal protein L28 [Thalassiobium sp. R2A62]
          Length = 93

 Score = 94.7 bits (234), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 46/90 (51%), Positives = 61/90 (67%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT K  M+GN VSHA N+TRRRFLPNL  +TL S+ + + ++ RIS  ALR+V+
Sbjct: 1  MSRRCELTGKGPMTGNNVSHAKNRTRRRFLPNLQDVTLASETLGRSFKFRISNAALRTVD 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILK 90
           +GGLD F + SK   LS     ++ +I K
Sbjct: 61 HRGGLDGFFAKSKDVELSDAALKVKKEIAK 90


>gi|254293143|ref|YP_003059166.1| ribosomal protein L28 [Hirschia baltica ATCC 49814]
 gi|254041674|gb|ACT58469.1| ribosomal protein L28 [Hirschia baltica ATCC 49814]
          Length = 98

 Score = 94.7 bits (234), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 43/88 (48%), Positives = 66/88 (75%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT K  ++GN VSH+N +T+RRFLPNL +++L S+ + Q+++LRI+  ALR+V+
Sbjct: 1  MSRECELTGKKPITGNNVSHSNLRTKRRFLPNLVKVSLRSEALGQEFKLRIAASALRTVD 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQI 88
          ++GGLD FL+   +E LSA+   ++  I
Sbjct: 61 KRGGLDAFLAKETEEKLSAKAAKIKRDI 88


>gi|115522159|ref|YP_779070.1| 50S ribosomal protein L28 [Rhodopseudomonas palustris BisA53]
 gi|122298122|sp|Q07VE4|RL28_RHOP5 RecName: Full=50S ribosomal protein L28
 gi|115516106|gb|ABJ04090.1| LSU ribosomal protein L28P [Rhodopseudomonas palustris BisA53]
          Length = 101

 Score = 94.7 bits (234), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 48/91 (52%), Positives = 63/91 (69%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT K    G+KVSH+N KT+RRFLPNL  IT ISD + ++ +LR+S  AL+SV+
Sbjct: 1  MSRRCELTAKGAQVGHKVSHSNIKTKRRFLPNLVNITFISDALGRQVRLRVSTNALKSVD 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKK 91
           +GGLD FL  +K   LS +   ++ QI KK
Sbjct: 61 HRGGLDGFLLKAKDAELSPKAVDIKRQIEKK 91


>gi|85713780|ref|ZP_01044770.1| ribosomal protein L28 [Nitrobacter sp. Nb-311A]
 gi|85699684|gb|EAQ37551.1| ribosomal protein L28 [Nitrobacter sp. Nb-311A]
          Length = 97

 Score = 94.7 bits (234), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 63/97 (64%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT K  + G++VSH+N KT+RRFLPNL  +T +SD +    + R+S  ALRSV+
Sbjct: 1  MSRRCELTAKAPLVGHRVSHSNIKTKRRFLPNLVNVTFVSDTLASSVRFRVSTHALRSVD 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKSS 97
           +GG D FL  +K   LS +   ++ QI KK + K+ 
Sbjct: 61 HRGGFDAFLLKAKDSELSPKAVEIKRQIQKKQAAKAG 97


>gi|154246139|ref|YP_001417097.1| 50S ribosomal protein L28 [Xanthobacter autotrophicus Py2]
 gi|226699185|sp|A7IHE7|RL28_XANP2 RecName: Full=50S ribosomal protein L28
 gi|154160224|gb|ABS67440.1| ribosomal protein L28 [Xanthobacter autotrophicus Py2]
          Length = 100

 Score = 94.7 bits (234), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 62/80 (77%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR C+LT K V+SG+ VSH+N+KT+RRFLPNLC +TL S+ +++  +LR+S  AL+SV+
Sbjct: 1  MSRRCDLTGKGVLSGHTVSHSNHKTKRRFLPNLCNVTLESETLKRTIRLRVSANALKSVD 60

Query: 61 RQGGLDRFLSNSKKENLSAR 80
           +GGLD FL  ++ E LS R
Sbjct: 61 HRGGLDAFLKKARDEELSPR 80


>gi|148555241|ref|YP_001262823.1| 50S ribosomal protein L28 [Sphingomonas wittichii RW1]
 gi|166228155|sp|A5V8R9|RL28_SPHWW RecName: Full=50S ribosomal protein L28
 gi|148500431|gb|ABQ68685.1| LSU ribosomal protein L28P [Sphingomonas wittichii RW1]
          Length = 97

 Score = 94.4 bits (233), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 49/91 (53%), Positives = 61/91 (67%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR+CELT K    G+ VSHANNKT+R FLPNL  +TLISD + +  +LR+S   LRSVE
Sbjct: 1  MSRICELTGKGRQVGHNVSHANNKTKRTFLPNLQNVTLISDSLGKGVKLRVSTHGLRSVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKK 91
            GGLD +L  +  + LS R R L+  I KK
Sbjct: 61 HVGGLDNWLLKTSDDLLSLRARRLKRDIAKK 91


>gi|58038593|ref|YP_190557.1| 50S ribosomal protein L28 [Gluconobacter oxydans 621H]
 gi|67461239|sp|Q5FUP5|RL28_GLUOX RecName: Full=50S ribosomal protein L28
 gi|58001007|gb|AAW59901.1| LSU ribosomal protein L28P [Gluconobacter oxydans 621H]
          Length = 100

 Score = 94.4 bits (233), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 64/97 (65%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR C++T K V++GN VSHANNK+RRRFLPNL   TLISDI+    ++R+S   +R+VE
Sbjct: 1  MSRRCQITGKGVLTGNNVSHANNKSRRRFLPNLQETTLISDILGASVRMRLSTDGIRTVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKSS 97
            GGLD FL  +    L    + ++ +IL+    K++
Sbjct: 61 HNGGLDSFLLGTPNRKLPTEAQVIKRRILRVQERKAA 97


>gi|296116557|ref|ZP_06835167.1| 50S ribosomal protein L28 [Gluconacetobacter hansenii ATCC 23769]
 gi|295976769|gb|EFG83537.1| 50S ribosomal protein L28 [Gluconacetobacter hansenii ATCC 23769]
          Length = 100

 Score = 94.0 bits (232), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 66/97 (68%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR C++T K V++GN VSHANNK+RRRFLPNL   +L+SDI+    +LR+S   +R+VE
Sbjct: 1  MSRRCQITGKGVLTGNNVSHANNKSRRRFLPNLQETSLLSDILGAPVRLRLSTNGIRTVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKSS 97
            GGLD FL ++    L+    T++ +IL+    K++
Sbjct: 61 HNGGLDAFLLSTPNRKLTPEAMTVKRRILRVQVRKAA 97


>gi|83949729|ref|ZP_00958462.1| ribosomal protein L28 [Roseovarius nubinhibens ISM]
 gi|83837628|gb|EAP76924.1| ribosomal protein L28 [Roseovarius nubinhibens ISM]
          Length = 96

 Score = 94.0 bits (232), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 48/90 (53%), Positives = 61/90 (67%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT K  M GN  SHANNKTRRR+LPNL  +TL S+ + +  +LRIS  ALRSV+
Sbjct: 1  MSRRCELTGKGPMVGNNSSHANNKTRRRYLPNLNDVTLQSETLSRGIKLRISAHALRSVD 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILK 90
           +GGLD FL+ +K   LS     ++ +I K
Sbjct: 61 HRGGLDAFLAKAKDSELSTTALKVKKEIAK 90


>gi|162148837|ref|YP_001603298.1| 50S ribosomal protein L28 [Gluconacetobacter diazotrophicus PAl
          5]
 gi|209545415|ref|YP_002277644.1| 50S ribosomal protein L28 [Gluconacetobacter diazotrophicus PAl
          5]
 gi|189029443|sp|A9HS05|RL28_GLUDA RecName: Full=50S ribosomal protein L28
 gi|161787414|emb|CAP57009.1| putative 50S ribosomal protein L28 [Gluconacetobacter
          diazotrophicus PAl 5]
 gi|209533092|gb|ACI53029.1| ribosomal protein L28 [Gluconacetobacter diazotrophicus PAl 5]
          Length = 100

 Score = 94.0 bits (232), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 45/96 (46%), Positives = 65/96 (67%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR C++T K V++GN VSHANNK+RRRFLPNL   +L+SDI+    +LR+S   +R+VE
Sbjct: 1  MSRRCQITGKGVLTGNNVSHANNKSRRRFLPNLQETSLLSDILGSAVRLRLSTNGIRTVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKS 96
            GGLD FL ++    L    + L+ +IL+   +K+
Sbjct: 61 HNGGLDAFLLSTPNRKLPTEAQALKRRILRAKEKKA 96


>gi|23016453|ref|ZP_00056209.1| COG0227: Ribosomal protein L28 [Magnetospirillum magnetotacticum
          MS-1]
          Length = 101

 Score = 93.6 bits (231), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 45/95 (47%), Positives = 63/95 (66%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+R C +T K V++GN VSHANNKTRRRFLPNL   +L+SD +    +LRIS   L+++E
Sbjct: 1  MARRCAITGKGVLTGNNVSHANNKTRRRFLPNLQEASLLSDALGHAVRLRISTNGLKTIE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEK 95
            GG+D FL +     LSA  R L+ +I + ++ K
Sbjct: 61 HNGGIDSFLLSVATTKLSAEARRLKKRIERALASK 95


>gi|114570840|ref|YP_757520.1| 50S ribosomal protein L28P [Maricaulis maris MCS10]
 gi|122315437|sp|Q0AMB1|RL28_MARMM RecName: Full=50S ribosomal protein L28
 gi|114341302|gb|ABI66582.1| LSU ribosomal protein L28P [Maricaulis maris MCS10]
          Length = 94

 Score = 93.6 bits (231), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 65/93 (69%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+R CELT   V++GN VSHA NK+RRRFLPNLC +TL S+ + + ++LR++  ALRSV+
Sbjct: 1  MARRCELTGTGVLTGNNVSHAQNKSRRRFLPNLCDVTLASEKLGRGFKLRVAAKALRSVD 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMS 93
            GGLD +L  ++ E LS +   ++  + K M+
Sbjct: 61 HVGGLDVYLLKARDEKLSDKALKIKRDLKKAMA 93


>gi|75674604|ref|YP_317025.1| 50S ribosomal protein L28 [Nitrobacter winogradskyi Nb-255]
 gi|123614188|sp|Q3SVL8|RL28_NITWN RecName: Full=50S ribosomal protein L28
 gi|74419474|gb|ABA03673.1| LSU ribosomal protein L28P [Nitrobacter winogradskyi Nb-255]
          Length = 97

 Score = 93.2 bits (230), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 45/96 (46%), Positives = 63/96 (65%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT K  + G+KVSH+N KT+RRFLPNL  +T +S+ +    + R+S  ALRSV+
Sbjct: 1  MSRRCELTAKAPLVGHKVSHSNIKTKRRFLPNLVNVTFVSETLSSSVRFRVSTHALRSVD 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKS 96
           +GG D FL  ++   LS +   L+ QI KK + K+
Sbjct: 61 HRGGFDAFLLKARDSELSPKAIELKRQIQKKQAAKA 96


>gi|27375273|ref|NP_766802.1| 50S ribosomal protein L28 [Bradyrhizobium japonicum USDA 110]
 gi|67461519|sp|Q89XZ3|RL28_BRAJA RecName: Full=50S ribosomal protein L28
 gi|27348409|dbj|BAC45427.1| 50S ribosomal protein L28 [Bradyrhizobium japonicum USDA 110]
          Length = 102

 Score = 92.8 bits (229), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 46/93 (49%), Positives = 63/93 (67%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT K  + G+KVSH+N KT+RRFLPNL  +T IS+ +E+  +LR+S  A++SV+
Sbjct: 1  MSRRCELTAKGPLVGHKVSHSNIKTKRRFLPNLVNVTFISEALERNVRLRVSTNAVKSVD 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMS 93
            GGLD FL  +  + LS R   L+  I KK+ 
Sbjct: 61 HNGGLDAFLLKASADALSPRALELKRAIQKKVG 93


>gi|254461018|ref|ZP_05074434.1| ribosomal protein L28 [Rhodobacterales bacterium HTCC2083]
 gi|206677607|gb|EDZ42094.1| ribosomal protein L28 [Rhodobacteraceae bacterium HTCC2083]
          Length = 95

 Score = 92.8 bits (229), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 46/90 (51%), Positives = 62/90 (68%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT K  M+GN VSHA N+TRRRFLPNL  +TL S+I+ +  +L+I   ALR+V+
Sbjct: 1  MSRRCELTGKGPMTGNNVSHAKNRTRRRFLPNLNDVTLQSEILGRGIKLKICAAALRTVD 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILK 90
           +GGLD+F + SK   LS     ++ +I K
Sbjct: 61 HRGGLDQFFAKSKDSELSDSALKVKKEIAK 90


>gi|88608656|ref|YP_506211.1| ribosomal protein L28 [Neorickettsia sennetsu str. Miyayama]
 gi|123492103|sp|Q2GE85|RL28_NEOSM RecName: Full=50S ribosomal protein L28
 gi|88600825|gb|ABD46293.1| ribosomal protein L28 [Neorickettsia sennetsu str. Miyayama]
          Length = 102

 Score = 92.8 bits (229), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 41/93 (44%), Positives = 66/93 (70%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS  C+LT     +GN VSH+N KT++RF+PNL R+T+ SD+++QK++ ++S   +R+++
Sbjct: 1  MSNSCDLTGHGWQNGNMVSHSNRKTKKRFMPNLQRVTVFSDVLKQKFRFKVSAKTIRTID 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMS 93
           +GGLD FL N+K   LS     L+ +I+KK+S
Sbjct: 61 FKGGLDDFLRNTKNSKLSKSALVLKKRIMKKVS 93


>gi|39933570|ref|NP_945846.1| 50S ribosomal protein L28 [Rhodopseudomonas palustris CGA009]
 gi|192288924|ref|YP_001989529.1| 50S ribosomal protein L28 [Rhodopseudomonas palustris TIE-1]
 gi|67461434|sp|Q6NCH9|RL28_RHOPA RecName: Full=50S ribosomal protein L28; AltName: Full=RRP-L28
 gi|226699155|sp|B3QAG7|RL28_RHOPT RecName: Full=50S ribosomal protein L28
 gi|39647416|emb|CAE25937.1| 50S ribosomal protein L28 [Rhodopseudomonas palustris CGA009]
 gi|192282673|gb|ACE99053.1| ribosomal protein L28 [Rhodopseudomonas palustris TIE-1]
          Length = 101

 Score = 92.8 bits (229), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 45/93 (48%), Positives = 64/93 (68%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT K    G+KVSH+N KT+RRFLPNL  +T +SD + +  +LR+S  AL+SV+
Sbjct: 1  MSRRCELTAKGAQVGHKVSHSNIKTKRRFLPNLVNVTFLSDTLGRAVRLRVSTNALKSVD 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMS 93
           +GGLD +L  +++  LS +   L+  I KKM+
Sbjct: 61 HRGGLDAYLLKAREAELSPKAVELKRAIAKKMA 93


>gi|90422067|ref|YP_530437.1| 50S ribosomal protein L28 [Rhodopseudomonas palustris BisB18]
 gi|122477466|sp|Q21BW8|RL28_RHOPB RecName: Full=50S ribosomal protein L28
 gi|90104081|gb|ABD86118.1| LSU ribosomal protein L28P [Rhodopseudomonas palustris BisB18]
          Length = 101

 Score = 92.8 bits (229), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 46/91 (50%), Positives = 62/91 (68%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT K    G+KVSH+N KT+RRFLPNL  +T +SD + +  +LR+S  AL+SV+
Sbjct: 1  MSRRCELTAKGAQVGHKVSHSNIKTKRRFLPNLVNVTFLSDALGRPVRLRVSTNALKSVD 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKK 91
           +GGLD FL  +K   LS +   ++ QI KK
Sbjct: 61 HRGGLDGFLLKAKDAELSPKAVDIKRQIQKK 91


>gi|254466084|ref|ZP_05079495.1| ribosomal protein L28 [Rhodobacterales bacterium Y4I]
 gi|206686992|gb|EDZ47474.1| ribosomal protein L28 [Rhodobacterales bacterium Y4I]
          Length = 84

 Score = 92.8 bits (229), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 61/84 (72%)

Query: 13 MSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFLSNS 72
          M+GN VSHANNKT+RRFLPNL  +TL S+++ +  +LRIS  ALRSV+ +GGLD FL+ +
Sbjct: 1  MTGNNVSHANNKTKRRFLPNLNDVTLQSEVLGRGVKLRISAAALRSVDHRGGLDAFLAKA 60

Query: 73 KKENLSARMRTLRSQILKKMSEKS 96
          K E LSA    ++ +I K  + ++
Sbjct: 61 KDEELSANALKVKKEIAKAQAAQA 84


>gi|296282926|ref|ZP_06860924.1| 50S ribosomal protein L28 [Citromicrobium bathyomarinum JL354]
          Length = 96

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 58/80 (72%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR+CELT K    G+ VSHANNKT+R FLPNL  +TL+S+ +++ ++ R+S   LRSVE
Sbjct: 1  MSRICELTGKGRQVGHNVSHANNKTKRVFLPNLQNVTLMSEKLDRSFKFRVSTQGLRSVE 60

Query: 61 RQGGLDRFLSNSKKENLSAR 80
            GGLD +L  +K E LSAR
Sbjct: 61 HNGGLDNWLLKTKDEKLSAR 80


>gi|297183663|gb|ADI19788.1| ribosomal protein l28 [uncultured alpha proteobacterium
           EB000_37G09]
          Length = 116

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 43/89 (48%), Positives = 63/89 (70%)

Query: 1   MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
           MS+ C++T K VMSGN VSHA N+TRRRFLPNL + ++ S+I+ +   +R+S  A+R+VE
Sbjct: 23  MSKRCQITGKGVMSGNNVSHAKNRTRRRFLPNLQQTSMSSEILGRTISMRVSTSAIRTVE 82

Query: 61  RQGGLDRFLSNSKKENLSARMRTLRSQIL 89
           + GGLD FL  ++   L+   R L+ +IL
Sbjct: 83  KHGGLDTFLLQARNSELADEARALKREIL 111


>gi|85375365|ref|YP_459427.1| 50S ribosomal protein L28 [Erythrobacter litoralis HTCC2594]
 gi|122543434|sp|Q2N6R1|RL28_ERYLH RecName: Full=50S ribosomal protein L28
 gi|84788448|gb|ABC64630.1| ribosomal protein L28 [Erythrobacter litoralis HTCC2594]
          Length = 99

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 44/97 (45%), Positives = 66/97 (68%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR+CELT K    G+ VSHANNKT+R FLPNL  +TL+S+ +++ ++ R+S   LRSVE
Sbjct: 1  MSRICELTGKGRQVGHNVSHANNKTKRVFLPNLQNVTLLSEKLDRGFKFRVSTQGLRSVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKSS 97
            GGLD +L  +K + LS+    ++ ++ K M+E  +
Sbjct: 61 HNGGLDNWLLKTKDDKLSSNALKVKRELKKAMNEADA 97


>gi|114799496|ref|YP_762169.1| 50S ribosomal protein [Hyphomonas neptunium ATCC 15444]
 gi|122941994|sp|Q0BWH4|RL28_HYPNA RecName: Full=50S ribosomal protein L28
 gi|114739670|gb|ABI77795.1| 50S ribosomal protein [Hyphomonas neptunium ATCC 15444]
          Length = 94

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 44/91 (48%), Positives = 65/91 (71%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT    M GN VSH+  KT+RR+LPNL ++TL S+ ++Q +++RI+  ALR+V+
Sbjct: 1  MSRECELTGTKPMVGNIVSHSQIKTKRRYLPNLVQVTLRSEALDQNFRMRIAAKALRTVD 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKK 91
          + GGLD FL+ +K+E LS +   ++  I KK
Sbjct: 61 KLGGLDAFLAKAKEEGLSTKALKIKRDIAKK 91


>gi|197104188|ref|YP_002129565.1| 50S ribosomal protein L28 [Phenylobacterium zucineum HLK1]
 gi|226699143|sp|B4RFQ5|RL28_PHEZH RecName: Full=50S ribosomal protein L28
 gi|196477608|gb|ACG77136.1| 50S ribosomal protein L28 [Phenylobacterium zucineum HLK1]
          Length = 98

 Score = 92.0 bits (227), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 43/97 (44%), Positives = 66/97 (68%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CE+T    M G+ VSH+N KT+RRF+PNL ++T++SD + Q   LR++  ALR+V+
Sbjct: 1  MSRRCEITGVGPMVGHNVSHSNIKTKRRFMPNLTKVTVLSDALGQNVTLRVTNAALRTVD 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKSS 97
           +GGLD  L  ++ E LS R   ++ QI  K++E+ +
Sbjct: 61 AKGGLDAVLLKARDEVLSPRALKIKRQIKAKLAEQPA 97


>gi|289609991|emb|CBI60347.1| unnamed protein product [Sordaria macrospora]
          Length = 97

 Score = 92.0 bits (227), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 45/85 (52%), Positives = 61/85 (71%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR+CELT K    G+ VSHANNKT+R FLPNL  +TL+S+ +E+  +LR+S   LRSVE
Sbjct: 1  MSRICELTGKGRQVGHNVSHANNKTKRTFLPNLQNVTLMSEALERSIRLRVSTHGLRSVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLR 85
            GGLD +L  ++ ++LS R R L+
Sbjct: 61 HVGGLDNWLLKTRDDDLSLRARRLK 85


>gi|330994027|ref|ZP_08317957.1| 50S ribosomal protein L28 [Gluconacetobacter sp. SXCC-1]
 gi|329758973|gb|EGG75487.1| 50S ribosomal protein L28 [Gluconacetobacter sp. SXCC-1]
          Length = 99

 Score = 92.0 bits (227), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 43/97 (44%), Positives = 66/97 (68%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR C++T K V++GN VSHANNK+RRRFLPNL   +L+SDI+     +R++   +R+VE
Sbjct: 1  MSRRCQITGKGVLTGNNVSHANNKSRRRFLPNLQETSLLSDILGAAVPMRMTTNGIRTVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKSS 97
            GGLD FL ++    L+    T++ +IL+   +K++
Sbjct: 61 HNGGLDSFLLSTPNRKLTPEALTVKRRILRVQEKKAA 97


>gi|85709871|ref|ZP_01040936.1| ribosomal protein L28 [Erythrobacter sp. NAP1]
 gi|85688581|gb|EAQ28585.1| ribosomal protein L28 [Erythrobacter sp. NAP1]
          Length = 95

 Score = 92.0 bits (227), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 64/93 (68%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR+CELT K    GN VSHANNKT+R FLPNL  +TL+S+ +++ ++ R+S   LRSVE
Sbjct: 1  MSRICELTGKGRQVGNNVSHANNKTKRVFLPNLQNVTLMSEKLDRSFKFRVSTHGLRSVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMS 93
            GGLD +L  +K + LS R   ++ ++ K ++
Sbjct: 61 HNGGLDNWLLKTKDDKLSTRALKVKRELKKAVA 93


>gi|307293959|ref|ZP_07573803.1| ribosomal protein L28 [Sphingobium chlorophenolicum L-1]
 gi|306880110|gb|EFN11327.1| ribosomal protein L28 [Sphingobium chlorophenolicum L-1]
          Length = 97

 Score = 92.0 bits (227), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 46/88 (52%), Positives = 59/88 (67%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR+CELT K    G+ VSHANNKT+R FLPNL  ++LIS+ +E   +LR+S   LRSVE
Sbjct: 1  MSRICELTGKGRQVGHNVSHANNKTKRVFLPNLQNVSLISEALETTVKLRVSTHGLRSVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQI 88
            GGLD +L  +  E LS + R L+  I
Sbjct: 61 HNGGLDNWLLKTSDEKLSLKARRLKRDI 88


>gi|94498764|ref|ZP_01305312.1| ribosomal protein L28 [Sphingomonas sp. SKA58]
 gi|94421773|gb|EAT06826.1| ribosomal protein L28 [Sphingomonas sp. SKA58]
          Length = 97

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 45/89 (50%), Positives = 60/89 (67%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR+CELT K    G+ VSHANNKT+R FLPNL  ++LIS+ +E   +LR+S   LRSVE
Sbjct: 1  MSRICELTGKGRQVGHNVSHANNKTKRVFLPNLQNVSLISEALETTVKLRVSTHGLRSVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQIL 89
            GGLD +L  +  + LS + R L+  I+
Sbjct: 61 HNGGLDNWLVKTSDDKLSLKARRLKRDIV 89


>gi|254500400|ref|ZP_05112551.1| ribosomal protein L28, putative [Labrenzia alexandrii DFL-11]
 gi|222436471|gb|EEE43150.1| ribosomal protein L28, putative [Labrenzia alexandrii DFL-11]
          Length = 87

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 41/85 (48%), Positives = 60/85 (70%)

Query: 13 MSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFLSNS 72
          M+GN VSHANNK+RRRFLPNLC ++L+SD + + ++L++S  ALRSVE +GGLD +L  +
Sbjct: 1  MTGNNVSHANNKSRRRFLPNLCNVSLMSDTLGETFKLKVSAHALRSVEHRGGLDAYLMKA 60

Query: 73 KKENLSARMRTLRSQILKKMSEKSS 97
              LS   R ++  I +K  E ++
Sbjct: 61 SDAELSDNARKIKVSIKRKQEEAAA 85


>gi|149185198|ref|ZP_01863515.1| ribosomal protein L28 [Erythrobacter sp. SD-21]
 gi|148831309|gb|EDL49743.1| ribosomal protein L28 [Erythrobacter sp. SD-21]
          Length = 95

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 43/79 (54%), Positives = 56/79 (70%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR+CELT K    GN VSHANNKT+R FLPNL  +TL+S+ +++ ++ R+S   LRSVE
Sbjct: 1  MSRICELTGKGRQVGNNVSHANNKTKRVFLPNLQNVTLMSEKLDRSFKFRVSTQGLRSVE 60

Query: 61 RQGGLDRFLSNSKKENLSA 79
            GGLD +L  +  E LSA
Sbjct: 61 HNGGLDNWLMKTSDEKLSA 79


>gi|302382242|ref|YP_003818065.1| ribosomal protein L28 [Brevundimonas subvibrioides ATCC 15264]
 gi|302192870|gb|ADL00442.1| ribosomal protein L28 [Brevundimonas subvibrioides ATCC 15264]
          Length = 98

 Score = 91.3 bits (225), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 44/97 (45%), Positives = 66/97 (68%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT    M GN VSH+N KT+RRFLP+L ++ L S+ + Q Y LRIS  ALR+++
Sbjct: 1  MSRRCELTGIGPMVGNLVSHSNVKTKRRFLPSLKKVKLASEALGQSYTLRISNAALRTLD 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKSS 97
           +GGLD F+  +  E LS   + ++ Q+  K++E+++
Sbjct: 61 FKGGLDPFIVKADDEKLSVAAQRIKRQVKAKLAEQAA 97


>gi|294012907|ref|YP_003546367.1| ribosomal protein L28 [Sphingobium japonicum UT26S]
 gi|292676237|dbj|BAI97755.1| ribosomal protein L28 [Sphingobium japonicum UT26S]
          Length = 97

 Score = 90.5 bits (223), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 45/88 (51%), Positives = 59/88 (67%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR+CELT K    G+ VSHANNKT+R FLPNL  ++LIS+ +E   +LR+S   LRSVE
Sbjct: 1  MSRICELTGKGRQVGHNVSHANNKTKRVFLPNLQNVSLISEALETTVKLRVSTHGLRSVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQI 88
            GGLD +L  +  + LS + R L+  I
Sbjct: 61 HNGGLDNWLLKTSDDKLSLKARRLKRDI 88


>gi|330813137|ref|YP_004357376.1| LSU ribosomal protein L28p [Candidatus Pelagibacter sp. IMCC9063]
 gi|327486232|gb|AEA80637.1| LSU ribosomal protein L28p [Candidatus Pelagibacter sp. IMCC9063]
          Length = 116

 Score = 90.1 bits (222), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 42/91 (46%), Positives = 66/91 (72%)

Query: 1   MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
           M++VCELT K  MSGN VSH+NNKT+R+F PNL +++L S+++ +    +IS  AL++V+
Sbjct: 24  MAKVCELTGKRPMSGNTVSHSNNKTKRKFYPNLKKVSLRSELLNKNISFKISTRALKAVD 83

Query: 61  RQGGLDRFLSNSKKENLSARMRTLRSQILKK 91
            +GG+D FL  +K   L+ R++ ++ QIL K
Sbjct: 84  FRGGIDEFLIRAKNAKLALRVKKIKKQILSK 114


>gi|92116123|ref|YP_575852.1| 50S ribosomal protein L28 [Nitrobacter hamburgensis X14]
 gi|122418709|sp|Q1QQV5|RL28_NITHX RecName: Full=50S ribosomal protein L28
 gi|91799017|gb|ABE61392.1| LSU ribosomal protein L28P [Nitrobacter hamburgensis X14]
          Length = 97

 Score = 90.1 bits (222), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 62/93 (66%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT K  M G+KVSH+N KT+RRFLPNL  +T +S+ +    +LR+S  AL+SV+
Sbjct: 1  MSRRCELTAKAPMVGHKVSHSNIKTKRRFLPNLVNVTFLSEALASPVRLRVSTHALKSVD 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMS 93
           +GG D FL  +K   LS +   ++ +I KK +
Sbjct: 61 HRGGFDAFLLKAKNAELSPKAIEIKRRIEKKQA 93


>gi|329848403|ref|ZP_08263431.1| ribosomal protein L28 [Asticcacaulis biprosthecum C19]
 gi|328843466|gb|EGF93035.1| ribosomal protein L28 [Asticcacaulis biprosthecum C19]
          Length = 96

 Score = 90.1 bits (222), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 46/96 (47%), Positives = 65/96 (67%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT    M G+ VSH+N KT+RRFLP+L +  L S+ + Q Y+L+IS  ALR+++
Sbjct: 1  MSRRCELTGVGPMVGHSVSHSNVKTKRRFLPSLRQTALQSEALGQAYRLKISNAALRTLD 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKS 96
           +GGLD FL  +   +LS R R L+ QI  K++ K+
Sbjct: 61 FRGGLDAFLVKADDADLSLRARRLKKQIKDKLAAKA 96


>gi|260562923|ref|ZP_05833409.1| ribosomal protein L28 [Brucella melitensis bv. 1 str. 16M]
 gi|260152939|gb|EEW88031.1| ribosomal protein L28 [Brucella melitensis bv. 1 str. 16M]
          Length = 59

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 48/59 (81%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSV 59
          MSR CELT K+V  GN VSHANN+TRRRFLPNLC +TLIS+ + Q Y+LRIS  ALRSV
Sbjct: 1  MSRACELTGKSVQYGNNVSHANNRTRRRFLPNLCNVTLISETLGQSYRLRISANALRSV 59


>gi|87198247|ref|YP_495504.1| 50S ribosomal protein L28 [Novosphingobium aromaticivorans DSM
          12444]
 gi|123491021|sp|Q2GBV3|RL28_NOVAD RecName: Full=50S ribosomal protein L28
 gi|87133928|gb|ABD24670.1| LSU ribosomal protein L28P [Novosphingobium aromaticivorans DSM
          12444]
          Length = 94

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 43/90 (47%), Positives = 61/90 (67%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR+CELT K    G+ VSHANNKT+R FLPNL  +TL+S+ +++ ++ R+S   LRSVE
Sbjct: 1  MSRICELTGKGRQVGHNVSHANNKTKRLFLPNLQNVTLLSEKLDRSFKFRVSTHGLRSVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILK 90
            GGLD +L       LSAR   ++ +++K
Sbjct: 61 HNGGLDNWLLKQSDTKLSARALKVKRELVK 90


>gi|114327278|ref|YP_744435.1| 50S ribosomal protein L28 [Granulibacter bethesdensis CGDNIH1]
 gi|114315452|gb|ABI61512.1| LSU ribosomal protein L28P [Granulibacter bethesdensis CGDNIH1]
          Length = 133

 Score = 89.4 bits (220), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 44/96 (45%), Positives = 63/96 (65%)

Query: 1   MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
           MSR C++T K V++GN VSHANNKTRRRFLPNL    L+SD +    +LR+S  A+R+VE
Sbjct: 34  MSRRCQITGKGVLTGNNVSHANNKTRRRFLPNLQVAGLLSDTLGTSVRLRLSTRAIRTVE 93

Query: 61  RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKS 96
           + GG+D FL  +    L      L+ +I +  ++K+
Sbjct: 94  KNGGIDAFLLGTPDRQLPTEALELKRRITRAQAKKA 129


>gi|300024668|ref|YP_003757279.1| ribosomal protein L28 [Hyphomicrobium denitrificans ATCC 51888]
 gi|299526489|gb|ADJ24958.1| ribosomal protein L28 [Hyphomicrobium denitrificans ATCC 51888]
          Length = 97

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 47/97 (48%), Positives = 66/97 (68%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+R CELT    +SG   SHA NKT+R+F PNL  +TL+SD + +K +LRIS  AL+SVE
Sbjct: 1  MTRRCELTGTLPLSGQLRSHAENKTKRKFRPNLHNVTLLSDALGRKVRLRISARALKSVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKSS 97
           +GGLD FL  +K + LSA    L+ ++ K  +EK++
Sbjct: 61 HRGGLDAFLLKAKNDELSAACLKLKRELQKAQAEKAA 97


>gi|144898657|emb|CAM75521.1| 50S ribosomal protein L28 [Magnetospirillum gryphiswaldense
          MSR-1]
          Length = 100

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 41/97 (42%), Positives = 63/97 (64%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+R C +T K V++GN VSHANNK+RRRFLPNL   +++SD + Q  +L++S   L+++E
Sbjct: 1  MARRCSITGKGVLTGNNVSHANNKSRRRFLPNLQETSVLSDALGQMVRLKVSTRGLKTIE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKSS 97
            GGLD FL  +    L    R L+ ++ K ++ K +
Sbjct: 61 HNGGLDAFLLGTNDSRLPDEARRLKKRVAKALATKQA 97


>gi|148258718|ref|YP_001243303.1| 50S ribosomal protein L28 [Bradyrhizobium sp. BTAi1]
 gi|166226547|sp|A5ETA3|RL28_BRASB RecName: Full=50S ribosomal protein L28
 gi|146410891|gb|ABQ39397.1| LSU ribosomal protein L28P [Bradyrhizobium sp. BTAi1]
          Length = 102

 Score = 88.6 bits (218), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 43/85 (50%), Positives = 57/85 (67%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT K    G+KVSH+N KT+RRFLPNLC +T ISD + +  +LR+S  A++SV+
Sbjct: 1  MSRRCELTAKGPQVGHKVSHSNIKTKRRFLPNLCNVTFISDALGRNVRLRVSTNAIKSVD 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLR 85
            GGLD +L  +    LS R   L+
Sbjct: 61 HNGGLDAYLLKANAATLSPRALELK 85


>gi|146337760|ref|YP_001202808.1| 50S ribosomal protein L28 [Bradyrhizobium sp. ORS278]
 gi|166226548|sp|A4YKZ2|RL28_BRASO RecName: Full=50S ribosomal protein L28
 gi|146190566|emb|CAL74568.1| 50S ribosomal protein L28 [Bradyrhizobium sp. ORS278]
          Length = 102

 Score = 88.6 bits (218), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 43/85 (50%), Positives = 57/85 (67%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT K    G+KVSH+N KT+RRFLPNLC +T ISD + +  +LR+S  A++SV+
Sbjct: 1  MSRRCELTAKGPQVGHKVSHSNIKTKRRFLPNLCNVTFISDALGRNVRLRVSTNAIKSVD 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLR 85
            GGLD +L  +    LS R   L+
Sbjct: 61 HNGGLDAYLMKANAAALSPRALELK 85


>gi|86747672|ref|YP_484168.1| 50S ribosomal protein L28 [Rhodopseudomonas palustris HaA2]
 gi|123293234|sp|Q2J2Q3|RL28_RHOP2 RecName: Full=50S ribosomal protein L28
 gi|86570700|gb|ABD05257.1| LSU ribosomal protein L28P [Rhodopseudomonas palustris HaA2]
          Length = 101

 Score = 88.2 bits (217), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 58/84 (69%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT K V +G+KVSH+N KT+RRFLPNL  +T +SD + +  +LR+S  AL+SV+
Sbjct: 1  MSRRCELTAKGVQTGHKVSHSNIKTKRRFLPNLVNVTFLSDALGRPVRLRVSTNALKSVD 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTL 84
           +GGLD FL  +    LS +   L
Sbjct: 61 HRGGLDAFLLKASVAELSPKAAEL 84


>gi|296532524|ref|ZP_06895238.1| 50S ribosomal protein L28 [Roseomonas cervicalis ATCC 49957]
 gi|296267150|gb|EFH13061.1| 50S ribosomal protein L28 [Roseomonas cervicalis ATCC 49957]
          Length = 103

 Score = 87.8 bits (216), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 41/88 (46%), Positives = 55/88 (62%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+R C +T K V++GN VSHANNKTRRRFLPNL   +  SD++    Q+R+S   +R+VE
Sbjct: 1  MARRCGITGKGVLTGNNVSHANNKTRRRFLPNLQETSFFSDVLGTSVQIRLSTNGIRTVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQI 88
            GGLD FL  +    L      L+ +I
Sbjct: 61 HNGGLDSFLLGTPDRKLPTEALVLKRRI 88


>gi|148261685|ref|YP_001235812.1| 50S ribosomal protein L28 [Acidiphilium cryptum JF-5]
 gi|326405178|ref|YP_004285260.1| 50S ribosomal protein L28 [Acidiphilium multivorum AIU301]
 gi|166226532|sp|A5G211|RL28_ACICJ RecName: Full=50S ribosomal protein L28
 gi|146403366|gb|ABQ31893.1| LSU ribosomal protein L28P [Acidiphilium cryptum JF-5]
 gi|325052040|dbj|BAJ82378.1| 50S ribosomal protein L28 [Acidiphilium multivorum AIU301]
          Length = 100

 Score = 87.4 bits (215), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 41/84 (48%), Positives = 58/84 (69%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+R C++T K+V+SGN VSHANNK+RRRFLPNL    L SD +    +LR++   L ++E
Sbjct: 1  MTRRCDITGKSVLSGNNVSHANNKSRRRFLPNLQDSALQSDALGHSVKLRVTPRGLATIE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTL 84
          ++GGLD FL ++    L+   RTL
Sbjct: 61 QKGGLDAFLLDTPNRKLTDEARTL 84


>gi|326385791|ref|ZP_08207420.1| ribosomal protein L28 [Novosphingobium nitrogenifigens DSM 19370]
 gi|326209770|gb|EGD60558.1| ribosomal protein L28 [Novosphingobium nitrogenifigens DSM 19370]
          Length = 95

 Score = 87.4 bits (215), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 63/93 (67%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR+CELT K    G+ VSHANNKT+R FLPNL  +TL+S+ +++ ++ R+S   LRSVE
Sbjct: 1  MSRICELTGKGRQIGHNVSHANNKTKRVFLPNLQNVTLLSEKLDRSFRFRVSTHGLRSVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMS 93
            GGLD +L  ++   LS R   ++ ++ K ++
Sbjct: 61 HNGGLDNWLLKARDTELSTRALKVKRELKKAVA 93


>gi|258542744|ref|YP_003188177.1| 50S ribosomal protein L28 [Acetobacter pasteurianus IFO 3283-01]
 gi|329114656|ref|ZP_08243415.1| 50S ribosomal protein L28 [Acetobacter pomorum DM001]
 gi|256633822|dbj|BAH99797.1| LSU ribosomal protein L28P [Acetobacter pasteurianus IFO 3283-01]
 gi|256636881|dbj|BAI02850.1| LSU ribosomal protein L28P [Acetobacter pasteurianus IFO 3283-03]
 gi|256639934|dbj|BAI05896.1| LSU ribosomal protein L28P [Acetobacter pasteurianus IFO 3283-07]
 gi|256642990|dbj|BAI08945.1| LSU ribosomal protein L28P [Acetobacter pasteurianus IFO 3283-22]
 gi|256646045|dbj|BAI11993.1| LSU ribosomal protein L28P [Acetobacter pasteurianus IFO 3283-26]
 gi|256649098|dbj|BAI15039.1| LSU ribosomal protein L28P [Acetobacter pasteurianus IFO 3283-32]
 gi|256652085|dbj|BAI18019.1| LSU ribosomal protein L28P [Acetobacter pasteurianus IFO
          3283-01-42C]
 gi|256655142|dbj|BAI21069.1| LSU ribosomal protein L28P [Acetobacter pasteurianus IFO 3283-12]
 gi|326696136|gb|EGE47818.1| 50S ribosomal protein L28 [Acetobacter pomorum DM001]
          Length = 101

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 39/90 (43%), Positives = 61/90 (67%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR C++T K V++GN VSHANNK+RRRFLPNL   +L+S+ +    ++R+S   LR++E
Sbjct: 1  MSRRCQITGKGVLTGNNVSHANNKSRRRFLPNLQDASLVSETLGSAVRMRVSARGLRTIE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILK 90
            GGLD FL ++    L    + ++ ++L+
Sbjct: 61 HNGGLDAFLLSTPNRKLPEEAQVIKRRVLR 90


>gi|295691053|ref|YP_003594746.1| 50S 50S ribosomal protein L28 [Caulobacter segnis ATCC 21756]
 gi|295432956|gb|ADG12128.1| ribosomal protein L28 [Caulobacter segnis ATCC 21756]
          Length = 145

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 43/80 (53%), Positives = 55/80 (68%)

Query: 1   MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
           MSR CELT    M G+ VSH+N KT+RRFLP L   TL S+ + Q ++LRIS  ALR+++
Sbjct: 47  MSRRCELTGIGPMVGHNVSHSNIKTKRRFLPALSPATLQSESLGQSFKLRISNAALRTLD 106

Query: 61  RQGGLDRFLSNSKKENLSAR 80
            +GGLD FL  +K E LS R
Sbjct: 107 FKGGLDTFLLGAKDEQLSPR 126


>gi|16124914|ref|NP_419478.1| 50S ribosomal protein L28 [Caulobacter crescentus CB15]
 gi|221233636|ref|YP_002516072.1| 50S ribosomal protein L28 [Caulobacter crescentus NA1000]
 gi|20139681|sp|Q9AAE1|RL28_CAUCR RecName: Full=50S ribosomal protein L28
 gi|254801349|sp|B8H0R5|RL28_CAUCN RecName: Full=50S ribosomal protein L28
 gi|13421878|gb|AAK22646.1| ribosomal protein L28 [Caulobacter crescentus CB15]
 gi|220962808|gb|ACL94164.1| LSU ribosomal protein L28P [Caulobacter crescentus NA1000]
          Length = 99

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 43/80 (53%), Positives = 55/80 (68%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT    M G+ VSH+N KT+RRFLP L   TL S+ + Q ++LRIS  ALR+++
Sbjct: 1  MSRRCELTGIGPMVGHNVSHSNIKTKRRFLPALSPATLQSESLGQSFKLRISNAALRTLD 60

Query: 61 RQGGLDRFLSNSKKENLSAR 80
           +GGLD FL  +K E LS R
Sbjct: 61 FKGGLDTFLLGAKDEQLSPR 80


>gi|167648087|ref|YP_001685750.1| 50S ribosomal protein L28 [Caulobacter sp. K31]
 gi|189042427|sp|B0SXP0|RL28_CAUSK RecName: Full=50S ribosomal protein L28
 gi|167350517|gb|ABZ73252.1| ribosomal protein L28 [Caulobacter sp. K31]
          Length = 101

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 43/80 (53%), Positives = 55/80 (68%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT    M G+ VSH+N KT+RRFLP L   +L SD + Q ++LRIS  ALR+++
Sbjct: 1  MSRRCELTGIGPMVGHNVSHSNIKTKRRFLPALSPASLQSDSLGQTFKLRISNAALRTLD 60

Query: 61 RQGGLDRFLSNSKKENLSAR 80
           +GGLD FL  +K E LS R
Sbjct: 61 FRGGLDVFLLGAKDEQLSPR 80


>gi|71082914|ref|YP_265633.1| 50S ribosomal protein L28 [Candidatus Pelagibacter ubique
          HTCC1062]
 gi|91762663|ref|ZP_01264628.1| 50S ribosomal protein L28 [Candidatus Pelagibacter ubique
          HTCC1002]
 gi|71062027|gb|AAZ21030.1| 50S ribosomal protein L28 [Candidatus Pelagibacter ubique
          HTCC1062]
 gi|91718465|gb|EAS85115.1| 50S ribosomal protein L28 [Candidatus Pelagibacter ubique
          HTCC1002]
          Length = 107

 Score = 84.0 bits (206), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 38/80 (47%), Positives = 55/80 (68%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS+ CELT K  M G+ VSHANNKT+RRFLPNL +    S+++++   L +S   +RSV+
Sbjct: 1  MSKKCELTGKIPMKGHNVSHANNKTKRRFLPNLKKAKFTSELLKRSLTLTVSNAGVRSVD 60

Query: 61 RQGGLDRFLSNSKKENLSAR 80
          ++G  D+FL   K +N+S R
Sbjct: 61 KKGTFDQFLKTVKNKNISPR 80


>gi|288957262|ref|YP_003447603.1| large subunit ribosomal protein L28 [Azospirillum sp. B510]
 gi|288909570|dbj|BAI71059.1| large subunit ribosomal protein L28 [Azospirillum sp. B510]
          Length = 99

 Score = 84.0 bits (206), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 44/97 (45%), Positives = 62/97 (63%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+R C +T K    GN VSHANNK RRRF PNL   +L+SD + Q  +LR+S  A+RS+E
Sbjct: 1  MARRCSVTGKGTQFGNNVSHANNKNRRRFQPNLQETSLLSDSLGQLVRLRLSVNAIRSIE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKSS 97
           +GGLD FL ++K   LS   R ++ +I K   ++ +
Sbjct: 61 HKGGLDAFLLDAKDAVLSLDARRIKRRISKAQEKQQA 97


>gi|209966402|ref|YP_002299317.1| ribosomal protein L28 [Rhodospirillum centenum SW]
 gi|226699154|sp|B6IW31|RL28_RHOCS RecName: Full=50S ribosomal protein L28
 gi|209959868|gb|ACJ00505.1| ribosomal protein L28 [Rhodospirillum centenum SW]
          Length = 99

 Score = 83.6 bits (205), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 42/97 (43%), Positives = 62/97 (63%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR C +T K V +GN VSHANNK+RRR+LPNL   +L+SD + +  +LR+S   +R++E
Sbjct: 1  MSRKCAVTGKGVQTGNNVSHANNKSRRRWLPNLQETSLLSDTLGRMVRLRLSTNGIRTIE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKSS 97
           +GGLD  L +     L+   R ++ QI K +  K +
Sbjct: 61 HKGGLDAALLDIPDARLNQDARRVKKQIQKAIEAKKA 97


>gi|316931526|ref|YP_004106508.1| 50S ribosomal protein L28 [Rhodopseudomonas palustris DX-1]
 gi|315599240|gb|ADU41775.1| ribosomal protein L28 [Rhodopseudomonas palustris DX-1]
          Length = 101

 Score = 83.6 bits (205), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 42/88 (47%), Positives = 57/88 (64%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT K    G+KVSH+N KT+RRFLPNL  +T  SD + +  +LR+S  AL+SV+
Sbjct: 1  MSRRCELTAKGAQVGHKVSHSNIKTKRRFLPNLVNVTFQSDTLGRSVRLRVSTNALKSVD 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQI 88
           +GGLD +L  +    LS +   L+  I
Sbjct: 61 HRGGLDAYLLKASDAELSPKAVELKRAI 88


>gi|126733276|ref|ZP_01749023.1| ribosomal protein L28 [Roseobacter sp. CCS2]
 gi|126716142|gb|EBA13006.1| ribosomal protein L28 [Roseobacter sp. CCS2]
          Length = 82

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 38/78 (48%), Positives = 54/78 (69%)

Query: 13 MSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFLSNS 72
          MSGN VSHA N+TRRRFLPNL  +TL SD + + ++ +IS  ALR+V+ +GGLD F++ +
Sbjct: 1  MSGNNVSHAKNRTRRRFLPNLQDVTLQSDTLGRSFKFKISNAALRTVDHRGGLDAFMAKA 60

Query: 73 KKENLSARMRTLRSQILK 90
          K   LS     ++ +I K
Sbjct: 61 KDAELSDNALKVKKEIAK 78


>gi|190570684|ref|YP_001975042.1| ribosomal protein L28 [Wolbachia endosymbiont of Culex
          quinquefasciatus Pel]
 gi|213019068|ref|ZP_03334875.1| ribosomal protein L28 [Wolbachia endosymbiont of Culex
          quinquefasciatus JHB]
 gi|190356956|emb|CAQ54342.1| ribosomal protein L28 [Wolbachia endosymbiont of Culex
          quinquefasciatus Pel]
 gi|212995177|gb|EEB55818.1| ribosomal protein L28 [Wolbachia endosymbiont of Culex
          quinquefasciatus JHB]
          Length = 104

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 40/78 (51%), Positives = 56/78 (71%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR+CELT +    GNKVSH+N KT+R FL NL ++TL S+I+E+K+  RI+   LR+++
Sbjct: 1  MSRICELTNRKKSFGNKVSHSNRKTKRTFLLNLHKVTLTSNILEKKFSFRIATRTLRTID 60

Query: 61 RQGGLDRFLSNSKKENLS 78
           +G LD FL N+K   LS
Sbjct: 61 YKGDLDAFLLNTKTIKLS 78


>gi|315498114|ref|YP_004086918.1| ribosomal protein l28 [Asticcacaulis excentricus CB 48]
 gi|315416126|gb|ADU12767.1| ribosomal protein L28 [Asticcacaulis excentricus CB 48]
          Length = 98

 Score = 82.8 bits (203), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 43/88 (48%), Positives = 58/88 (65%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT    M G+ VSH+N KT+RRFLP+L    L S+ + Q ++L+IS  ALR+++
Sbjct: 1  MSRRCELTGVGPMVGHSVSHSNIKTKRRFLPSLRETALQSEALGQSFRLKISNAALRTLD 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQI 88
           +GGLD FL  +    LS R R L+ QI
Sbjct: 61 FKGGLDAFLVKADDTELSLRARRLKKQI 88


>gi|57239262|ref|YP_180398.1| 50S ribosomal protein L28 [Ehrlichia ruminantium str.
          Welgevonden]
 gi|58579225|ref|YP_197437.1| 50S ribosomal protein L28 [Ehrlichia ruminantium str.
          Welgevonden]
 gi|81557296|sp|Q5HAZ6|RL28_EHRRW RecName: Full=50S ribosomal protein L28
 gi|57161341|emb|CAH58264.1| 50S ribosomal protein L28 [Ehrlichia ruminantium str.
          Welgevonden]
 gi|58417851|emb|CAI27055.1| 50S ribosomal protein L28 [Ehrlichia ruminantium str.
          Welgevonden]
          Length = 100

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 39/96 (40%), Positives = 64/96 (66%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T +T   GNKVSH+N KT+R +L NL  +TL SD++ +K++ +IS   LR+++
Sbjct: 1  MSRVCDITGQTKSFGNKVSHSNRKTKRTYLVNLHNVTLFSDVLNRKFRFKISSRTLRTID 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKS 96
           +GGLD +L  +    LS + + ++  I K  +E +
Sbjct: 61 YKGGLDLYLLETSSRKLSDKAQKIKKMIKKATAENA 96


>gi|42520268|ref|NP_966183.1| 50S ribosomal protein L28 [Wolbachia endosymbiont of Drosophila
          melanogaster]
 gi|58700226|ref|ZP_00374712.1| ribosomal protein L28-related protein [Wolbachia endosymbiont of
          Drosophila ananassae]
 gi|99034408|ref|ZP_01314419.1| hypothetical protein Wendoof_01000778 [Wolbachia endosymbiont of
          Drosophila willistoni TSC#14030-0811.24]
 gi|225630197|ref|YP_002726988.1| ribosomal protein L28 [Wolbachia sp. wRi]
 gi|225677014|ref|ZP_03788027.1| ribosomal protein L28 [Wolbachia endosymbiont of Muscidifurax
          uniraptor]
 gi|67461471|sp|Q73HZ5|RL28_WOLPM RecName: Full=50S ribosomal protein L28
 gi|42410006|gb|AAS14117.1| ribosomal protein L28 [Wolbachia endosymbiont of Drosophila
          melanogaster]
 gi|58533257|gb|EAL57770.1| ribosomal protein L28-related protein [Wolbachia endosymbiont of
          Drosophila ananassae]
 gi|225590940|gb|EEH12154.1| ribosomal protein L28 [Wolbachia endosymbiont of Muscidifurax
          uniraptor]
 gi|225592178|gb|ACN95197.1| ribosomal protein L28 [Wolbachia sp. wRi]
          Length = 104

 Score = 82.0 bits (201), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 40/90 (44%), Positives = 63/90 (70%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVCELT +    GNKVSH+N KT+R FL NL ++TL SDI+ +K++ R++   LR+++
Sbjct: 1  MSRVCELTNRKKSFGNKVSHSNRKTKRTFLLNLHKVTLTSDILNKKFRFRVATRTLRTID 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILK 90
           +G LD FL N++   LS + + ++ ++ K
Sbjct: 61 YKGDLDAFLLNTRTIKLSEKAQKIKRRLKK 90


>gi|254796704|ref|YP_003081540.1| ribosomal protein L28 [Neorickettsia risticii str. Illinois]
 gi|254589934|gb|ACT69296.1| ribosomal protein L28 [Neorickettsia risticii str. Illinois]
          Length = 86

 Score = 82.0 bits (201), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 57/76 (75%)

Query: 18 VSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFLSNSKKENL 77
          VSH+N KT++RF+PNL RIT+ SD+++QK++ ++S   +R+V+ +GGLD FL N+K   L
Sbjct: 2  VSHSNRKTKKRFMPNLQRITVFSDVLKQKFRFKVSAKTIRTVDFKGGLDDFLRNTKNSKL 61

Query: 78 SARMRTLRSQILKKMS 93
          S     L+ +I+KK+S
Sbjct: 62 SKSALALKKRIMKKVS 77


>gi|83591550|ref|YP_425302.1| 50S ribosomal protein L28 [Rhodospirillum rubrum ATCC 11170]
 gi|123527567|sp|Q2RXY0|RL28_RHORT RecName: Full=50S ribosomal protein L28
 gi|83574464|gb|ABC21015.1| LSU ribosomal protein L28P [Rhodospirillum rubrum ATCC 11170]
          Length = 99

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 39/90 (43%), Positives = 63/90 (70%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR C +T K V +GN VSH+N K+RRRFLPNL   +L+SD++ +  ++R+S   LR+VE
Sbjct: 1  MSRRCAVTGKGVQTGNNVSHSNIKSRRRFLPNLQVNSLMSDLLREPVRMRLSAHGLRTVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILK 90
           +GG+D FL ++    L+  +R ++ +++K
Sbjct: 61 HRGGIDAFLLSTPSVELTVELRKVKRRMVK 90


>gi|58617277|ref|YP_196476.1| 50S ribosomal protein L28 [Ehrlichia ruminantium str. Gardel]
 gi|75432681|sp|Q5FFP1|RL28_EHRRG RecName: Full=50S ribosomal protein L28
 gi|58416889|emb|CAI28002.1| 50S ribosomal protein L28 [Ehrlichia ruminantium str. Gardel]
          Length = 100

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 62/94 (65%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T +T   GNKVSH+N KT+R +L NL  +TL SD++ +K++ +IS   LR+++
Sbjct: 1  MSRVCDITGQTKSFGNKVSHSNRKTKRTYLVNLHNVTLFSDVLNRKFRFKISSRTLRTID 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSE 94
           +GG D +L  +    LS + + ++  I K  +E
Sbjct: 61 YKGGFDLYLLETSSRKLSDKAQKIKKMIKKATAE 94


>gi|88657876|ref|YP_507300.1| 50S ribosomal protein L28 [Ehrlichia chaffeensis str. Arkansas]
 gi|123493481|sp|Q2GGY3|RL28_EHRCR RecName: Full=50S ribosomal protein L28
 gi|88599333|gb|ABD44802.1| 50S ribosomal protein L28 [Ehrlichia chaffeensis str. Arkansas]
          Length = 100

 Score = 80.9 bits (198), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 41/92 (44%), Positives = 64/92 (69%), Gaps = 5/92 (5%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T +    GNKVSH+N KT+R +L NL  +TL+SDI+ +K++ ++S   LR+V 
Sbjct: 1  MSRVCDITGQGKSFGNKVSHSNRKTKRAYLVNLHNVTLVSDILNRKFKFKVSSRTLRTVN 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKM 92
           +GGLD +L N+     S+R  T ++Q +KK+
Sbjct: 61 YKGGLDLYLLNT-----SSRKLTDKAQKIKKL 87


>gi|15603977|ref|NP_220492.1| 50S ribosomal protein L28 [Rickettsia prowazekii str. Madrid E]
 gi|6225989|sp|Q9ZE48|RL28_RICPR RecName: Full=50S ribosomal protein L28
 gi|3860668|emb|CAA14569.1| 50S RIBOSOMAL PROTEIN L28 (rpmB) [Rickettsia prowazekii]
 gi|292571691|gb|ADE29606.1| 50S ribosomal protein L28 [Rickettsia prowazekii Rp22]
          Length = 97

 Score = 80.5 bits (197), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 41/96 (42%), Positives = 60/96 (62%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT   V+ GN VSH+  KTRRRF PNL  I   SDI ++ Y+L ++   +RSVE
Sbjct: 1  MSRKCELTGVGVLYGNNVSHSQRKTRRRFEPNLRSIKFRSDITDEVYRLSVNARCIRSVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKS 96
          + GG D ++  +  + LS+  R ++ +I+   + KS
Sbjct: 61 KAGGFDAYILKANDDILSSAARAIKQKIIHIKAAKS 96


>gi|67458475|ref|YP_246099.1| 50S ribosomal protein L28 [Rickettsia felis URRWXCal2]
 gi|75537055|sp|Q4UNC4|RL28_RICFE RecName: Full=50S ribosomal protein L28
 gi|67004008|gb|AAY60934.1| 50S ribosomal protein L28 [Rickettsia felis URRWXCal2]
          Length = 97

 Score = 80.1 bits (196), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 40/96 (41%), Positives = 59/96 (61%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT   V+ GN VSH+  KTRRRF PNL  +   SDI   +Y+L ++   + SVE
Sbjct: 1  MSRKCELTGVGVLYGNNVSHSQRKTRRRFEPNLRSVKFTSDITAGEYRLSVNARCISSVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKS 96
          + GG D ++  +    LS+  RT++ +I++  + KS
Sbjct: 61 KAGGFDAYILKADDNVLSSNARTIKKKIIQTKTAKS 96


>gi|91206094|ref|YP_538449.1| 50S ribosomal protein L28 [Rickettsia bellii RML369-C]
 gi|157826473|ref|YP_001495537.1| 50S ribosomal protein L28 [Rickettsia bellii OSU 85-389]
 gi|122425214|sp|Q1RH04|RL28_RICBR RecName: Full=50S ribosomal protein L28
 gi|166226612|sp|A8GUK4|RL28_RICB8 RecName: Full=50S ribosomal protein L28
 gi|91069638|gb|ABE05360.1| 50S ribosomal protein L28 [Rickettsia bellii RML369-C]
 gi|157801777|gb|ABV78500.1| 50S ribosomal protein L28 [Rickettsia bellii OSU 85-389]
          Length = 97

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 40/96 (41%), Positives = 58/96 (60%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT   V+ GN VSH+  KTRRRF PNL  +  ISDI   +Y+L +S   + SVE
Sbjct: 1  MSRKCELTGVGVLYGNNVSHSQRKTRRRFEPNLRSVKFISDITTAEYRLSVSARCISSVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKS 96
          + GG D ++  +  + LS   + ++ +I++    KS
Sbjct: 61 KAGGFDAYMLKANNDALSTTAKAIKKKIIQTKMAKS 96


>gi|58700297|ref|ZP_00374759.1| ribosomal protein L28-related protein [Wolbachia endosymbiont of
          Drosophila ananassae]
 gi|58533187|gb|EAL57724.1| ribosomal protein L28-related protein [Wolbachia endosymbiont of
          Drosophila ananassae]
          Length = 103

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 39/89 (43%), Positives = 62/89 (69%)

Query: 2  SRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVER 61
          SRVCELT +    GNKVSH+N KT+R FL NL ++TL SDI+ +K++ R++   LR+++ 
Sbjct: 1  SRVCELTNRKKSFGNKVSHSNRKTKRTFLLNLHKVTLTSDILNKKFRFRVATRTLRTIDY 60

Query: 62 QGGLDRFLSNSKKENLSARMRTLRSQILK 90
          +G LD FL N++   LS + + ++ ++ K
Sbjct: 61 KGDLDAFLLNTRTIKLSEKAQKIKRRLKK 89


>gi|157825271|ref|YP_001492991.1| 50S ribosomal protein L28 [Rickettsia akari str. Hartford]
 gi|166226611|sp|A8GM58|RL28_RICAH RecName: Full=50S ribosomal protein L28
 gi|157799229|gb|ABV74483.1| 50S ribosomal protein L28 [Rickettsia akari str. Hartford]
          Length = 97

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 40/96 (41%), Positives = 58/96 (60%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT   V+ GN VSH+  KTRRRF PNL  +   SDI   KY+L ++   + SVE
Sbjct: 1  MSRKCELTGVGVLYGNNVSHSQRKTRRRFEPNLRSVKFTSDITAGKYRLSVNARCISSVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKS 96
          + GG D ++  +    LS+  R ++ +I++  + KS
Sbjct: 61 KAGGFDAYILQADDNVLSSNARAIKKKIIQTKTAKS 96


>gi|51473250|ref|YP_067007.1| 50S ribosomal protein L28 [Rickettsia typhi str. Wilmington]
 gi|67461384|sp|Q68XW7|RL28_RICTY RecName: Full=50S ribosomal protein L28
 gi|51459562|gb|AAU03525.1| 50S ribosomal protein L28 [Rickettsia typhi str. Wilmington]
          Length = 97

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 38/89 (42%), Positives = 58/89 (65%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT  +V+ GN VSH+  KTRRRF PNL  +   SDI ++ Y+L ++   +RSVE
Sbjct: 1  MSRKCELTGVSVLYGNNVSHSQRKTRRRFEPNLRSVKFRSDITDEVYRLSVNARCIRSVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQIL 89
          + GG D ++  +  + LS+  R ++ +I+
Sbjct: 61 KAGGFDEYILKANNDVLSSTARAIKQKII 89


>gi|73667160|ref|YP_303176.1| 50S ribosomal protein L28 [Ehrlichia canis str. Jake]
 gi|123614861|sp|Q3YRS7|RL28_EHRCJ RecName: Full=50S ribosomal protein L28
 gi|72394301|gb|AAZ68578.1| LSU ribosomal protein L28P [Ehrlichia canis str. Jake]
          Length = 100

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 39/92 (42%), Positives = 64/92 (69%), Gaps = 5/92 (5%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T +    GNKVSH+N KT+R +L NL  +TL+SDI+ +K++ ++S   LR+++
Sbjct: 1  MSRVCDITGQGKSFGNKVSHSNRKTKRTYLVNLHNVTLLSDILNRKFKFKVSSRTLRTID 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKM 92
           +GG D +L N+     S+R  T ++Q +KK+
Sbjct: 61 YKGGFDLYLLNT-----SSRKLTDKAQKIKKL 87


>gi|58584560|ref|YP_198133.1| 50S ribosomal protein L28 [Wolbachia endosymbiont strain TRS of
          Brugia malayi]
 gi|67461241|sp|Q5GSY3|RL28_WOLTR RecName: Full=50S ribosomal protein L28
 gi|58418876|gb|AAW70891.1| Ribosomal protein L28 [Wolbachia endosymbiont strain TRS of
          Brugia malayi]
          Length = 104

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 39/95 (41%), Positives = 66/95 (69%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVCELT +    GNKVSH+N K +R FL NL  +TLIS+I+ +K++ R++   LR+++
Sbjct: 1  MSRVCELTNRKKSFGNKVSHSNRKAKRIFLLNLHNVTLISNILNKKFKFRVAIRTLRTID 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEK 95
           +G LD FL N++   LS + + ++ ++ K ++++
Sbjct: 61 YKGNLDAFLLNTRTVKLSKKAQKIKRKLKKVLAKQ 95


>gi|157828010|ref|YP_001494252.1| 50S ribosomal protein L28 [Rickettsia rickettsii str. 'Sheila
          Smith']
 gi|165932708|ref|YP_001649497.1| 50S ribosomal protein L28 [Rickettsia rickettsii str. Iowa]
 gi|166226614|sp|A8GQR9|RL28_RICRS RecName: Full=50S ribosomal protein L28
 gi|189029452|sp|B0BW65|RL28_RICRO RecName: Full=50S ribosomal protein L28
 gi|157800491|gb|ABV75744.1| 50S ribosomal protein L28 [Rickettsia rickettsii str. 'Sheila
          Smith']
 gi|165907795|gb|ABY72091.1| LSU ribosomal protein L28P [Rickettsia rickettsii str. Iowa]
          Length = 97

 Score = 78.2 bits (191), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 39/96 (40%), Positives = 57/96 (59%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT   V+ GN VSH+  KTRRRF PNL  +   SDI   +Y+L ++   + SVE
Sbjct: 1  MSRKCELTGVGVLYGNNVSHSQRKTRRRFEPNLRSVKFTSDITAGEYRLSVNARCISSVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKS 96
          + GG D ++  +    LS   R ++ +I++  + KS
Sbjct: 61 KAGGFDAYILKADDNVLSGNARAIKKKIIQTKTAKS 96


>gi|15892059|ref|NP_359773.1| 50S ribosomal protein L28 [Rickettsia conorii str. Malish 7]
 gi|34580910|ref|ZP_00142390.1| 50S ribosomal protein L28 [Rickettsia sibirica 246]
 gi|157964165|ref|YP_001498989.1| 50S ribosomal protein L28 [Rickettsia massiliae MTU5]
 gi|229586339|ref|YP_002844840.1| 50S ribosomal protein L28 [Rickettsia africae ESF-5]
 gi|239947148|ref|ZP_04698901.1| 50S ribosomal protein L28 [Rickettsia endosymbiont of Ixodes
          scapularis]
 gi|20139556|sp|Q92JD1|RL28_RICCN RecName: Full=50S ribosomal protein L28
 gi|166987915|sp|A8F0K6|RL28_RICM5 RecName: Full=50S ribosomal protein L28
 gi|259646748|sp|C3PMD7|RL28_RICAE RecName: Full=50S ribosomal protein L28
 gi|15619179|gb|AAL02674.1| 50S ribosomal protein L28 [Rickettsia conorii str. Malish 7]
 gi|28262295|gb|EAA25799.1| 50S ribosomal protein L28 [Rickettsia sibirica 246]
 gi|157843941|gb|ABV84442.1| 50S ribosomal protein L28 [Rickettsia massiliae MTU5]
 gi|228021389|gb|ACP53097.1| 50S ribosomal protein L28 [Rickettsia africae ESF-5]
 gi|239921424|gb|EER21448.1| 50S ribosomal protein L28 [Rickettsia endosymbiont of Ixodes
          scapularis]
          Length = 97

 Score = 78.2 bits (191), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 39/96 (40%), Positives = 58/96 (60%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT   V+ GN VSH+  KTRRRF PNL  +   SDI   +Y+L ++   + SVE
Sbjct: 1  MSRKCELTGVGVLYGNNVSHSQRKTRRRFEPNLRSVKFTSDITAGEYRLSVNARCISSVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKS 96
          + GG D ++  +    LS+  R ++ +I++  + KS
Sbjct: 61 KAGGFDAYILKADDNVLSSNARAIKKKIIQTKTAKS 96


>gi|238650564|ref|YP_002916416.1| 50S ribosomal protein L28 [Rickettsia peacockii str. Rustic]
 gi|259646749|sp|C4K1B7|RL28_RICPU RecName: Full=50S ribosomal protein L28
 gi|238624662|gb|ACR47368.1| 50S ribosomal protein L28 [Rickettsia peacockii str. Rustic]
          Length = 97

 Score = 78.2 bits (191), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 39/96 (40%), Positives = 58/96 (60%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT   V+ GN VSH+  KTRRRF PNL  +   SDI   +Y+L ++   + SVE
Sbjct: 1  MSRKCELTGVGVLYGNNVSHSQRKTRRRFKPNLRSVKFTSDITAGEYRLSVNARCISSVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKS 96
          + GG D ++  +    LS+  R ++ +I++  + KS
Sbjct: 61 KAGGFDAYILKADDNVLSSNARAIKKKIIQTKTAKS 96


>gi|88607418|ref|YP_504966.1| 50S ribosomal protein L28 [Anaplasma phagocytophilum HZ]
 gi|123495525|sp|Q2GKY5|RL28_ANAPZ RecName: Full=50S ribosomal protein L28
 gi|88598481|gb|ABD43951.1| ribosomal protein L28 [Anaplasma phagocytophilum HZ]
          Length = 103

 Score = 76.6 bits (187), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 34/88 (38%), Positives = 62/88 (70%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T  +   GNKVSH+N KT+R +L NL  +TL+S+++ +K++++++   LR+++
Sbjct: 1  MSRVCDITGASKSFGNKVSHSNRKTKRSYLVNLHNVTLVSEVLGRKFRVKVASRTLRTID 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQI 88
           +GGLD +L N+    L+   R ++ +I
Sbjct: 61 YKGGLDLYLLNTSSRKLTEVARKIKRKI 88


>gi|189184694|ref|YP_001938479.1| 50S ribosomal protein L28 [Orientia tsutsugamushi str. Ikeda]
 gi|226699054|sp|B3CV48|RL28_ORITI RecName: Full=50S ribosomal protein L28
 gi|189181465|dbj|BAG41245.1| 50S ribosomal protein L28 [Orientia tsutsugamushi str. Ikeda]
          Length = 95

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 34/78 (43%), Positives = 57/78 (73%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVCELT  +V SG+ VSH+  KT+R+FLPNL  ++L SD +++ ++ ++   A+R+++
Sbjct: 1  MSRVCELTGVSVQSGHNVSHSQRKTKRKFLPNLQNVSLFSDSLKKAFKFKVVARAMRTLD 60

Query: 61 RQGGLDRFLSNSKKENLS 78
          + GGLD +L ++  + LS
Sbjct: 61 KVGGLDCYLLSASDKTLS 78


>gi|148284100|ref|YP_001248190.1| 50S ribosomal protein L28 [Orientia tsutsugamushi str. Boryong]
 gi|166226593|sp|A5CC87|RL28_ORITB RecName: Full=50S ribosomal protein L28
 gi|146739539|emb|CAM79268.1| 50S ribosomal protein L28 [Orientia tsutsugamushi str. Boryong]
          Length = 96

 Score = 75.5 bits (184), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 66/97 (68%), Gaps = 1/97 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVCELT  +V SG+ VSH+  KT+R+FLPNL  ++L SD +++ ++ ++   A+R+++
Sbjct: 1  MSRVCELTGVSVQSGHNVSHSQRKTKRKFLPNLQNVSLFSDSLKKAFKFKVVARAIRTLD 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKSS 97
          + GGLD +L ++  + LS     ++ +I+K    KSS
Sbjct: 61 KVGGLDCYLLSASDKILSKFAIEVK-KIIKNNGSKSS 96


>gi|157803281|ref|YP_001491830.1| 50S ribosomal protein L28 [Rickettsia canadensis str. McKiel]
 gi|166226613|sp|A8EXG2|RL28_RICCK RecName: Full=50S ribosomal protein L28
 gi|157784544|gb|ABV73045.1| 50S ribosomal protein L28 [Rickettsia canadensis str. McKiel]
          Length = 97

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 38/96 (39%), Positives = 57/96 (59%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR C+LT   V+ GN VSH+  KTRRRF PNL  +   SDI    Y+L ++   + SVE
Sbjct: 1  MSRKCDLTGVGVLYGNNVSHSQRKTRRRFEPNLRSVKFKSDITSGAYRLLVNARCISSVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKS 96
          + GG D ++  +    LS+  R ++ +I++  + KS
Sbjct: 61 KAGGFDAYILKADDNVLSSAARAIKKKIIQTKTAKS 96


>gi|254456316|ref|ZP_05069745.1| 50S ribosomal protein L28 [Candidatus Pelagibacter sp. HTCC7211]
 gi|207083318|gb|EDZ60744.1| 50S ribosomal protein L28 [Candidatus Pelagibacter sp. HTCC7211]
          Length = 91

 Score = 73.9 bits (180), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 48/68 (70%)

Query: 13 MSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFLSNS 72
          M G+ VSHANNKT+RRFLPNL ++   S++M++  +L +S   +RSV+++G  D +L   
Sbjct: 1  MKGHNVSHANNKTKRRFLPNLKKVKFTSELMKRSLKLTVSNAGVRSVDKKGSFDEYLKVV 60

Query: 73 KKENLSAR 80
          K +NLS R
Sbjct: 61 KNKNLSPR 68


>gi|329890834|ref|ZP_08269177.1| 50S ribosomal protein L28 [Brevundimonas diminuta ATCC 11568]
 gi|328846135|gb|EGF95699.1| 50S ribosomal protein L28 [Brevundimonas diminuta ATCC 11568]
          Length = 86

 Score = 73.6 bits (179), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 57/85 (67%)

Query: 13 MSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFLSNS 72
          M G+ VSH+N KT+RRFLP L  + + S+ + Q + LRIS  ALR+++ +GGLD F+  +
Sbjct: 1  MVGHHVSHSNIKTKRRFLPALKTVKVQSEALGQTFSLRISNAALRTLDFKGGLDAFIVKA 60

Query: 73 KKENLSARMRTLRSQILKKMSEKSS 97
          + E LS     ++ Q+  K++E+++
Sbjct: 61 RDEQLSIAALRIKRQVRAKLAEQAA 85


>gi|67461310|sp|Q5PAC9|RL28_ANAMM RecName: Full=50S ribosomal protein L28
          Length = 103

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 33/88 (37%), Positives = 59/88 (67%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T      GNKVSH+N KT+R +L NL  +TL+S+++ +K++++++   LR++ 
Sbjct: 1  MSRVCDVTGLAKSFGNKVSHSNRKTKRSYLVNLHNVTLVSEVLGRKFKMKVAARTLRTIN 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQI 88
           +GG D +L N+    LS   + ++ +I
Sbjct: 61 YKGGFDLYLLNTASRKLSDEAQKIKRKI 88


>gi|254995116|ref|ZP_05277306.1| 50S ribosomal protein L28 (rpmB) [Anaplasma marginale str.
          Mississippi]
 gi|255004409|ref|ZP_05279210.1| 50S ribosomal protein L28 (rpmB) [Anaplasma marginale str.
          Virginia]
          Length = 103

 Score = 72.0 bits (175), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 32/88 (36%), Positives = 59/88 (67%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T      GN+VSH+N KT+R +L NL  +TL+S+++ +K++++++   LR++ 
Sbjct: 1  MSRVCDVTGLAKSFGNRVSHSNRKTKRSYLVNLHNVTLVSEVLGRKFKMKVAARTLRTIN 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQI 88
           +GG D +L N+    LS   + ++ +I
Sbjct: 61 YKGGFDLYLLNTASRKLSDEAQKIKRKI 88


>gi|15837808|ref|NP_298496.1| 50S ribosomal protein L28 [Xylella fastidiosa 9a5c]
 gi|28198400|ref|NP_778714.1| 50S ribosomal protein L28 [Xylella fastidiosa Temecula1]
 gi|71276524|ref|ZP_00652799.1| Ribosomal protein L28 [Xylella fastidiosa Dixon]
 gi|71900735|ref|ZP_00682857.1| Ribosomal protein L28 [Xylella fastidiosa Ann-1]
 gi|71901114|ref|ZP_00683221.1| Ribosomal protein L28 [Xylella fastidiosa Ann-1]
 gi|170729748|ref|YP_001775181.1| 50S ribosomal protein L28 [Xylella fastidiosa M12]
 gi|182681042|ref|YP_001829202.1| 50S ribosomal protein L28 [Xylella fastidiosa M23]
 gi|54039156|sp|P66163|RL28_XYLFT RecName: Full=50S ribosomal protein L28
 gi|54041855|sp|P66162|RL28_XYLFA RecName: Full=50S ribosomal protein L28
 gi|226699186|sp|B2I8L7|RL28_XYLF2 RecName: Full=50S ribosomal protein L28
 gi|226699187|sp|B0U5P7|RL28_XYLFM RecName: Full=50S ribosomal protein L28
 gi|9106178|gb|AAF84016.1|AE003954_13 50S ribosomal protein L28 [Xylella fastidiosa 9a5c]
 gi|28056470|gb|AAO28363.1| 50S ribosomal protein L28 [Xylella fastidiosa Temecula1]
 gi|71162701|gb|EAO12428.1| Ribosomal protein L28 [Xylella fastidiosa Dixon]
 gi|71729119|gb|EAO31243.1| Ribosomal protein L28 [Xylella fastidiosa Ann-1]
 gi|71729505|gb|EAO31614.1| Ribosomal protein L28 [Xylella fastidiosa Ann-1]
 gi|167964541|gb|ACA11551.1| 50S ribosomal protein L28 [Xylella fastidiosa M12]
 gi|182631152|gb|ACB91928.1| ribosomal protein L28 [Xylella fastidiosa M23]
 gi|307579510|gb|ADN63479.1| 50S ribosomal protein L28 [Xylella fastidiosa subsp. fastidiosa
          GB514]
          Length = 78

 Score = 72.0 bits (175), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 49/70 (70%), Gaps = 1/70 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K V +GN VSHANNKTRRRFLPNL +         +  +LR+S CA+R+++
Sbjct: 1  MSRVCQVTGKRVQTGNNVSHANNKTRRRFLPNLHKRRFWVASENRWVKLRVSTCAVRTID 60

Query: 61 RQGGLDRFLS 70
          +  G+D  L+
Sbjct: 61 KN-GIDAVLA 69


>gi|255003282|ref|ZP_05278246.1| 50S ribosomal protein L28 (rpmB) [Anaplasma marginale str. Puerto
           Rico]
          Length = 117

 Score = 71.2 bits (173), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 32/88 (36%), Positives = 59/88 (67%)

Query: 1   MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
           +SRVC++T      GNKVSH+N KT+R +L NL  +TL+S+++ +K++++++   LR++ 
Sbjct: 15  VSRVCDVTGLAKSFGNKVSHSNRKTKRSYLVNLHNVTLVSEVLGRKFKMKVAARTLRTIN 74

Query: 61  RQGGLDRFLSNSKKENLSARMRTLRSQI 88
            +GG D +L N+    LS   + ++ +I
Sbjct: 75  YKGGFDLYLLNTASRKLSDEAQKIKRKI 102


>gi|56416932|ref|YP_154006.1| 50S ribosomal protein L28 [Anaplasma marginale str. St. Maries]
 gi|222475298|ref|YP_002563715.1| 50S ribosomal protein L28 (rpmB) [Anaplasma marginale str. Florida]
 gi|56388164|gb|AAV86751.1| 50S ribosomal protein L28 [Anaplasma marginale str. St. Maries]
 gi|222419436|gb|ACM49459.1| 50S ribosomal protein L28 (rpmB) [Anaplasma marginale str. Florida]
          Length = 134

 Score = 71.2 bits (173), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 32/88 (36%), Positives = 59/88 (67%)

Query: 1   MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
           +SRVC++T      GNKVSH+N KT+R +L NL  +TL+S+++ +K++++++   LR++ 
Sbjct: 32  VSRVCDVTGLAKSFGNKVSHSNRKTKRSYLVNLHNVTLVSEVLGRKFKMKVAARTLRTIN 91

Query: 61  RQGGLDRFLSNSKKENLSARMRTLRSQI 88
            +GG D +L N+    LS   + ++ +I
Sbjct: 92  YKGGFDLYLLNTASRKLSDEAQKIKRKI 119


>gi|119897427|ref|YP_932640.1| 50S ribosomal protein L28 [Azoarcus sp. BH72]
 gi|166226540|sp|A1K4J8|RL28_AZOSB RecName: Full=50S ribosomal protein L28
 gi|119669840|emb|CAL93753.1| 50S ribosomal protein L28 [Azoarcus sp. BH72]
          Length = 78

 Score = 70.5 bits (171), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 32/63 (50%), Positives = 45/63 (71%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVC++T K  M GN VSHANNKT+RRFLPNL      S+   +  +LR+S  ALR+++
Sbjct: 1  MARVCQVTGKAPMVGNHVSHANNKTKRRFLPNLQNRRFWSEAENRWIRLRVSNAALRTID 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|319788437|ref|YP_004147912.1| ribosomal protein L28 [Pseudoxanthomonas suwonensis 11-1]
 gi|317466949|gb|ADV28681.1| ribosomal protein L28 [Pseudoxanthomonas suwonensis 11-1]
          Length = 78

 Score = 70.1 bits (170), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 47/70 (67%), Gaps = 1/70 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K V +GN VSHANNKTRRRFLPNL           +  +LR+S  ALR+++
Sbjct: 1  MSRVCQVTGKGVQTGNNVSHANNKTRRRFLPNLHERRFWVASENRWVKLRVSAAALRTID 60

Query: 61 RQGGLDRFLS 70
          +  G+D  L+
Sbjct: 61 KN-GIDSVLA 69


>gi|269958654|ref|YP_003328441.1| 50S ribosomal protein L28 [Anaplasma centrale str. Israel]
 gi|269848483|gb|ACZ49127.1| 50S ribosomal protein L28 [Anaplasma centrale str. Israel]
          Length = 117

 Score = 70.1 bits (170), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 59/88 (67%)

Query: 1   MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
           +SRVC++T      GN+VSH+N KT+R +L NL  +TL+S+++ +K++++++   LR++ 
Sbjct: 15  VSRVCDVTGLAKSFGNRVSHSNRKTKRSYLVNLHNVTLVSEVLGRKFKMKVAARTLRTIN 74

Query: 61  RQGGLDRFLSNSKKENLSARMRTLRSQI 88
            +GG D +L N+    LS   + ++ +I
Sbjct: 75  YKGGFDLYLLNTASRKLSDEAQKIKRKI 102


>gi|56477979|ref|YP_159568.1| 50S ribosomal protein L28 [Aromatoleum aromaticum EbN1]
 gi|67461304|sp|Q5P1Z7|RL28_AZOSE RecName: Full=50S ribosomal protein L28
 gi|56314022|emb|CAI08667.1| 50S ribosomal protein L28 [Aromatoleum aromaticum EbN1]
          Length = 78

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 32/63 (50%), Positives = 45/63 (71%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVC++T K  M GN VSHANNKT+RRFLPNL      S+   +  +LR+S  ALR+++
Sbjct: 1  MARVCQVTGKAPMVGNNVSHANNKTKRRFLPNLQNRRFWSESENRWIRLRVSNAALRTID 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|237747513|ref|ZP_04577993.1| LSU ribosomal protein L28P [Oxalobacter formigenes OXCC13]
 gi|229380956|gb|EEO31047.1| LSU ribosomal protein L28P [Oxalobacter formigenes OXCC13]
          Length = 78

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 34/71 (47%), Positives = 47/71 (66%), Gaps = 1/71 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVC++T K  MSGNKVSHANNKTRRRF+PNL       +   +   LR+S   LR ++
Sbjct: 1  MARVCQITGKKPMSGNKVSHANNKTRRRFMPNLHYRRFFVESENRWVSLRVSNAGLRVID 60

Query: 61 RQGGLDRFLSN 71
          +  G+D  L++
Sbjct: 61 KL-GIDAVLAD 70


>gi|298369464|ref|ZP_06980781.1| ribosomal protein L28 [Neisseria sp. oral taxon 014 str. F0314]
 gi|298282021|gb|EFI23509.1| ribosomal protein L28 [Neisseria sp. oral taxon 014 str. F0314]
          Length = 77

 Score = 68.2 bits (165), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 49/71 (69%), Gaps = 1/71 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVC++T K  MSGN VSHANNKT+RRFLPNL       +   +  +LRIS  ALR+++
Sbjct: 1  MARVCKVTGKRPMSGNNVSHANNKTKRRFLPNLQSRRFWVESENRWVRLRISNAALRTID 60

Query: 61 RQGGLDRFLSN 71
          +  G+D  L++
Sbjct: 61 KV-GIDAVLAD 70


>gi|301629813|ref|XP_002944028.1| PREDICTED: 50S ribosomal protein L28-like [Xenopus (Silurana)
          tropicalis]
          Length = 90

 Score = 68.2 bits (165), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 43/63 (68%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVCE+T K  M GNKVSHANNKT+RRFLPNL       +   +  +LR+S  ALR ++
Sbjct: 14 MARVCEVTGKKPMVGNKVSHANNKTKRRFLPNLQYRRFWVESENRWVRLRVSSAALRLID 73

Query: 61 RQG 63
          + G
Sbjct: 74 KNG 76


>gi|217969674|ref|YP_002354908.1| 50S ribosomal protein L28 [Thauera sp. MZ1T]
 gi|217507001|gb|ACK54012.1| ribosomal protein L28 [Thauera sp. MZ1T]
          Length = 78

 Score = 68.2 bits (165), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 44/63 (69%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVC++T K  M GN VSHANNKT+RRFLPNL      S+   +  +LR+S   LR+++
Sbjct: 1  MARVCQVTGKAPMVGNNVSHANNKTKRRFLPNLQSRRFWSEGENRWIRLRVSNAGLRTID 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|170693581|ref|ZP_02884739.1| ribosomal protein L28 [Burkholderia graminis C4D1M]
 gi|295677433|ref|YP_003605957.1| ribosomal protein L28 [Burkholderia sp. CCGE1002]
 gi|307730753|ref|YP_003907977.1| 50S ribosomal protein L28 [Burkholderia sp. CCGE1003]
 gi|323527116|ref|YP_004229269.1| 50S ribosomal protein L28 [Burkholderia sp. CCGE1001]
 gi|170141363|gb|EDT09533.1| ribosomal protein L28 [Burkholderia graminis C4D1M]
 gi|295437276|gb|ADG16446.1| ribosomal protein L28 [Burkholderia sp. CCGE1002]
 gi|307585288|gb|ADN58686.1| ribosomal protein L28 [Burkholderia sp. CCGE1003]
 gi|323384118|gb|ADX56209.1| ribosomal protein L28 [Burkholderia sp. CCGE1001]
          Length = 77

 Score = 68.2 bits (165), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 34/71 (47%), Positives = 48/71 (67%), Gaps = 1/71 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVC++T K  MSGN VSHANNKT+RRFLPNL    +  +   +  +LRIS   LR ++
Sbjct: 1  MARVCQVTGKAPMSGNNVSHANNKTKRRFLPNLQSRRIWVESENRWVRLRISNAGLRLID 60

Query: 61 RQGGLDRFLSN 71
          +  G+D  L++
Sbjct: 61 KN-GIDAVLAD 70


>gi|302879482|ref|YP_003848046.1| 50S ribosomal protein L28 [Gallionella capsiferriformans ES-2]
 gi|302582271|gb|ADL56282.1| ribosomal protein L28 [Gallionella capsiferriformans ES-2]
          Length = 78

 Score = 67.8 bits (164), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 30/63 (47%), Positives = 43/63 (68%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVC++T K  MSGN VSHANN+T+RRFLPNL R     +   +   LR++   LR+++
Sbjct: 1  MARVCQVTGKGPMSGNNVSHANNRTKRRFLPNLQRRRFWVEAENRWVSLRLTNAGLRTID 60

Query: 61 RQG 63
          + G
Sbjct: 61 KNG 63


>gi|121608722|ref|YP_996529.1| 50S ribosomal protein L28 [Verminephrobacter eiseniae EF01-2]
 gi|166228170|sp|A1WIQ4|RL28_VEREI RecName: Full=50S ribosomal protein L28
 gi|121553362|gb|ABM57511.1| LSU ribosomal protein L28P [Verminephrobacter eiseniae EF01-2]
          Length = 77

 Score = 67.8 bits (164), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 34/71 (47%), Positives = 47/71 (66%), Gaps = 1/71 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVC++T K  M GN VSHANNKTRRRFLPNL       +   +  +LR+S  ALR ++
Sbjct: 1  MARVCDVTGKKPMVGNNVSHANNKTRRRFLPNLQYRRFWVETENRWVRLRVSSAALRLID 60

Query: 61 RQGGLDRFLSN 71
          +  G+D  L++
Sbjct: 61 KN-GIDAVLAD 70


>gi|91784963|ref|YP_560169.1| 50S ribosomal protein L28 [Burkholderia xenovorans LB400]
 gi|209517443|ref|ZP_03266284.1| ribosomal protein L28 [Burkholderia sp. H160]
 gi|296157155|ref|ZP_06839991.1| ribosomal protein L28 [Burkholderia sp. Ch1-1]
 gi|123358513|sp|Q13UX2|RL28_BURXL RecName: Full=50S ribosomal protein L28
 gi|91688917|gb|ABE32117.1| LSU ribosomal protein L28P [Burkholderia xenovorans LB400]
 gi|209502097|gb|EEA02112.1| ribosomal protein L28 [Burkholderia sp. H160]
 gi|295892491|gb|EFG72273.1| ribosomal protein L28 [Burkholderia sp. Ch1-1]
          Length = 77

 Score = 67.8 bits (164), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 48/71 (67%), Gaps = 1/71 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVC++T K  MSGN VSHANNKT+RRFLPNL    +  +   +  +LR+S   LR ++
Sbjct: 1  MARVCQVTGKAPMSGNNVSHANNKTKRRFLPNLQNRRIWVESENRWVRLRVSNAGLRLID 60

Query: 61 RQGGLDRFLSN 71
          +  G+D  L++
Sbjct: 61 KN-GIDAVLAD 70


>gi|164656903|ref|XP_001729578.1| hypothetical protein MGL_3122 [Malassezia globosa CBS 7966]
 gi|159103471|gb|EDP42364.1| hypothetical protein MGL_3122 [Malassezia globosa CBS 7966]
          Length = 153

 Score = 67.8 bits (164), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 29/84 (34%), Positives = 55/84 (65%)

Query: 12  VMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFLSN 71
           V  GN +  + +KT R++ PN+ R TL S+ +++    R++  A+RS+E+ GGLD++L+ 
Sbjct: 62  VQFGNTIPKSRHKTSRKWTPNIQRTTLWSETLQEYVTTRVATSAMRSIEKHGGLDQYLAR 121

Query: 72  SKKENLSARMRTLRSQILKKMSEK 95
           +K+ +L    RTLR ++ + + +K
Sbjct: 122 TKESHLGEFGRTLRMRVARALRDK 145


>gi|291613167|ref|YP_003523324.1| ribosomal protein L28 [Sideroxydans lithotrophicus ES-1]
 gi|291583279|gb|ADE10937.1| ribosomal protein L28 [Sideroxydans lithotrophicus ES-1]
          Length = 78

 Score = 67.4 bits (163), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 44/63 (69%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVC++T K  M GN +SHANNKT+RRFLPNL R  L  +   +   LR++  ALR+++
Sbjct: 1  MARVCQVTGKKPMVGNNISHANNKTKRRFLPNLQRRRLWVESENRWVSLRLTNAALRTID 60

Query: 61 RQG 63
          + G
Sbjct: 61 KNG 63


>gi|325982098|ref|YP_004294500.1| 50S ribosomal protein L28 [Nitrosomonas sp. AL212]
 gi|325531617|gb|ADZ26338.1| ribosomal protein L28 [Nitrosomonas sp. AL212]
          Length = 78

 Score = 67.4 bits (163), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 44/63 (69%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVCE+T K  MSG+ VSHANNKT+RRFLPNL       +   +  +LR++  ALR+++
Sbjct: 1  MARVCEVTGKKPMSGHNVSHANNKTKRRFLPNLQHRKFWVESENRWIKLRLTNAALRTID 60

Query: 61 RQG 63
          + G
Sbjct: 61 KNG 63


>gi|91774668|ref|YP_544424.1| 50S ribosomal protein L28P [Methylobacillus flagellatus KT]
 gi|253998048|ref|YP_003050111.1| 50S ribosomal protein L28 [Methylovorus sp. SIP3-4]
 gi|313200113|ref|YP_004038771.1| 50S ribosomal protein L28 [Methylovorus sp. MP688]
 gi|122400322|sp|Q1H4K4|RL28_METFK RecName: Full=50S ribosomal protein L28
 gi|91708655|gb|ABE48583.1| LSU ribosomal protein L28P [Methylobacillus flagellatus KT]
 gi|253984727|gb|ACT49584.1| ribosomal protein L28 [Methylovorus sp. SIP3-4]
 gi|312439429|gb|ADQ83535.1| ribosomal protein L28 [Methylovorus sp. MP688]
          Length = 78

 Score = 67.4 bits (163), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 47/71 (66%), Gaps = 1/71 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVC++T K  M GN VSHANNKT+RRFLPNL       +   +   LRI+  ALR+++
Sbjct: 1  MARVCQVTGKKPMVGNNVSHANNKTKRRFLPNLQNRKFWVESENRWVSLRITNAALRTID 60

Query: 61 RQGGLDRFLSN 71
          +  G+D  L++
Sbjct: 61 KN-GIDAVLAD 70


>gi|53718557|ref|YP_107543.1| 50S ribosomal protein L28 [Burkholderia pseudomallei K96243]
 gi|53726240|ref|YP_103795.1| 50S ribosomal protein L28 [Burkholderia mallei ATCC 23344]
 gi|76810126|ref|YP_332549.1| 50S ribosomal protein L28 [Burkholderia pseudomallei 1710b]
 gi|78067303|ref|YP_370072.1| 50S ribosomal protein L28 [Burkholderia sp. 383]
 gi|83720970|ref|YP_441336.1| 50S ribosomal protein L28 [Burkholderia thailandensis E264]
 gi|107023440|ref|YP_621767.1| 50S ribosomal protein L28 [Burkholderia cenocepacia AU 1054]
 gi|115352600|ref|YP_774439.1| 50S ribosomal protein L28 [Burkholderia ambifaria AMMD]
 gi|116690522|ref|YP_836145.1| 50S ribosomal protein L28 [Burkholderia cenocepacia HI2424]
 gi|124384182|ref|YP_001027008.1| 50S ribosomal protein L28 [Burkholderia mallei NCTC 10229]
 gi|126440334|ref|YP_001058029.1| 50S ribosomal protein L28 [Burkholderia pseudomallei 668]
 gi|126452424|ref|YP_001065264.1| 50S ribosomal protein L28 [Burkholderia pseudomallei 1106a]
 gi|134296675|ref|YP_001120410.1| 50S ribosomal protein L28 [Burkholderia vietnamiensis G4]
 gi|161523973|ref|YP_001578985.1| 50S ribosomal protein L28 [Burkholderia multivorans ATCC 17616]
 gi|167561867|ref|ZP_02354783.1| 50S ribosomal protein L28 [Burkholderia oklahomensis EO147]
 gi|167569089|ref|ZP_02361963.1| 50S ribosomal protein L28 [Burkholderia oklahomensis C6786]
 gi|167580121|ref|ZP_02372995.1| 50S ribosomal protein L28 [Burkholderia thailandensis TXDOH]
 gi|167585718|ref|ZP_02378106.1| 50S ribosomal protein L28 [Burkholderia ubonensis Bu]
 gi|167618185|ref|ZP_02386816.1| 50S ribosomal protein L28 [Burkholderia thailandensis Bt4]
 gi|167718468|ref|ZP_02401704.1| 50S ribosomal protein L28 [Burkholderia pseudomallei DM98]
 gi|167737517|ref|ZP_02410291.1| 50S ribosomal protein L28 [Burkholderia pseudomallei 14]
 gi|167814636|ref|ZP_02446316.1| 50S ribosomal protein L28 [Burkholderia pseudomallei 91]
 gi|167823104|ref|ZP_02454575.1| 50S ribosomal protein L28 [Burkholderia pseudomallei 9]
 gi|167835744|ref|ZP_02462627.1| 50S ribosomal protein L28 [Burkholderia thailandensis MSMB43]
 gi|167844667|ref|ZP_02470175.1| 50S ribosomal protein L28 [Burkholderia pseudomallei B7210]
 gi|167893196|ref|ZP_02480598.1| 50S ribosomal protein L28 [Burkholderia pseudomallei 7894]
 gi|167901649|ref|ZP_02488854.1| 50S ribosomal protein L28 [Burkholderia pseudomallei NCTC 13177]
 gi|167909899|ref|ZP_02496990.1| 50S ribosomal protein L28 [Burkholderia pseudomallei 112]
 gi|167917921|ref|ZP_02505012.1| 50S ribosomal protein L28 [Burkholderia pseudomallei BCC215]
 gi|170697689|ref|ZP_02888777.1| ribosomal protein L28 [Burkholderia ambifaria IOP40-10]
 gi|170733863|ref|YP_001765810.1| 50S ribosomal protein L28 [Burkholderia cenocepacia MC0-3]
 gi|171316764|ref|ZP_02905976.1| ribosomal protein L28 [Burkholderia ambifaria MEX-5]
 gi|172061462|ref|YP_001809114.1| 50S ribosomal protein L28 [Burkholderia ambifaria MC40-6]
 gi|186475351|ref|YP_001856821.1| 50S ribosomal protein L28 [Burkholderia phymatum STM815]
 gi|189351266|ref|YP_001946894.1| 50S ribosomal protein L28 [Burkholderia multivorans ATCC 17616]
 gi|206561052|ref|YP_002231817.1| 50S ribosomal protein L28 [Burkholderia cenocepacia J2315]
 gi|221199268|ref|ZP_03572312.1| 50S ribosomal protein L28 [Burkholderia multivorans CGD2M]
 gi|221205830|ref|ZP_03578845.1| 50S ribosomal protein L28 [Burkholderia multivorans CGD2]
 gi|221211488|ref|ZP_03584467.1| 50S ribosomal protein L28 [Burkholderia multivorans CGD1]
 gi|238028404|ref|YP_002912635.1| 50S ribosomal protein L28 [Burkholderia glumae BGR1]
 gi|254175666|ref|ZP_04882326.1| 50S ribosomal protein L28 [Burkholderia mallei ATCC 10399]
 gi|254181485|ref|ZP_04888082.1| 50S ribosomal protein L28 [Burkholderia pseudomallei 1655]
 gi|254190873|ref|ZP_04897380.1| 50S ribosomal protein L28 [Burkholderia pseudomallei Pasteur
          52237]
 gi|254202497|ref|ZP_04908860.1| 50S ribosomal protein L28 [Burkholderia mallei FMH]
 gi|254207832|ref|ZP_04914182.1| 50S ribosomal protein L28 [Burkholderia mallei JHU]
 gi|254247436|ref|ZP_04940757.1| ribosomal protein L28 [Burkholderia cenocepacia PC184]
 gi|254251633|ref|ZP_04944951.1| RL28_BLOFL 50S ribosomal protein L28 [Burkholderia dolosa AUO158]
 gi|254356273|ref|ZP_04972549.1| 50S ribosomal protein L28 [Burkholderia mallei 2002721280]
 gi|257139990|ref|ZP_05588252.1| ribosomal protein L28 [Burkholderia thailandensis E264]
 gi|330818062|ref|YP_004361767.1| 50S ribosomal protein L28 [Burkholderia gladioli BSR3]
 gi|67461359|sp|Q62HM5|RL28_BURMA RecName: Full=50S ribosomal protein L28
 gi|67461365|sp|Q63WH3|RL28_BURPS RecName: Full=50S ribosomal protein L28
 gi|122322428|sp|Q0BCL8|RL28_BURCM RecName: Full=50S ribosomal protein L28
 gi|123371366|sp|Q1BUB1|RL28_BURCA RecName: Full=50S ribosomal protein L28
 gi|123537847|sp|Q2T0G3|RL28_BURTA RecName: Full=50S ribosomal protein L28
 gi|123567820|sp|Q39DN8|RL28_BURS3 RecName: Full=50S ribosomal protein L28
 gi|123599996|sp|Q3JV54|RL28_BURP1 RecName: Full=50S ribosomal protein L28
 gi|166226550|sp|A0K9S5|RL28_BURCH RecName: Full=50S ribosomal protein L28
 gi|166226551|sp|A2S4Y9|RL28_BURM9 RecName: Full=50S ribosomal protein L28
 gi|166226552|sp|A3NSE3|RL28_BURP0 RecName: Full=50S ribosomal protein L28
 gi|166226553|sp|A3N6Q8|RL28_BURP6 RecName: Full=50S ribosomal protein L28
 gi|166226554|sp|A4JH22|RL28_BURVG RecName: Full=50S ribosomal protein L28
 gi|226738041|sp|B1YV94|RL28_BURA4 RecName: Full=50S ribosomal protein L28
 gi|226738042|sp|B1JXB3|RL28_BURCC RecName: Full=50S ribosomal protein L28
 gi|226738043|sp|B4E8Y7|RL28_BURCJ RecName: Full=50S ribosomal protein L28
 gi|226738044|sp|A9AHD5|RL28_BURM1 RecName: Full=50S ribosomal protein L28
 gi|226738045|sp|B2JDZ9|RL28_BURP8 RecName: Full=50S ribosomal protein L28
 gi|52208971|emb|CAH34910.1| 50S ribosomal protein L28 [Burkholderia pseudomallei K96243]
 gi|52429663|gb|AAU50256.1| ribosomal protein L28 [Burkholderia mallei ATCC 23344]
 gi|76579579|gb|ABA49054.1| RpmB protein [Burkholderia pseudomallei 1710b]
 gi|77968048|gb|ABB09428.1| LSU ribosomal protein L28P [Burkholderia sp. 383]
 gi|83654795|gb|ABC38858.1| ribosomal protein L28, putative [Burkholderia thailandensis E264]
 gi|105893629|gb|ABF76794.1| LSU ribosomal protein L28P [Burkholderia cenocepacia AU 1054]
 gi|115282588|gb|ABI88105.1| LSU ribosomal protein L28P [Burkholderia ambifaria AMMD]
 gi|116648611|gb|ABK09252.1| LSU ribosomal protein L28P [Burkholderia cenocepacia HI2424]
 gi|124292202|gb|ABN01471.1| 50S ribosomal protein L28 [Burkholderia mallei NCTC 10229]
 gi|124872212|gb|EAY63928.1| ribosomal protein L28 [Burkholderia cenocepacia PC184]
 gi|124894242|gb|EAY68122.1| RL28_BLOFL 50S ribosomal protein L28 [Burkholderia dolosa AUO158]
 gi|126219827|gb|ABN83333.1| 50S ribosomal protein L28 [Burkholderia pseudomallei 668]
 gi|126226066|gb|ABN89606.1| 50S ribosomal protein L28 [Burkholderia pseudomallei 1106a]
 gi|134139832|gb|ABO55575.1| LSU ribosomal protein L28P [Burkholderia vietnamiensis G4]
 gi|147746744|gb|EDK53821.1| 50S ribosomal protein L28 [Burkholderia mallei FMH]
 gi|147751726|gb|EDK58793.1| 50S ribosomal protein L28 [Burkholderia mallei JHU]
 gi|148025270|gb|EDK83424.1| 50S ribosomal protein L28 [Burkholderia mallei 2002721280]
 gi|157938548|gb|EDO94218.1| 50S ribosomal protein L28 [Burkholderia pseudomallei Pasteur
          52237]
 gi|160341402|gb|ABX14488.1| ribosomal protein L28 [Burkholderia multivorans ATCC 17616]
 gi|160696710|gb|EDP86680.1| 50S ribosomal protein L28 [Burkholderia mallei ATCC 10399]
 gi|169817105|gb|ACA91688.1| ribosomal protein L28 [Burkholderia cenocepacia MC0-3]
 gi|170137437|gb|EDT05677.1| ribosomal protein L28 [Burkholderia ambifaria IOP40-10]
 gi|171098114|gb|EDT42929.1| ribosomal protein L28 [Burkholderia ambifaria MEX-5]
 gi|171993979|gb|ACB64898.1| ribosomal protein L28 [Burkholderia ambifaria MC40-6]
 gi|184191810|gb|ACC69775.1| ribosomal protein L28 [Burkholderia phymatum STM815]
 gi|184212023|gb|EDU09066.1| 50S ribosomal protein L28 [Burkholderia pseudomallei 1655]
 gi|189335288|dbj|BAG44358.1| large subunit ribosomal protein L28 [Burkholderia multivorans
          ATCC 17616]
 gi|198037094|emb|CAR53015.1| 50S ribosomal protein L28 [Burkholderia cenocepacia J2315]
 gi|221168849|gb|EEE01317.1| 50S ribosomal protein L28 [Burkholderia multivorans CGD1]
 gi|221174668|gb|EEE07100.1| 50S ribosomal protein L28 [Burkholderia multivorans CGD2]
 gi|221180553|gb|EEE12956.1| 50S ribosomal protein L28 [Burkholderia multivorans CGD2M]
 gi|237877598|gb|ACR29931.1| 50S ribosomal protein L28 [Burkholderia glumae BGR1]
 gi|325528991|gb|EGD06010.1| ribosomal protein L28 [Burkholderia sp. TJI49]
 gi|327370455|gb|AEA61811.1| 50S ribosomal protein L28 [Burkholderia gladioli BSR3]
          Length = 77

 Score = 67.4 bits (163), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 47/71 (66%), Gaps = 1/71 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVC++T K  MSGN VSHANNKT+RRFLPNL       +   +  +LR+S   LR ++
Sbjct: 1  MARVCQVTGKAPMSGNNVSHANNKTKRRFLPNLQNRRFWVESENRWVRLRVSNAGLRLID 60

Query: 61 RQGGLDRFLSN 71
          +  G+D  L++
Sbjct: 61 KN-GIDSVLAD 70


>gi|89901949|ref|YP_524420.1| 50S ribosomal protein L28 [Rhodoferax ferrireducens T118]
 gi|122478563|sp|Q21TL4|RL28_RHOFD RecName: Full=50S ribosomal protein L28
 gi|89346686|gb|ABD70889.1| LSU ribosomal protein L28P [Rhodoferax ferrireducens T118]
          Length = 77

 Score = 67.0 bits (162), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 34/71 (47%), Positives = 47/71 (66%), Gaps = 1/71 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVCE+T K  M GNKVSHANN+T+RRFLPNL       +   +  +LRIS   LR ++
Sbjct: 1  MARVCEVTGKGPMVGNKVSHANNRTKRRFLPNLQYRRFWVETENRWIRLRISNAGLRLID 60

Query: 61 RQGGLDRFLSN 71
          +  G+D  L++
Sbjct: 61 KN-GIDVVLAD 70


>gi|237811180|ref|YP_002895631.1| ribosomal protein L28 [Burkholderia pseudomallei MSHR346]
 gi|237503801|gb|ACQ96119.1| ribosomal protein L28 [Burkholderia pseudomallei MSHR346]
          Length = 163

 Score = 67.0 bits (162), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 47/71 (66%), Gaps = 1/71 (1%)

Query: 1   MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
           M+RVC++T K  MSGN VSHANNKT+RRFLPNL       +   +  +LR+S   LR ++
Sbjct: 87  MARVCQVTGKAPMSGNNVSHANNKTKRRFLPNLQNRRFWVESENRWVRLRVSNAGLRLID 146

Query: 61  RQGGLDRFLSN 71
           +  G+D  L++
Sbjct: 147 KN-GIDSVLAD 156


>gi|121599881|ref|YP_993944.1| 50S ribosomal protein L28 [Burkholderia mallei SAVP1]
 gi|217419760|ref|ZP_03451266.1| 50S ribosomal protein L28 [Burkholderia pseudomallei 576]
 gi|238562658|ref|ZP_00440037.2| 50S ribosomal protein L28 [Burkholderia mallei GB8 horse 4]
 gi|242314284|ref|ZP_04813300.1| 50S ribosomal protein L28 [Burkholderia pseudomallei 1106b]
 gi|251766709|ref|ZP_04819772.1| 50S ribosomal protein L28 [Burkholderia mallei PRL-20]
 gi|262193282|ref|YP_001081631.2| 50S ribosomal protein L28 [Burkholderia mallei NCTC 10247]
 gi|121228691|gb|ABM51209.1| 50S ribosomal protein L28 [Burkholderia mallei SAVP1]
 gi|217397064|gb|EEC37080.1| 50S ribosomal protein L28 [Burkholderia pseudomallei 576]
 gi|238522152|gb|EEP85598.1| 50S ribosomal protein L28 [Burkholderia mallei GB8 horse 4]
 gi|242137523|gb|EES23925.1| 50S ribosomal protein L28 [Burkholderia pseudomallei 1106b]
 gi|243064992|gb|EES47178.1| 50S ribosomal protein L28 [Burkholderia mallei PRL-20]
 gi|261835068|gb|ABO05945.2| 50S ribosomal protein L28 [Burkholderia mallei NCTC 10247]
          Length = 163

 Score = 67.0 bits (162), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 47/71 (66%), Gaps = 1/71 (1%)

Query: 1   MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
           M+RVC++T K  MSGN VSHANNKT+RRFLPNL       +   +  +LR+S   LR ++
Sbjct: 87  MARVCQVTGKAPMSGNNVSHANNKTKRRFLPNLQNRRFWVESENRWVRLRVSNAGLRLID 146

Query: 61  RQGGLDRFLSN 71
           +  G+D  L++
Sbjct: 147 KN-GIDSVLAD 156


>gi|254196472|ref|ZP_04902896.1| 50S ribosomal protein L28 [Burkholderia pseudomallei S13]
 gi|169653215|gb|EDS85908.1| 50S ribosomal protein L28 [Burkholderia pseudomallei S13]
          Length = 163

 Score = 67.0 bits (162), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 47/71 (66%), Gaps = 1/71 (1%)

Query: 1   MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
           M+RVC++T K  MSGN VSHANNKT+RRFLPNL       +   +  +LR+S   LR ++
Sbjct: 87  MARVCQVTGKAPMSGNNVSHANNKTKRRFLPNLQNRRFWVESENRWVRLRVSNAGLRLID 146

Query: 61  RQGGLDRFLSN 71
           +  G+D  L++
Sbjct: 147 KN-GIDSVLAD 156


>gi|15676238|ref|NP_273370.1| 50S ribosomal protein L28 [Neisseria meningitidis MC58]
 gi|59802005|ref|YP_208717.1| 50S ribosomal protein L28 [Neisseria gonorrhoeae FA 1090]
 gi|121635542|ref|YP_975787.1| 50S ribosomal protein L28 [Neisseria meningitidis FAM18]
 gi|161870749|ref|YP_001599922.1| 50S ribosomal protein L28 [Neisseria meningitidis 053442]
 gi|218768902|ref|YP_002343414.1| 50S ribosomal protein L28 [Neisseria meningitidis Z2491]
 gi|225076598|ref|ZP_03719797.1| hypothetical protein NEIFLAOT_01646 [Neisseria flavescens
          NRL30031/H210]
 gi|239999768|ref|ZP_04719692.1| 50S ribosomal protein L28 [Neisseria gonorrhoeae 35/02]
 gi|240014925|ref|ZP_04721838.1| 50S ribosomal protein L28 [Neisseria gonorrhoeae DGI18]
 gi|240017373|ref|ZP_04723913.1| 50S ribosomal protein L28 [Neisseria gonorrhoeae FA6140]
 gi|240081516|ref|ZP_04726059.1| 50S ribosomal protein L28 [Neisseria gonorrhoeae FA19]
 gi|240113795|ref|ZP_04728285.1| 50S ribosomal protein L28 [Neisseria gonorrhoeae MS11]
 gi|240116529|ref|ZP_04730591.1| 50S ribosomal protein L28 [Neisseria gonorrhoeae PID18]
 gi|240118753|ref|ZP_04732815.1| 50S ribosomal protein L28 [Neisseria gonorrhoeae PID1]
 gi|240121995|ref|ZP_04734957.1| 50S ribosomal protein L28 [Neisseria gonorrhoeae PID24-1]
 gi|240124292|ref|ZP_04737248.1| 50S ribosomal protein L28 [Neisseria gonorrhoeae PID332]
 gi|240126503|ref|ZP_04739389.1| 50S ribosomal protein L28 [Neisseria gonorrhoeae SK-92-679]
 gi|240128966|ref|ZP_04741627.1| 50S ribosomal protein L28 [Neisseria gonorrhoeae SK-93-1035]
 gi|241759287|ref|ZP_04757393.1| ribosomal protein L28 [Neisseria flavescens SK114]
 gi|254805643|ref|YP_003083864.1| 50S ribosomal protein L28 [Neisseria meningitidis alpha14]
 gi|255067972|ref|ZP_05319827.1| ribosomal protein L28 [Neisseria sicca ATCC 29256]
 gi|260439714|ref|ZP_05793530.1| 50S ribosomal protein L28 [Neisseria gonorrhoeae DGI2]
 gi|261378369|ref|ZP_05982942.1| ribosomal protein L28 [Neisseria cinerea ATCC 14685]
 gi|261379983|ref|ZP_05984556.1| ribosomal protein L28 [Neisseria subflava NJ9703]
 gi|268595580|ref|ZP_06129747.1| 50S ribosomal protein L28 [Neisseria gonorrhoeae 35/02]
 gi|268597615|ref|ZP_06131782.1| 50S ribosomal protein L28 [Neisseria gonorrhoeae FA19]
 gi|268599866|ref|ZP_06134033.1| 50S ribosomal protein L28 [Neisseria gonorrhoeae MS11]
 gi|268602201|ref|ZP_06136368.1| 50S ribosomal protein L28 [Neisseria gonorrhoeae PID18]
 gi|268682920|ref|ZP_06149782.1| 50S ribosomal protein L28 [Neisseria gonorrhoeae PID332]
 gi|268685086|ref|ZP_06151948.1| 50S ribosomal protein L28 [Neisseria gonorrhoeae SK-92-679]
 gi|268687349|ref|ZP_06154211.1| 50S ribosomal protein L28 [Neisseria gonorrhoeae SK-93-1035]
 gi|291042961|ref|ZP_06568699.1| 50S ribosomal protein L28 [Neisseria gonorrhoeae DGI2]
 gi|293398307|ref|ZP_06642498.1| 50S ribosomal protein L28 [Neisseria gonorrhoeae F62]
 gi|319639310|ref|ZP_07994061.1| 50S ribosomal protein L28 [Neisseria mucosa C102]
 gi|54039149|sp|P66151|RL28_NEIMB RecName: Full=50S ribosomal protein L28
 gi|54041850|sp|P66150|RL28_NEIMA RecName: Full=50S ribosomal protein L28
 gi|67461225|sp|Q5F682|RL28_NEIG1 RecName: Full=50S ribosomal protein L28
 gi|166226589|sp|A1KVW2|RL28_NEIMF RecName: Full=50S ribosomal protein L28
 gi|189029447|sp|A9M300|RL28_NEIM0 RecName: Full=50S ribosomal protein L28
 gi|7225542|gb|AAF40766.1| 50S ribosomal protein L28 [Neisseria meningitidis MC58]
 gi|59718900|gb|AAW90305.1| putative 50S ribosomal protein L28 [Neisseria gonorrhoeae FA
          1090]
 gi|120867248|emb|CAM11017.1| 50S ribosomal protein L28 [Neisseria meningitidis FAM18]
 gi|121052910|emb|CAM09262.1| 50S ribosomal protein L28 [Neisseria meningitidis Z2491]
 gi|161596302|gb|ABX73962.1| 50S ribosomal protein L28 [Neisseria meningitidis 053442]
 gi|224952098|gb|EEG33307.1| hypothetical protein NEIFLAOT_01646 [Neisseria flavescens
          NRL30031/H210]
 gi|241320423|gb|EER56720.1| ribosomal protein L28 [Neisseria flavescens SK114]
 gi|254669185|emb|CBA07933.1| 50S ribosomal protein L28 [Neisseria meningitidis alpha14]
 gi|255047749|gb|EET43213.1| ribosomal protein L28 [Neisseria sicca ATCC 29256]
 gi|261391847|emb|CAX49306.1| 50S ribosomal protein L28 [Neisseria meningitidis 8013]
 gi|268548969|gb|EEZ44387.1| 50S ribosomal protein L28 [Neisseria gonorrhoeae 35/02]
 gi|268551403|gb|EEZ46422.1| 50S ribosomal protein L28 [Neisseria gonorrhoeae FA19]
 gi|268583997|gb|EEZ48673.1| 50S ribosomal protein L28 [Neisseria gonorrhoeae MS11]
 gi|268586332|gb|EEZ51008.1| 50S ribosomal protein L28 [Neisseria gonorrhoeae PID18]
 gi|268623204|gb|EEZ55604.1| 50S ribosomal protein L28 [Neisseria gonorrhoeae PID332]
 gi|268625370|gb|EEZ57770.1| 50S ribosomal protein L28 [Neisseria gonorrhoeae SK-92-679]
 gi|268627633|gb|EEZ60033.1| 50S ribosomal protein L28 [Neisseria gonorrhoeae SK-93-1035]
 gi|269145479|gb|EEZ71897.1| ribosomal protein L28 [Neisseria cinerea ATCC 14685]
 gi|284797182|gb|EFC52529.1| ribosomal protein L28 [Neisseria subflava NJ9703]
 gi|291013100|gb|EFE05069.1| 50S ribosomal protein L28 [Neisseria gonorrhoeae DGI2]
 gi|291611231|gb|EFF40315.1| 50S ribosomal protein L28 [Neisseria gonorrhoeae F62]
 gi|308388532|gb|ADO30852.1| 50S ribosomal protein L28 [Neisseria meningitidis alpha710]
 gi|309378671|emb|CBX22742.1| unnamed protein product [Neisseria lactamica Y92-1009]
 gi|317399494|gb|EFV80164.1| 50S ribosomal protein L28 [Neisseria mucosa C102]
 gi|319411203|emb|CBY91608.1| 50S ribosomal protein L28 [Neisseria meningitidis WUE 2594]
 gi|325128907|gb|EGC51761.1| ribosomal protein L28 [Neisseria meningitidis N1568]
 gi|325133013|gb|EGC55688.1| ribosomal protein L28 [Neisseria meningitidis M6190]
 gi|325134999|gb|EGC57629.1| ribosomal protein L28 [Neisseria meningitidis M13399]
 gi|325136897|gb|EGC59494.1| ribosomal protein L28 [Neisseria meningitidis M0579]
 gi|325139002|gb|EGC61550.1| ribosomal protein L28 [Neisseria meningitidis ES14902]
 gi|325141046|gb|EGC63551.1| ribosomal protein L28 [Neisseria meningitidis CU385]
 gi|325145210|gb|EGC67491.1| ribosomal protein L28 [Neisseria meningitidis M01-240013]
 gi|325198988|gb|ADY94444.1| ribosomal protein L28 [Neisseria meningitidis G2136]
 gi|325199515|gb|ADY94970.1| ribosomal protein L28 [Neisseria meningitidis H44/76]
 gi|325202858|gb|ADY98312.1| ribosomal protein L28 [Neisseria meningitidis M01-240149]
 gi|325203435|gb|ADY98888.1| ribosomal protein L28 [Neisseria meningitidis M01-240355]
 gi|325205399|gb|ADZ00852.1| ribosomal protein L28 [Neisseria meningitidis M04-240196]
 gi|325208851|gb|ADZ04303.1| ribosomal protein L28 [Neisseria meningitidis NZ-05/33]
          Length = 77

 Score = 67.0 bits (162), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 34/71 (47%), Positives = 49/71 (69%), Gaps = 1/71 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVC++T K  MSGN VSHANNKT+RRFLPNL       +   +  +LR+S  ALR+++
Sbjct: 1  MARVCKVTGKRPMSGNNVSHANNKTKRRFLPNLQSRRFWVESENRWVRLRVSNAALRTID 60

Query: 61 RQGGLDRFLSN 71
          +  G+D  L++
Sbjct: 61 KV-GIDVVLAD 70


>gi|187925123|ref|YP_001896765.1| 50S ribosomal protein L28 [Burkholderia phytofirmans PsJN]
 gi|226738046|sp|B2T6H7|RL28_BURPP RecName: Full=50S ribosomal protein L28
 gi|187716317|gb|ACD17541.1| ribosomal protein L28 [Burkholderia phytofirmans PsJN]
          Length = 77

 Score = 67.0 bits (162), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 34/71 (47%), Positives = 48/71 (67%), Gaps = 1/71 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVC++T K  MSGN VSHANNKT+RRFLPNL    +  +   +  +LRIS   LR ++
Sbjct: 1  MARVCQVTGKAPMSGNNVSHANNKTKRRFLPNLQSRRIWVESENRFVRLRISNAGLRLID 60

Query: 61 RQGGLDRFLSN 71
          +  G+D  L++
Sbjct: 61 KN-GIDSVLAD 70


>gi|190576385|ref|YP_001974230.1| 50S ribosomal protein L28 [Stenotrophomonas maltophilia K279a]
 gi|194367723|ref|YP_002030333.1| 50S ribosomal protein L28 [Stenotrophomonas maltophilia R551-3]
 gi|226699168|sp|B4SNN0|RL28_STRM5 RecName: Full=50S ribosomal protein L28
 gi|226699169|sp|B2FNE3|RL28_STRMK RecName: Full=50S ribosomal protein L28
 gi|190014307|emb|CAQ47954.1| putative 50S ribosomal protein L28 [Stenotrophomonas maltophilia
          K279a]
 gi|194350527|gb|ACF53650.1| ribosomal protein L28 [Stenotrophomonas maltophilia R551-3]
          Length = 78

 Score = 67.0 bits (162), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 34/70 (48%), Positives = 47/70 (67%), Gaps = 1/70 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC+++ K V +GN VSHANNKTRRRFLPNL           +  +LR+S  ALR+++
Sbjct: 1  MSRVCQVSGKRVQTGNNVSHANNKTRRRFLPNLHERRFWVASENRWVKLRVSAHALRTID 60

Query: 61 RQGGLDRFLS 70
          +  G+D  L+
Sbjct: 61 KN-GIDSVLA 69


>gi|82703258|ref|YP_412824.1| ribosomal protein L28 [Nitrosospira multiformis ATCC 25196]
 gi|123544108|sp|Q2Y739|RL28_NITMU RecName: Full=50S ribosomal protein L28
 gi|82411323|gb|ABB75432.1| LSU ribosomal protein L28P [Nitrosospira multiformis ATCC 25196]
          Length = 78

 Score = 67.0 bits (162), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 34/70 (48%), Positives = 48/70 (68%), Gaps = 1/70 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVCE+T K  M+G+ VSHANNKT+RRFLPNL R     +   +   LR+S  ALR+++
Sbjct: 1  MARVCEVTGKKPMTGHHVSHANNKTKRRFLPNLQRRRFWVESERRWISLRLSNEALRTID 60

Query: 61 RQGGLDRFLS 70
          +  G+D  L+
Sbjct: 61 KN-GIDAVLA 69


>gi|121595684|ref|YP_987580.1| 50S ribosomal protein L28 [Acidovorax sp. JS42]
 gi|221068788|ref|ZP_03544893.1| ribosomal protein L28 [Comamonas testosteroni KF-1]
 gi|222111892|ref|YP_002554156.1| 50S ribosomal protein l28 [Acidovorax ebreus TPSY]
 gi|264677019|ref|YP_003276925.1| ribosomal protein L28 [Comamonas testosteroni CNB-2]
 gi|299532561|ref|ZP_07045951.1| 50S ribosomal protein L28 [Comamonas testosteroni S44]
 gi|319761898|ref|YP_004125835.1| ribosomal protein l28 [Alicycliphilus denitrificans BC]
 gi|330826250|ref|YP_004389553.1| 50S ribosomal protein L28 [Alicycliphilus denitrificans K601]
 gi|166226533|sp|A1WB79|RL28_ACISJ RecName: Full=50S ribosomal protein L28
 gi|254801357|sp|B9MEB7|RL28_DIAST RecName: Full=50S ribosomal protein L28
 gi|120607764|gb|ABM43504.1| LSU ribosomal protein L28P [Acidovorax sp. JS42]
 gi|220713811|gb|EED69179.1| ribosomal protein L28 [Comamonas testosteroni KF-1]
 gi|221731336|gb|ACM34156.1| ribosomal protein L28 [Acidovorax ebreus TPSY]
 gi|262207531|gb|ACY31629.1| ribosomal protein L28 [Comamonas testosteroni CNB-2]
 gi|298719508|gb|EFI60475.1| 50S ribosomal protein L28 [Comamonas testosteroni S44]
 gi|317116459|gb|ADU98947.1| ribosomal protein L28 [Alicycliphilus denitrificans BC]
 gi|329311622|gb|AEB86037.1| 50S ribosomal protein L28 [Alicycliphilus denitrificans K601]
          Length = 77

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 34/71 (47%), Positives = 47/71 (66%), Gaps = 1/71 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVCE+T K  M GN VSHANNKT+RRFLPNL       +   +  +LR+S  ALR ++
Sbjct: 1  MARVCEVTGKKPMVGNNVSHANNKTKRRFLPNLQYRRFWVESENRWVRLRVSSAALRLID 60

Query: 61 RQGGLDRFLSN 71
          +  G+D  L++
Sbjct: 61 KN-GIDSVLAD 70


>gi|160900797|ref|YP_001566379.1| 50S ribosomal protein L28 [Delftia acidovorans SPH-1]
 gi|226738065|sp|A9BNU9|RL28_DELAS RecName: Full=50S ribosomal protein L28
 gi|160366381|gb|ABX37994.1| ribosomal protein L28 [Delftia acidovorans SPH-1]
          Length = 77

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 34/71 (47%), Positives = 47/71 (66%), Gaps = 1/71 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVCE+T K  M GN VSHANNKT+RRFLPNL       +   +  +LR+S  ALR ++
Sbjct: 1  MARVCEVTGKKPMVGNNVSHANNKTKRRFLPNLQYRRFWVESENRWVRLRVSSAALRLID 60

Query: 61 RQGGLDRFLSN 71
          +  G+D  L++
Sbjct: 61 KN-GIDSVLAD 70


>gi|332968532|gb|EGK07593.1| 50S ribosomal protein L28 [Kingella kingae ATCC 23330]
          Length = 78

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 49/71 (69%), Gaps = 1/71 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M++VC++T K  MSGN VSHANNKT+RRFLPNL       +   +  ++R+S  ALR+++
Sbjct: 1  MAKVCKITGKRPMSGNNVSHANNKTKRRFLPNLQSRRFWVESENRWVRIRVSNAALRTID 60

Query: 61 RQGGLDRFLSN 71
          +  G+D  L++
Sbjct: 61 KN-GIDAVLAD 70


>gi|325922641|ref|ZP_08184388.1| LSU ribosomal protein L28P [Xanthomonas gardneri ATCC 19865]
 gi|325923804|ref|ZP_08185419.1| LSU ribosomal protein L28P [Xanthomonas gardneri ATCC 19865]
 gi|325924285|ref|ZP_08185832.1| LSU ribosomal protein L28P [Xanthomonas gardneri ATCC 19865]
 gi|325545234|gb|EGD16541.1| LSU ribosomal protein L28P [Xanthomonas gardneri ATCC 19865]
 gi|325545737|gb|EGD16976.1| LSU ribosomal protein L28P [Xanthomonas gardneri ATCC 19865]
 gi|325546876|gb|EGD17983.1| LSU ribosomal protein L28P [Xanthomonas gardneri ATCC 19865]
          Length = 78

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 44/63 (69%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC+++ K+V +GN VSHANN+TRRRFLPNL           +  +LR+S  ALR+++
Sbjct: 1  MSRVCQVSGKSVQTGNNVSHANNRTRRRFLPNLHERRFWVASENRWVKLRVSAHALRTID 60

Query: 61 RQG 63
          + G
Sbjct: 61 KNG 63


>gi|239814289|ref|YP_002943199.1| 50S ribosomal protein L28 [Variovorax paradoxus S110]
 gi|319792070|ref|YP_004153710.1| ribosomal protein l28 [Variovorax paradoxus EPS]
 gi|259646753|sp|C5CRK1|RL28_VARPS RecName: Full=50S ribosomal protein L28
 gi|239800866|gb|ACS17933.1| ribosomal protein L28 [Variovorax paradoxus S110]
 gi|315594533|gb|ADU35599.1| ribosomal protein L28 [Variovorax paradoxus EPS]
          Length = 77

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 47/71 (66%), Gaps = 1/71 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVC++T K  M GN VSHANNKT+RRFLPNL       +   +  +LR+S  ALR ++
Sbjct: 1  MARVCDVTGKGPMVGNNVSHANNKTKRRFLPNLQYRRFWVETENRWVRLRVSSAALRLID 60

Query: 61 RQGGLDRFLSN 71
          +  G+D  L++
Sbjct: 61 KN-GIDAVLAD 70


>gi|254419542|ref|ZP_05033266.1| hypothetical protein BBAL3_1852 [Brevundimonas sp. BAL3]
 gi|196185719|gb|EDX80695.1| hypothetical protein BBAL3_1852 [Brevundimonas sp. BAL3]
          Length = 82

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 49/71 (69%)

Query: 18 VSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFLSNSKKENL 77
          +SH+N KT+RRFLP+L  + + SD + Q + LRIS  ALR+++ +GGLD F+  ++ E L
Sbjct: 1  MSHSNIKTKRRFLPSLKTVKVTSDSLGQTFSLRISNAALRTLDYKGGLDAFIVKARDEQL 60

Query: 78 SARMRTLRSQI 88
          S   + ++ Q+
Sbjct: 61 SIAAQRIKRQV 71


>gi|294789471|ref|ZP_06754707.1| ribosomal protein L28 [Simonsiella muelleri ATCC 29453]
 gi|294482551|gb|EFG30242.1| ribosomal protein L28 [Simonsiella muelleri ATCC 29453]
          Length = 78

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 49/71 (69%), Gaps = 1/71 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M++VC++T K  MSGN VSHANNKT+RRFLPNL       +   +  +LR+S  ALR+++
Sbjct: 1  MAKVCKVTGKRPMSGNNVSHANNKTKRRFLPNLQSRRFWVESENRWVRLRVSNAALRTID 60

Query: 61 RQGGLDRFLSN 71
          +  G+D  L++
Sbjct: 61 KN-GIDVVLAD 70


>gi|296840760|ref|ZP_06899339.1| 50S ribosomal subunit protein L28 [Neisseria polysaccharea ATCC
          43768]
 gi|296840040|gb|EFH23978.1| 50S ribosomal subunit protein L28 [Neisseria polysaccharea ATCC
          43768]
          Length = 99

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 34/71 (47%), Positives = 49/71 (69%), Gaps = 1/71 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVC++T K  MSGN VSHANNKT+RRFLPNL       +   +  +LR+S  ALR+++
Sbjct: 23 MARVCKVTGKRPMSGNNVSHANNKTKRRFLPNLQSRRFWVESENRWVRLRVSNAALRTID 82

Query: 61 RQGGLDRFLSN 71
          +  G+D  L++
Sbjct: 83 KV-GIDVVLAD 92


>gi|255019877|ref|ZP_05291952.1| LSU ribosomal protein L28p [Acidithiobacillus caldus ATCC 51756]
 gi|254970657|gb|EET28144.1| LSU ribosomal protein L28p [Acidithiobacillus caldus ATCC 51756]
          Length = 78

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 30/63 (47%), Positives = 45/63 (71%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  M+GN VSHANNKTRRRFLPNL       +  ++  ++R+S   +R+++
Sbjct: 1  MSRVCKITGKKPMAGNNVSHANNKTRRRFLPNLQYHRFWVESEQRWVRMRVSTKGMRTID 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|34498911|ref|NP_903126.1| 50S ribosomal protein L28 [Chromobacterium violaceum ATCC 12472]
 gi|67461496|sp|Q7NSH0|RL28_CHRVO RecName: Full=50S ribosomal protein L28
 gi|34104760|gb|AAQ61117.1| 50S ribosomal protein L28 [Chromobacterium violaceum ATCC 12472]
          Length = 77

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 49/71 (69%), Gaps = 1/71 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVC++T K  M+GN VSHANNKT+RRFLPNL       +   +  +LR+S  ALR+++
Sbjct: 1  MARVCKVTGKRPMTGNNVSHANNKTKRRFLPNLQYRKFWVESENRWVRLRVSNAALRTID 60

Query: 61 RQGGLDRFLSN 71
          +  G+D  L++
Sbjct: 61 KV-GIDVVLAD 70


>gi|332530913|ref|ZP_08406837.1| 50S ribosomal protein L28 [Hylemonella gracilis ATCC 19624]
 gi|332039601|gb|EGI76003.1| 50S ribosomal protein L28 [Hylemonella gracilis ATCC 19624]
          Length = 77

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 47/71 (66%), Gaps = 1/71 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVCE+T K  M GN +SHANNKT+RRFLPNL       +   +  +LR+S  ALR ++
Sbjct: 1  MARVCEVTGKKPMVGNNISHANNKTKRRFLPNLQYRRFWVESENRWVRLRVSSAALRLID 60

Query: 61 RQGGLDRFLSN 71
          +  G+D  L++
Sbjct: 61 KN-GIDSVLAD 70


>gi|149928584|ref|ZP_01916804.1| ribosomal protein L28 [Limnobacter sp. MED105]
 gi|149822696|gb|EDM81963.1| ribosomal protein L28 [Limnobacter sp. MED105]
          Length = 77

 Score = 66.2 bits (160), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 49/71 (69%), Gaps = 1/71 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVC++T K  M GNKVSHANNKT+RRFLPNL       +   +  +LR++  ALR+++
Sbjct: 1  MARVCQVTGKRPMVGNKVSHANNKTKRRFLPNLQSRKFWVESENRWVRLRLTNNALRTID 60

Query: 61 RQGGLDRFLSN 71
          +  G+D  L++
Sbjct: 61 KN-GIDAVLAD 70


>gi|254494553|ref|ZP_05107724.1| 50S ribosomal protein L28 [Neisseria gonorrhoeae 1291]
 gi|268604467|ref|ZP_06138634.1| 50S ribosomal protein L28 [Neisseria gonorrhoeae PID1]
 gi|226513593|gb|EEH62938.1| 50S ribosomal protein L28 [Neisseria gonorrhoeae 1291]
 gi|268588598|gb|EEZ53274.1| 50S ribosomal protein L28 [Neisseria gonorrhoeae PID1]
          Length = 117

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 34/71 (47%), Positives = 49/71 (69%), Gaps = 1/71 (1%)

Query: 1   MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
           M+RVC++T K  MSGN VSHANNKT+RRFLPNL       +   +  +LR+S  ALR+++
Sbjct: 41  MARVCKVTGKRPMSGNNVSHANNKTKRRFLPNLQSRRFWVESENRWVRLRVSNAALRTID 100

Query: 61  RQGGLDRFLSN 71
           +  G+D  L++
Sbjct: 101 KV-GIDVVLAD 110


>gi|303257739|ref|ZP_07343751.1| ribosomal protein L28 [Burkholderiales bacterium 1_1_47]
 gi|331000392|ref|ZP_08324070.1| ribosomal protein L28 [Parasutterella excrementihominis YIT
          11859]
 gi|302859709|gb|EFL82788.1| ribosomal protein L28 [Burkholderiales bacterium 1_1_47]
 gi|329571944|gb|EGG53618.1| ribosomal protein L28 [Parasutterella excrementihominis YIT
          11859]
          Length = 77

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 44/63 (69%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVC++T K  M GN+VSHANNKT+RRF+PNL       +   +  +LR++  ALR+++
Sbjct: 1  MARVCQVTGKAPMVGNRVSHANNKTKRRFMPNLQYRRFWVESENRWVRLRVTNAALRTID 60

Query: 61 RQG 63
          + G
Sbjct: 61 KNG 63


>gi|224824522|ref|ZP_03697629.1| ribosomal protein L28 [Lutiella nitroferrum 2002]
 gi|224603015|gb|EEG09191.1| ribosomal protein L28 [Lutiella nitroferrum 2002]
          Length = 77

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 44/63 (69%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVC++T K  M+GN VSHANNKT+RRFLPNL       +   +  +LR+S  ALR+++
Sbjct: 1  MARVCKVTGKRPMTGNNVSHANNKTKRRFLPNLQYRKFWVESENRWVRLRVSNAALRTID 60

Query: 61 RQG 63
          + G
Sbjct: 61 KLG 63


>gi|325267099|ref|ZP_08133768.1| 50S ribosomal protein L28 [Kingella denitrificans ATCC 33394]
 gi|324981452|gb|EGC17095.1| 50S ribosomal protein L28 [Kingella denitrificans ATCC 33394]
          Length = 78

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 49/71 (69%), Gaps = 1/71 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M++VC++T K  +SGN VSHANNKT+RRFLPNL       +   +  +LR+S  ALR+++
Sbjct: 1  MAKVCKITGKRPVSGNNVSHANNKTKRRFLPNLQSRRFWVESENRWVRLRVSNAALRTID 60

Query: 61 RQGGLDRFLSN 71
          +  G+D  L++
Sbjct: 61 KN-GIDAVLAD 70


>gi|260220651|emb|CBA28404.1| 50S ribosomal protein L28 [Curvibacter putative symbiont of Hydra
          magnipapillata]
          Length = 93

 Score = 65.5 bits (158), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 34/71 (47%), Positives = 46/71 (64%), Gaps = 1/71 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVCE+T K  M GN VSHANNKT+RRFLPNL       +   +  +LRIS   LR ++
Sbjct: 17 MARVCEVTGKGPMVGNNVSHANNKTKRRFLPNLQYRRFWVESENRWVRLRISNAGLRLID 76

Query: 61 RQGGLDRFLSN 71
          +  G+D  L++
Sbjct: 77 KN-GIDSVLAD 86


>gi|285016930|ref|YP_003374641.1| 50s ribosomal subunit protein l28 [Xanthomonas albilineans GPE
          PC73]
 gi|283472148|emb|CBA14655.1| probable 50s ribosomal subunit protein l28 [Xanthomonas
          albilineans]
          Length = 78

 Score = 65.5 bits (158), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 47/70 (67%), Gaps = 1/70 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC+++ K V +GN VSHANNKTRRRFLPNL           +  +L++S  ALR+++
Sbjct: 1  MSRVCQVSGKRVQTGNNVSHANNKTRRRFLPNLHERRFWVASENRWVKLKVSAHALRTID 60

Query: 61 RQGGLDRFLS 70
          +  G+D  L+
Sbjct: 61 KN-GIDTVLA 69


>gi|120612081|ref|YP_971759.1| 50S ribosomal protein L28 [Acidovorax citrulli AAC00-1]
 gi|241765340|ref|ZP_04763316.1| ribosomal protein L28 [Acidovorax delafieldii 2AN]
 gi|326318090|ref|YP_004235762.1| 50S ribosomal protein L28 [Acidovorax avenae subsp. avenae ATCC
          19860]
 gi|166226528|sp|A1TSP7|RL28_ACIAC RecName: Full=50S ribosomal protein L28
 gi|120590545|gb|ABM33985.1| LSU ribosomal protein L28P [Acidovorax citrulli AAC00-1]
 gi|241364939|gb|EER59877.1| ribosomal protein L28 [Acidovorax delafieldii 2AN]
 gi|323374926|gb|ADX47195.1| 50S ribosomal protein L28 [Acidovorax avenae subsp. avenae ATCC
          19860]
          Length = 77

 Score = 65.5 bits (158), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 47/71 (66%), Gaps = 1/71 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVC++T K  M GN VSHANNKT+RRFLPNL       +   +  +LR+S  ALR ++
Sbjct: 1  MARVCDVTGKKPMVGNNVSHANNKTKRRFLPNLQYRRFWVESENRWVRLRVSSAALRLID 60

Query: 61 RQGGLDRFLSN 71
          +  G+D  L++
Sbjct: 61 KN-GIDSVLAD 70


>gi|21233456|ref|NP_639373.1| 50S ribosomal protein L28 [Xanthomonas campestris pv. campestris
          str. ATCC 33913]
 gi|21244876|ref|NP_644458.1| 50S ribosomal protein L28 [Xanthomonas axonopodis pv. citri str.
          306]
 gi|66770420|ref|YP_245182.1| 50S ribosomal protein L28 [Xanthomonas campestris pv. campestris
          str. 8004]
 gi|78049813|ref|YP_365988.1| 50S ribosomal protein L28 [Xanthomonas campestris pv. vesicatoria
          str. 85-10]
 gi|84625952|ref|YP_453324.1| 50S ribosomal protein L28 [Xanthomonas oryzae pv. oryzae MAFF
          311018]
 gi|166710250|ref|ZP_02241457.1| 50S ribosomal protein L28 [Xanthomonas oryzae pv. oryzicola
          BLS256]
 gi|188993625|ref|YP_001905635.1| 50S ribosomal protein L28 [Xanthomonas campestris pv. campestris
          str. B100]
 gi|289666100|ref|ZP_06487681.1| 50S ribosomal protein L28 [Xanthomonas campestris pv. vasculorum
          NCPPB702]
 gi|289670773|ref|ZP_06491848.1| 50S ribosomal protein L28 [Xanthomonas campestris pv. musacearum
          NCPPB4381]
 gi|325916749|ref|ZP_08179003.1| LSU ribosomal protein L28P [Xanthomonas vesicatoria ATCC 35937]
 gi|325925992|ref|ZP_08187358.1| 50S ribosomal protein L28 [Xanthomonas perforans 91-118]
 gi|54039155|sp|P66161|RL28_XANCP RecName: Full=50S ribosomal protein L28
 gi|54041854|sp|P66160|RL28_XANAC RecName: Full=50S ribosomal protein L28
 gi|81303633|sp|Q4UP61|RL28_XANC8 RecName: Full=50S ribosomal protein L28
 gi|123520476|sp|Q2NXC7|RL28_XANOM RecName: Full=50S ribosomal protein L28
 gi|123583817|sp|Q3BMM5|RL28_XANC5 RecName: Full=50S ribosomal protein L28
 gi|226699184|sp|B0RYR3|RL28_XANCB RecName: Full=50S ribosomal protein L28
 gi|21110585|gb|AAM38994.1| 50S ribosomal protein L28 [Xanthomonas axonopodis pv. citri str.
          306]
 gi|21115302|gb|AAM43255.1| 50S ribosomal protein L28 [Xanthomonas campestris pv. campestris
          str. ATCC 33913]
 gi|66575752|gb|AAY51162.1| 50S ribosomal protein L28 [Xanthomonas campestris pv. campestris
          str. 8004]
 gi|78038243|emb|CAJ25988.1| 50S ribosomal protein L28 [Xanthomonas campestris pv. vesicatoria
          str. 85-10]
 gi|84369892|dbj|BAE71050.1| 50S ribosomal protein L28 [Xanthomonas oryzae pv. oryzae MAFF
          311018]
 gi|167735385|emb|CAP53599.1| 50S ribosomal protein L28 [Xanthomonas campestris pv. campestris]
 gi|325537003|gb|EGD08745.1| LSU ribosomal protein L28P [Xanthomonas vesicatoria ATCC 35937]
 gi|325543588|gb|EGD15005.1| 50S ribosomal protein L28 [Xanthomonas perforans 91-118]
          Length = 78

 Score = 65.5 bits (158), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 43/63 (68%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC+++ K V +GN VSHANN+TRRRFLPNL           +  +LR+S  ALR+++
Sbjct: 1  MSRVCQVSGKRVQTGNNVSHANNRTRRRFLPNLHERRFWVASENRWVKLRVSAHALRTID 60

Query: 61 RQG 63
          + G
Sbjct: 61 KNG 63


>gi|17547164|ref|NP_520566.1| 50S ribosomal protein L28 [Ralstonia solanacearum GMI1000]
 gi|83746660|ref|ZP_00943709.1| LSU ribosomal protein L28P [Ralstonia solanacearum UW551]
 gi|300690690|ref|YP_003751685.1| 50S ribosomal subunit protein L28 [Ralstonia solanacearum PSI07]
 gi|300703308|ref|YP_003744910.1| 50S ribosomal protein L28 [Ralstonia solanacearum CFBP2957]
 gi|20139460|sp|Q8XWM9|RL28_RALSO RecName: Full=50S ribosomal protein L28
 gi|17429466|emb|CAD16152.1| probable 50s ribosomal protein l28 [Ralstonia solanacearum
          GMI1000]
 gi|83726613|gb|EAP73742.1| LSU ribosomal protein L28P [Ralstonia solanacearum UW551]
 gi|299065958|emb|CBJ37139.1| 50S ribosomal subunit protein L28 [Ralstonia solanacearum CMR15]
 gi|299070971|emb|CBJ42280.1| 50S ribosomal subunit protein L28 [Ralstonia solanacearum
          CFBP2957]
 gi|299077750|emb|CBJ50388.1| 50S ribosomal subunit protein L28 [Ralstonia solanacearum PSI07]
          Length = 77

 Score = 65.5 bits (158), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 46/71 (64%), Gaps = 1/71 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVC++T K  M GN VSHANNKT+RRFLPNL       +   +   LR+S   LR ++
Sbjct: 1  MARVCQVTGKAPMVGNNVSHANNKTKRRFLPNLQNRRFWVESENRWVSLRVSNAGLRLID 60

Query: 61 RQGGLDRFLSN 71
          ++ G+D  L++
Sbjct: 61 KK-GIDEVLAD 70


>gi|94311802|ref|YP_585012.1| 50S ribosomal protein L28 [Cupriavidus metallidurans CH34]
 gi|166226608|sp|Q1LJD3|RL28_RALME RecName: Full=50S ribosomal protein L28
 gi|93355654|gb|ABF09743.1| 50S ribosomal subunit protein L28 [Cupriavidus metallidurans
          CH34]
          Length = 77

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 46/71 (64%), Gaps = 1/71 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVC++T K  M GN VSHANNKT+RRFLPNL       +   +   LR+S   LR ++
Sbjct: 1  MARVCQVTGKAPMVGNNVSHANNKTKRRFLPNLQNRRFFVESENRWVSLRVSNAGLRLID 60

Query: 61 RQGGLDRFLSN 71
          ++ G+D  L++
Sbjct: 61 KK-GIDAVLAD 70


>gi|118595305|ref|ZP_01552652.1| 50S ribosomal protein L28 [Methylophilales bacterium HTCC2181]
 gi|118441083|gb|EAV47710.1| 50S ribosomal protein L28 [Methylophilales bacterium HTCC2181]
          Length = 78

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 43/63 (68%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+R CE+T K  +SGN VSHANN+TRRRFLPNL    +  +   +   +RIS  ALR+++
Sbjct: 1  MTRECEVTGKRPVSGNNVSHANNRTRRRFLPNLHNRRIWVETENRWVSMRISSAALRTID 60

Query: 61 RQG 63
          + G
Sbjct: 61 KLG 63


>gi|257094340|ref|YP_003167981.1| 50S ribosomal protein L28 [Candidatus Accumulibacter phosphatis
          clade IIA str. UW-1]
 gi|257046864|gb|ACV36052.1| ribosomal protein L28 [Candidatus Accumulibacter phosphatis clade
          IIA str. UW-1]
          Length = 77

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 31/71 (43%), Positives = 48/71 (67%), Gaps = 1/71 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVC++T K  M+GN VSHANN+T+RRFLPNL       +   +  +LR+S   LR+++
Sbjct: 1  MARVCQVTGKGPMAGNNVSHANNRTKRRFLPNLQYRRFWIEGENRWVRLRVSNAGLRTID 60

Query: 61 RQGGLDRFLSN 71
          +  G+D  L++
Sbjct: 61 KN-GIDVVLAD 70


>gi|171057442|ref|YP_001789791.1| 50S ribosomal protein L28 [Leptothrix cholodnii SP-6]
 gi|226732833|sp|B1Y149|RL28_LEPCP RecName: Full=50S ribosomal protein L28
 gi|170774887|gb|ACB33026.1| ribosomal protein L28 [Leptothrix cholodnii SP-6]
          Length = 77

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 32/63 (50%), Positives = 42/63 (66%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVC++T K  M GN VSHANNKT+RRFLPNL       +   +  +LRIS  ALR ++
Sbjct: 1  MARVCQVTGKGPMVGNNVSHANNKTKRRFLPNLHYRRFWLETENRWVRLRISNAALRLID 60

Query: 61 RQG 63
          + G
Sbjct: 61 KVG 63


>gi|73542418|ref|YP_296938.1| 50S ribosomal protein L28 [Ralstonia eutropha JMP134]
 gi|113868988|ref|YP_727477.1| 50S ribosomal protein L28 [Ralstonia eutropha H16]
 gi|194290594|ref|YP_002006501.1| 50S ribosomal protein l28 [Cupriavidus taiwanensis LMG 19424]
 gi|122946632|sp|Q0K7B2|RL28_RALEH RecName: Full=50S ribosomal protein L28
 gi|123624202|sp|Q46XN9|RL28_RALEJ RecName: Full=50S ribosomal protein L28
 gi|226738062|sp|B3R6F8|RL28_CUPTR RecName: Full=50S ribosomal protein L28
 gi|72119831|gb|AAZ62094.1| LSU ribosomal protein L28P [Ralstonia eutropha JMP134]
 gi|113527764|emb|CAJ94109.1| LSU ribosomal protein L28 [Ralstonia eutropha H16]
 gi|193224429|emb|CAQ70440.1| 50S ribosomal subunit protein L28 [Cupriavidus taiwanensis LMG
          19424]
          Length = 77

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 46/71 (64%), Gaps = 1/71 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVC++T K  M GN VSHANNKT+RRFLPNL       +   +   LR+S   LR ++
Sbjct: 1  MARVCQVTGKAPMVGNNVSHANNKTKRRFLPNLQNRRFFVESENRWVSLRVSNAGLRLID 60

Query: 61 RQGGLDRFLSN 71
          ++ G+D  L++
Sbjct: 61 KK-GIDSVLAD 70


>gi|30249436|ref|NP_841506.1| 50S ribosomal protein L28 [Nitrosomonas europaea ATCC 19718]
 gi|67461512|sp|Q82UL8|RL28_NITEU RecName: Full=50S ribosomal protein L28
 gi|30138799|emb|CAD85376.1| Ribosomal protein L28 [Nitrosomonas europaea ATCC 19718]
          Length = 78

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 44/63 (69%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVC++T K  MSG+ VSHANNKT+RRFLPNL       +   +  +LR++  ALR+V+
Sbjct: 1  MARVCQVTGKRPMSGHNVSHANNKTKRRFLPNLQSRRFWLESENRWIRLRLTNAALRTVD 60

Query: 61 RQG 63
          + G
Sbjct: 61 KNG 63


>gi|311107980|ref|YP_003980833.1| 50S ribosomal protein L28 [Achromobacter xylosoxidans A8]
 gi|310762669|gb|ADP18118.1| ribosomal protein L28 [Achromobacter xylosoxidans A8]
          Length = 78

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 32/70 (45%), Positives = 47/70 (67%), Gaps = 1/70 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVC++T K  M GN VSHANNKT+RRFLPNL       +   +  +LR+S  A+R+++
Sbjct: 1  MARVCQVTGKGPMVGNNVSHANNKTKRRFLPNLQSRRFWVESENRWVRLRVSAKAIRTID 60

Query: 61 RQGGLDRFLS 70
          +  G+D  L+
Sbjct: 61 KN-GIDAVLA 69


>gi|117924123|ref|YP_864740.1| 50S ribosomal protein L28P [Magnetococcus sp. MC-1]
 gi|166226586|sp|A0L5U1|RL28_MAGSM RecName: Full=50S ribosomal protein L28
 gi|117607879|gb|ABK43334.1| LSU ribosomal protein L28P [Magnetococcus sp. MC-1]
          Length = 95

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 36/88 (40%), Positives = 50/88 (56%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+R   L  K   +GNKVSH+  KTRR+++PN+    L S  + Q  ++ IS  ALRSV+
Sbjct: 1  MARKRTLGGKAPQAGNKVSHSQRKTRRQWMPNIQTKALWSITLGQSVKVTISTSALRSVD 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQI 88
            GGLD +L       L+  MR +  QI
Sbjct: 61 NAGGLDNYLLKILPSELTPSMRRVARQI 88


>gi|163857625|ref|YP_001631923.1| 50S ribosomal protein L28 [Bordetella petrii DSM 12804]
 gi|226738038|sp|A9HWU4|RL28_BORPD RecName: Full=50S ribosomal protein L28
 gi|163261353|emb|CAP43655.1| 50S ribosomal protein L28 [Bordetella petrii]
          Length = 78

 Score = 64.7 bits (156), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 48/71 (67%), Gaps = 1/71 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVC++T K  M+GN VSHANNKT+RRFLPNL       +   +  +LR+S  A+R ++
Sbjct: 1  MARVCQVTGKGPMTGNNVSHANNKTKRRFLPNLQSRRFWVESENRWVRLRVSAKAIRIID 60

Query: 61 RQGGLDRFLSN 71
          +  G+D  L++
Sbjct: 61 KN-GIDAVLAD 70


>gi|317405790|gb|EFV86080.1| 50S ribosomal protein L28 [Achromobacter xylosoxidans C54]
          Length = 78

 Score = 64.7 bits (156), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 32/70 (45%), Positives = 47/70 (67%), Gaps = 1/70 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVC++T K  M GN VSHANNKT+RRFLPNL       +   +  +LR+S  A+R+++
Sbjct: 1  MARVCQVTGKGPMVGNNVSHANNKTKRRFLPNLQSRRFWVESENRWVRLRVSAKAIRTID 60

Query: 61 RQGGLDRFLS 70
          +  G+D  L+
Sbjct: 61 KN-GIDAVLA 69


>gi|114321788|ref|YP_743471.1| 50S ribosomal protein L28P [Alkalilimnicola ehrlichii MLHE-1]
 gi|122310770|sp|Q0A5A6|RL28_ALHEH RecName: Full=50S ribosomal protein L28
 gi|114228182|gb|ABI57981.1| LSU ribosomal protein L28P [Alkalilimnicola ehrlichii MLHE-1]
          Length = 78

 Score = 64.7 bits (156), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 49/71 (69%), Gaps = 1/71 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS+VC++T K   +GN VSHANNKT+RRFLPNL       +  ++  +LR+S   +R ++
Sbjct: 1  MSKVCQVTGKRPTTGNNVSHANNKTKRRFLPNLHHHRFWVESEQRFVRLRVSSKGMRIID 60

Query: 61 RQGGLDRFLSN 71
          R+ G+D+ LS+
Sbjct: 61 RK-GIDQVLSD 70


>gi|226939473|ref|YP_002794546.1| 50S ribosomal protein L28 [Laribacter hongkongensis HLHK9]
 gi|254801365|sp|C1DCC0|RL28_LARHH RecName: Full=50S ribosomal protein L28
 gi|226714399|gb|ACO73537.1| RpmB [Laribacter hongkongensis HLHK9]
          Length = 77

 Score = 64.3 bits (155), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 48/71 (67%), Gaps = 1/71 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVC++T K  M GN VSHANNKT+RRFLPNL       +   +  ++R+S  ALR+++
Sbjct: 1  MARVCKVTGKRPMVGNNVSHANNKTKRRFLPNLQYRRFWVESENRWVRMRVSNAALRTID 60

Query: 61 RQGGLDRFLSN 71
          +  G+D  L++
Sbjct: 61 KV-GIDAVLAD 70


>gi|71908756|ref|YP_286343.1| 50S ribosomal protein L28 [Dechloromonas aromatica RCB]
 gi|123626758|sp|Q47BA8|RL28_DECAR RecName: Full=50S ribosomal protein L28
 gi|71848377|gb|AAZ47873.1| LSU ribosomal protein L28P [Dechloromonas aromatica RCB]
          Length = 77

 Score = 64.3 bits (155), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 47/71 (66%), Gaps = 1/71 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVC++T K  M GNKVSHANN+T+RRFLPNL       +   +  +LR+S   LR ++
Sbjct: 1  MARVCQVTGKAPMVGNKVSHANNRTKRRFLPNLQYRRFWVESENRFLRLRVSNAGLRLID 60

Query: 61 RQGGLDRFLSN 71
          +  G+D  L++
Sbjct: 61 KN-GIDAVLAD 70


>gi|83643894|ref|YP_432329.1| ribosomal protein L28 [Hahella chejuensis KCTC 2396]
 gi|123534643|sp|Q2SN70|RL28_HAHCH RecName: Full=50S ribosomal protein L28
 gi|83631937|gb|ABC27904.1| ribosomal protein L28 [Hahella chejuensis KCTC 2396]
          Length = 78

 Score = 64.3 bits (155), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 50/71 (70%), Gaps = 1/71 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K+ ++GN VSHANNKT+RRFLPNL       +  ++  +LR+S   +R ++
Sbjct: 1  MSRVCQVTGKSPITGNNVSHANNKTKRRFLPNLQTHRFWVENEKRFVKLRVSTKGMRIID 60

Query: 61 RQGGLDRFLSN 71
          +  G+D+ LS+
Sbjct: 61 KV-GIDKVLSD 70


>gi|187929783|ref|YP_001900270.1| 50S ribosomal protein L28 [Ralstonia pickettii 12J]
 gi|241663909|ref|YP_002982269.1| 50S ribosomal protein L28 [Ralstonia pickettii 12D]
 gi|309781501|ref|ZP_07676237.1| ribosomal protein L28 [Ralstonia sp. 5_7_47FAA]
 gi|226699151|sp|B2UAP1|RL28_RALPJ RecName: Full=50S ribosomal protein L28
 gi|187726673|gb|ACD27838.1| ribosomal protein L28 [Ralstonia pickettii 12J]
 gi|240865936|gb|ACS63597.1| ribosomal protein L28 [Ralstonia pickettii 12D]
 gi|308919914|gb|EFP65575.1| ribosomal protein L28 [Ralstonia sp. 5_7_47FAA]
          Length = 77

 Score = 64.3 bits (155), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 44/69 (63%), Gaps = 1/69 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVC++T K  M GN VSHANNKT+RRFLPNL       +   +   LR+S   LR ++
Sbjct: 1  MARVCQVTGKAPMVGNNVSHANNKTKRRFLPNLQNRRFWVESENRWVSLRVSNAGLRLID 60

Query: 61 RQGGLDRFL 69
          ++ G+D  L
Sbjct: 61 KK-GIDEVL 68


>gi|74318607|ref|YP_316347.1| 50S ribosomal protein L28 [Thiobacillus denitrificans ATCC 25259]
 gi|123611211|sp|Q3SFR4|RL28_THIDA RecName: Full=50S ribosomal protein L28
 gi|74058102|gb|AAZ98542.1| ribosomal protein L28 [Thiobacillus denitrificans ATCC 25259]
          Length = 78

 Score = 63.9 bits (154), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 42/63 (66%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVC +T K  M GN VSHANNKT+RRFLPNL       +   +  +LR+S  ALR+++
Sbjct: 1  MARVCVVTGKKPMVGNNVSHANNKTKRRFLPNLQYRRFWVESENRWVRLRLSNAALRTID 60

Query: 61 RQG 63
          + G
Sbjct: 61 KNG 63


>gi|33593074|ref|NP_880718.1| 50S ribosomal protein L28 [Bordetella pertussis Tohama I]
 gi|33596368|ref|NP_884011.1| 50S ribosomal protein L28 [Bordetella parapertussis 12822]
 gi|33602345|ref|NP_889905.1| 50S ribosomal protein L28 [Bordetella bronchiseptica RB50]
 gi|187478973|ref|YP_786997.1| 50S ribosomal protein L28 [Bordetella avium 197N]
 gi|67461507|sp|Q7VWY1|RL28_BORPE RecName: Full=50S ribosomal protein L28
 gi|67461508|sp|Q7W9L9|RL28_BORPA RecName: Full=50S ribosomal protein L28
 gi|67461509|sp|Q7WH39|RL28_BORBR RecName: Full=50S ribosomal protein L28
 gi|123514301|sp|Q2KXH8|RL28_BORA1 RecName: Full=50S ribosomal protein L28
 gi|33563449|emb|CAE42330.1| 50S ribosomal protein L28 [Bordetella pertussis Tohama I]
 gi|33566137|emb|CAE37038.1| 50S ribosomal protein L28 [Bordetella parapertussis]
 gi|33576784|emb|CAE33863.1| 50S ribosomal protein L28 [Bordetella bronchiseptica RB50]
 gi|115423559|emb|CAJ50095.1| 50S ribosomal protein L28 [Bordetella avium 197N]
 gi|332382486|gb|AEE67333.1| 50S ribosomal protein L28 [Bordetella pertussis CS]
          Length = 78

 Score = 63.9 bits (154), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 31/71 (43%), Positives = 48/71 (67%), Gaps = 1/71 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVC++T K  M GN VSHANNKT+RRFLPNL       +   +  +LR++  A+R+++
Sbjct: 1  MARVCQVTGKGPMVGNNVSHANNKTKRRFLPNLQSRRFWVESENRWVRLRVTAKAIRTID 60

Query: 61 RQGGLDRFLSN 71
          +  G+D  L++
Sbjct: 61 KN-GIDAVLAD 70


>gi|319943235|ref|ZP_08017518.1| 50S ribosomal protein L28 [Lautropia mirabilis ATCC 51599]
 gi|319743777|gb|EFV96181.1| 50S ribosomal protein L28 [Lautropia mirabilis ATCC 51599]
          Length = 76

 Score = 63.9 bits (154), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 46/64 (71%), Gaps = 2/64 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKY-QLRISKCALRSV 59
          M++VC++T K  M GN VSHANNKT+RRFLPNL +  L  +  EQ+Y +LR++   LR +
Sbjct: 1  MAKVCQVTGKGPMVGNNVSHANNKTKRRFLPNLQQRRLWVE-SEQRYVRLRVTAAGLRKI 59

Query: 60 ERQG 63
          ++ G
Sbjct: 60 DKLG 63


>gi|253995750|ref|YP_003047814.1| 50S ribosomal protein L28 [Methylotenera mobilis JLW8]
 gi|253982429|gb|ACT47287.1| ribosomal protein L28 [Methylotenera mobilis JLW8]
          Length = 78

 Score = 63.9 bits (154), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 31/71 (43%), Positives = 46/71 (64%), Gaps = 1/71 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVC++T K  M GN VSHA NKT+RRFLPNL       +   +   +RI+  ALR+++
Sbjct: 1  MARVCQVTGKKPMVGNNVSHAQNKTKRRFLPNLQNRKFWVESENRWVSMRITNAALRTID 60

Query: 61 RQGGLDRFLSN 71
          +  G+D  L++
Sbjct: 61 KN-GIDAVLAD 70


>gi|300310516|ref|YP_003774608.1| 50S ribosomal protein L28 [Herbaspirillum seropedicae SmR1]
 gi|300073301|gb|ADJ62700.1| 50S ribosomal subunit L28 protein [Herbaspirillum seropedicae
          SmR1]
          Length = 78

 Score = 63.9 bits (154), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 46/71 (64%), Gaps = 1/71 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVC++T K  M GN VSHANNKT+RRFLPNL    +  +   +   LR+S   LR ++
Sbjct: 1  MARVCQVTGKGPMVGNNVSHANNKTKRRFLPNLQNRRIFVESENRWVSLRLSNAGLRVID 60

Query: 61 RQGGLDRFLSN 71
          +  G+D  L++
Sbjct: 61 KI-GIDAVLAD 70


>gi|288939948|ref|YP_003442188.1| 50S ribosomal protein L28 [Allochromatium vinosum DSM 180]
 gi|288895320|gb|ADC61156.1| ribosomal protein L28 [Allochromatium vinosum DSM 180]
          Length = 78

 Score = 63.9 bits (154), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 46/63 (73%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS+VC++T K  ++GN VSHANNKT+RRFLPNL       +  ++  +LR++  A+R+++
Sbjct: 1  MSKVCQVTGKRPLTGNNVSHANNKTKRRFLPNLHEKRFWVEAEKRWVKLRLTTKAMRTID 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|114330794|ref|YP_747016.1| 50S ribosomal protein L28 [Nitrosomonas eutropha C91]
 gi|122314268|sp|Q0AHY1|RL28_NITEC RecName: Full=50S ribosomal protein L28
 gi|114307808|gb|ABI59051.1| LSU ribosomal protein L28P [Nitrosomonas eutropha C91]
          Length = 78

 Score = 63.9 bits (154), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 30/63 (47%), Positives = 44/63 (69%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVC++T K  MSG+ VSHANNKT+RRFLPNL       +   +  +LR++  ALR+++
Sbjct: 1  MARVCQVTGKRPMSGHHVSHANNKTKRRFLPNLQSRRFWLESENRWIRLRLTNAALRTID 60

Query: 61 RQG 63
          + G
Sbjct: 61 KNG 63


>gi|198284382|ref|YP_002220703.1| 50S ribosomal protein L28 [Acidithiobacillus ferrooxidans ATCC
          53993]
 gi|218667456|ref|YP_002427047.1| ribosomal protein L28 [Acidithiobacillus ferrooxidans ATCC 23270]
 gi|226738018|sp|B7J7Y4|RL28_ACIF2 RecName: Full=50S ribosomal protein L28
 gi|226738019|sp|B5ENA7|RL28_ACIF5 RecName: Full=50S ribosomal protein L28
 gi|198248903|gb|ACH84496.1| ribosomal protein L28 [Acidithiobacillus ferrooxidans ATCC 53993]
 gi|218519669|gb|ACK80255.1| ribosomal protein L28 [Acidithiobacillus ferrooxidans ATCC 23270]
          Length = 78

 Score = 63.5 bits (153), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 31/71 (43%), Positives = 49/71 (69%), Gaps = 1/71 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  M+GN VSHA+NKTRRRFLPNL       +   +  ++R+S   +R+++
Sbjct: 1  MSRVCKVTGKKPMAGNNVSHAHNKTRRRFLPNLQYHRFWVESENRWVRMRVSTKGIRTID 60

Query: 61 RQGGLDRFLSN 71
          ++ G+D  L++
Sbjct: 61 KK-GIDVVLAD 70


>gi|26991958|ref|NP_747383.1| 50S ribosomal protein L28 [Pseudomonas putida KT2440]
 gi|148550392|ref|YP_001270494.1| 50S ribosomal protein L28 [Pseudomonas putida F1]
 gi|167036319|ref|YP_001671550.1| 50S ribosomal protein L28 [Pseudomonas putida GB-1]
 gi|325273179|ref|ZP_08139469.1| 50S ribosomal protein L28 [Pseudomonas sp. TJI-51]
 gi|38258487|sp|Q88C99|RL28_PSEPK RecName: Full=50S ribosomal protein L28
 gi|166226605|sp|A5WB00|RL28_PSEP1 RecName: Full=50S ribosomal protein L28
 gi|189029451|sp|B0KQ85|RL28_PSEPG RecName: Full=50S ribosomal protein L28
 gi|24987087|gb|AAN70847.1|AE016729_5 ribosomal protein L28 [Pseudomonas putida KT2440]
 gi|148514450|gb|ABQ81310.1| LSU ribosomal protein L28P [Pseudomonas putida F1]
 gi|166862807|gb|ABZ01215.1| ribosomal protein L28 [Pseudomonas putida GB-1]
 gi|313501257|gb|ADR62623.1| RpmB [Pseudomonas putida BIRD-1]
 gi|324101686|gb|EGB99242.1| 50S ribosomal protein L28 [Pseudomonas sp. TJI-51]
          Length = 78

 Score = 63.5 bits (153), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 50/74 (67%), Gaps = 1/74 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  ++GN +SHANNKTRRRFLPNL       +  ++  +LR+S   +R ++
Sbjct: 1  MSRVCQVTGKGPVTGNNISHANNKTRRRFLPNLQHHRFWVESEKRFVRLRVSAKGMRIID 60

Query: 61 RQGGLDRFLSNSKK 74
          ++ G+D  L + +K
Sbjct: 61 KR-GIDAVLVDIRK 73


>gi|152983116|ref|YP_001354242.1| 50S ribosomal protein L28 [Janthinobacterium sp. Marseille]
 gi|151283193|gb|ABR91603.1| 50S ribosomal protein L28 [Janthinobacterium sp. Marseille]
          Length = 112

 Score = 63.5 bits (153), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 46/71 (64%), Gaps = 1/71 (1%)

Query: 1   MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
           M+RVC++T K  M GN VSHANNKT+RRFLPNL    +  +   +   LR+S   LR ++
Sbjct: 35  MARVCQVTGKGPMVGNNVSHANNKTKRRFLPNLQNRRIFVESENRWVSLRLSNAGLRVID 94

Query: 61  RQGGLDRFLSN 71
           +  G+D  L++
Sbjct: 95  KI-GIDAVLAD 104


>gi|70734366|ref|YP_263107.1| 50S ribosomal protein L28 [Pseudomonas fluorescens Pf-5]
 gi|123652040|sp|Q4K3S6|RL28_PSEF5 RecName: Full=50S ribosomal protein L28
 gi|68348665|gb|AAY96271.1| ribosomal protein L28 [Pseudomonas fluorescens Pf-5]
          Length = 78

 Score = 63.5 bits (153), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 31/76 (40%), Positives = 51/76 (67%), Gaps = 1/76 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  ++GN +SHANNKTRRRFLPNL       +  ++  +LR+S   +R ++
Sbjct: 1  MSRVCQVTGKGPVTGNNISHANNKTRRRFLPNLQHHRFWVESEKRFVRLRVSAKGMRIID 60

Query: 61 RQGGLDRFLSNSKKEN 76
          ++ G+D  L+  +++ 
Sbjct: 61 KR-GIDVVLAEIRRDG 75


>gi|124266309|ref|YP_001020313.1| 50S ribosomal protein L28 [Methylibium petroleiphilum PM1]
 gi|166226588|sp|A2SET9|RL28_METPP RecName: Full=50S ribosomal protein L28
 gi|124259084|gb|ABM94078.1| LSU ribosomal protein L28P [Methylibium petroleiphilum PM1]
          Length = 77

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 30/63 (47%), Positives = 42/63 (66%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVC++T K  M GN VSHANNKT+RRFLPNL       +   +  +LR++  ALR ++
Sbjct: 1  MARVCQVTGKGPMVGNNVSHANNKTKRRFLPNLQYRRFWLETENRWVRLRVTNAALRLID 60

Query: 61 RQG 63
          + G
Sbjct: 61 KVG 63


>gi|332526019|ref|ZP_08402157.1| 50S ribosomal protein L28 [Rubrivivax benzoatilyticus JA2]
 gi|332109862|gb|EGJ10490.1| 50S ribosomal protein L28 [Rubrivivax benzoatilyticus JA2]
          Length = 77

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 42/63 (66%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVC++T K  M GN VSHANNKT+RRFLPNL       +   +  +LR+S  ALR ++
Sbjct: 1  MARVCQVTGKRPMVGNNVSHANNKTKRRFLPNLQYRRFWMESENRWVRLRVSNAALRLID 60

Query: 61 RQG 63
          + G
Sbjct: 61 KVG 63


>gi|220933511|ref|YP_002512410.1| ribosomal protein L28 [Thioalkalivibrio sp. HL-EbGR7]
 gi|254801385|sp|B8GUR2|RL28_THISH RecName: Full=50S ribosomal protein L28
 gi|219994821|gb|ACL71423.1| ribosomal protein L28 [Thioalkalivibrio sp. HL-EbGR7]
          Length = 78

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 48/71 (67%), Gaps = 1/71 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVC++T K  ++GN VSHA+NKTRRRFLPNL       +   +  +LRIS   LR ++
Sbjct: 1  MARVCQITGKRPVTGNNVSHAHNKTRRRFLPNLHSHRFWVESENRWVRLRISSKGLRIID 60

Query: 61 RQGGLDRFLSN 71
          ++ G+D  L++
Sbjct: 61 KK-GIDAVLAD 70


>gi|158929977|gb|ABW82958.1| 50S ribosomal protein L28 [uncultured bacterium pEAF66]
          Length = 78

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 30/63 (47%), Positives = 41/63 (65%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVC++T K  M GN VSHANNKT+RRFLPNL    +  +   +   LR+S   LR ++
Sbjct: 1  MARVCQVTGKGPMVGNNVSHANNKTKRRFLPNLQNRRIFVESENRWVSLRLSNAGLRVID 60

Query: 61 RQG 63
          + G
Sbjct: 61 KVG 63


>gi|146280503|ref|YP_001170656.1| 50S ribosomal protein L28 [Pseudomonas stutzeri A1501]
 gi|146309388|ref|YP_001189853.1| 50S ribosomal protein L28 [Pseudomonas mendocina ymp]
 gi|330505618|ref|YP_004382487.1| 50S ribosomal protein L28 [Pseudomonas mendocina NK-01]
 gi|166226604|sp|A4Y0K5|RL28_PSEMY RecName: Full=50S ribosomal protein L28
 gi|166226606|sp|A4VFR3|RL28_PSEU5 RecName: Full=50S ribosomal protein L28
 gi|145568708|gb|ABP77814.1| 50S ribosomal protein L28 [Pseudomonas stutzeri A1501]
 gi|145577589|gb|ABP87121.1| LSU ribosomal protein L28P [Pseudomonas mendocina ymp]
 gi|327478739|gb|AEA82049.1| 50S ribosomal protein L28 [Pseudomonas stutzeri DSM 4166]
 gi|328919904|gb|AEB60735.1| 50S ribosomal protein L28 [Pseudomonas mendocina NK-01]
          Length = 78

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 44/63 (69%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  ++GN +SHANNKTRRRFLPNL       +  ++  +LR+S   +R ++
Sbjct: 1  MSRVCQVTGKGPVTGNNISHANNKTRRRFLPNLQHHRFWVESEKRFVRLRVSAKGMRVID 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KRG 63


>gi|170719375|ref|YP_001747063.1| 50S ribosomal protein L28 [Pseudomonas putida W619]
 gi|226699150|sp|B1J4M3|RL28_PSEPW RecName: Full=50S ribosomal protein L28
 gi|169757378|gb|ACA70694.1| ribosomal protein L28 [Pseudomonas putida W619]
          Length = 78

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 43/63 (68%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  ++GN +SHANNKTRRRFLPNL       +   +  +LR+S   +R ++
Sbjct: 1  MSRVCQVTGKGPVTGNNISHANNKTRRRFLPNLQHHRFWVESENRFVRLRVSAKGMRVID 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KRG 63


>gi|296136855|ref|YP_003644097.1| ribosomal protein L28 [Thiomonas intermedia K12]
 gi|294341024|emb|CAZ89419.1| 50S ribosomal protein L28 [Thiomonas sp. 3As]
 gi|295796977|gb|ADG31767.1| ribosomal protein L28 [Thiomonas intermedia K12]
          Length = 77

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 43/63 (68%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVC++T K  M GN VSHANNKT+RRFLPNL       +   +  +LR++   LR+++
Sbjct: 1  MARVCQVTGKGPMVGNNVSHANNKTKRRFLPNLQYRRFWVESENRFVRLRVTSSGLRTID 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|331239536|ref|XP_003332421.1| hypothetical protein PGTG_13806 [Puccinia graminis f. sp. tritici
           CRL 75-36-700-3]
 gi|309311411|gb|EFP88002.1| hypothetical protein PGTG_13806 [Puccinia graminis f. sp. tritici
           CRL 75-36-700-3]
          Length = 255

 Score = 62.8 bits (151), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 53/84 (63%)

Query: 12  VMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFLSN 71
           V +G+ VS + ++T+R + PN+ R TL S+++ Q  QL+++  AL+S++R GGLDR++  
Sbjct: 84  VRAGDNVSKSKHRTKRTWKPNVQRTTLWSEVLGQSLQLKVTSAALKSIDRMGGLDRYVLQ 143

Query: 72  SKKENLSARMRTLRSQILKKMSEK 95
             ++ L      +R  ++  M E+
Sbjct: 144 MSEQRLGGMGIRIRELVIAAMQER 167


>gi|134095643|ref|YP_001100718.1| 50S ribosomal protein L28 [Herminiimonas arsenicoxydans]
 gi|166226581|sp|A4G7W0|RL28_HERAR RecName: Full=50S ribosomal protein L28
 gi|133739546|emb|CAL62597.1| 50S ribosomal subunit protein L28 [Herminiimonas arsenicoxydans]
          Length = 78

 Score = 62.8 bits (151), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 30/63 (47%), Positives = 41/63 (65%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVC++T K  M GN VSHANNKT+RRFLPNL    +  +   +   LR+S   LR ++
Sbjct: 1  MARVCQVTGKGPMVGNNVSHANNKTKRRFLPNLQNRRIFVESENRWVSLRLSNAGLRVID 60

Query: 61 RQG 63
          + G
Sbjct: 61 KIG 63


>gi|330873141|gb|EGH07290.1| 50S ribosomal protein L28 [Pseudomonas syringae pv. glycinea str.
          race 4]
          Length = 77

 Score = 62.8 bits (151), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 44/63 (69%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  ++GN +SHANNKTRRRFLPNL       +  ++  +LR+S   +R ++
Sbjct: 1  MSRVCQVTGKGPVTGNNISHANNKTRRRFLPNLQHHRFWVEGEKRFVRLRVSAKGMRIID 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KRG 63


>gi|28867329|ref|NP_789948.1| 50S ribosomal protein L28 [Pseudomonas syringae pv. tomato str.
          DC3000]
 gi|66043494|ref|YP_233335.1| 50S ribosomal protein L28 [Pseudomonas syringae pv. syringae
          B728a]
 gi|71736327|ref|YP_272517.1| 50S ribosomal protein L28 [Pseudomonas syringae pv. phaseolicola
          1448A]
 gi|213970683|ref|ZP_03398808.1| 50S ribosomal protein L28 [Pseudomonas syringae pv. tomato T1]
 gi|237797775|ref|ZP_04586236.1| 50S ribosomal protein L28 [Pseudomonas syringae pv. oryzae str.
          1_6]
 gi|257481768|ref|ZP_05635809.1| 50S ribosomal protein L28 [Pseudomonas syringae pv. tabaci ATCC
          11528]
 gi|289625762|ref|ZP_06458716.1| 50S ribosomal protein L28 [Pseudomonas syringae pv. aesculi str.
          NCPPB3681]
 gi|289646361|ref|ZP_06477704.1| 50S ribosomal protein L28 [Pseudomonas syringae pv. aesculi str.
          2250]
 gi|289674416|ref|ZP_06495306.1| 50S ribosomal protein L28 [Pseudomonas syringae pv. syringae FF5]
 gi|298484833|ref|ZP_07002933.1| LSU ribosomal protein L28p [Pseudomonas savastanoi pv. savastanoi
          NCPPB 3335]
 gi|38258485|sp|Q88BC8|RL28_PSESM RecName: Full=50S ribosomal protein L28
 gi|75503899|sp|Q4ZZX5|RL28_PSEU2 RecName: Full=50S ribosomal protein L28
 gi|123638796|sp|Q48Q02|RL28_PSE14 RecName: Full=50S ribosomal protein L28
 gi|28850563|gb|AAO53643.1| ribosomal protein L28 [Pseudomonas syringae pv. tomato str.
          DC3000]
 gi|63254201|gb|AAY35297.1| Ribosomal protein L28 [Pseudomonas syringae pv. syringae B728a]
 gi|71556880|gb|AAZ36091.1| ribosomal protein L28 [Pseudomonas syringae pv. phaseolicola
          1448A]
 gi|213924517|gb|EEB58087.1| 50S ribosomal protein L28 [Pseudomonas syringae pv. tomato T1]
 gi|298160687|gb|EFI01708.1| LSU ribosomal protein L28p [Pseudomonas savastanoi pv. savastanoi
          NCPPB 3335]
 gi|330866538|gb|EGH01247.1| 50S ribosomal protein L28 [Pseudomonas syringae pv. aesculi str.
          0893_23]
 gi|330876488|gb|EGH10637.1| 50S ribosomal protein L28 [Pseudomonas syringae pv. morsprunorum
          str. M302280PT]
 gi|330895711|gb|EGH28001.1| 50S ribosomal protein L28 [Pseudomonas syringae pv. japonica str.
          M301072PT]
 gi|330941091|gb|EGH43993.1| 50S ribosomal protein L28 [Pseudomonas syringae pv. pisi str.
          1704B]
 gi|330952114|gb|EGH52374.1| 50S ribosomal protein L28 [Pseudomonas syringae Cit 7]
 gi|330957301|gb|EGH57561.1| 50S ribosomal protein L28 [Pseudomonas syringae pv. maculicola
          str. ES4326]
 gi|330964263|gb|EGH64523.1| 50S ribosomal protein L28 [Pseudomonas syringae pv. actinidiae
          str. M302091]
 gi|330972195|gb|EGH72261.1| 50S ribosomal protein L28 [Pseudomonas syringae pv. aceris str.
          M302273PT]
 gi|330977332|gb|EGH77285.1| 50S ribosomal protein L28 [Pseudomonas syringae pv. aptata str.
          DSM 50252]
 gi|330986858|gb|EGH84961.1| 50S ribosomal protein L28 [Pseudomonas syringae pv. lachrymans
          str. M301315]
 gi|331009402|gb|EGH89458.1| 50S ribosomal protein L28 [Pseudomonas syringae pv. tabaci ATCC
          11528]
 gi|331020625|gb|EGI00682.1| 50S ribosomal protein L28 [Pseudomonas syringae pv. oryzae str.
          1_6]
          Length = 77

 Score = 62.8 bits (151), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 44/63 (69%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  ++GN +SHANNKTRRRFLPNL       +  ++  +LR+S   +R ++
Sbjct: 1  MSRVCQVTGKGPVTGNNISHANNKTRRRFLPNLQHHRFWVEGEKRFVRLRVSAKGMRIID 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KRG 63


>gi|226946811|ref|YP_002801884.1| 50S ribosomal protein L28 [Azotobacter vinelandii DJ]
 gi|259646727|sp|C1DK04|RL28_AZOVD RecName: Full=50S ribosomal protein L28
 gi|226721738|gb|ACO80909.1| ribosomal protein L28 [Azotobacter vinelandii DJ]
          Length = 78

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 44/63 (69%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  ++GN +SHANNKTRRRFLPNL       +  ++  +LR+S   +R ++
Sbjct: 1  MSRVCQVTGKGPVTGNNISHANNKTRRRFLPNLQHHRFWVESEKRFVRLRVSAKGMRIID 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KRG 63


>gi|283954257|ref|ZP_06371781.1| ribosomal protein L28 [Campylobacter jejuni subsp. jejuni 414]
 gi|283794275|gb|EFC33020.1| ribosomal protein L28 [Campylobacter jejuni subsp. jejuni 414]
          Length = 64

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 45/64 (70%), Gaps = 5/64 (7%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNL--CRITLISDIMEQKYQLRISKCALRS 58
          M+RVC++T K  M GN VSHANNKT+RRFLPNL   R+TL     +   ++RI+   LR+
Sbjct: 1  MARVCQITGKGPMVGNNVSHANNKTKRRFLPNLRTVRVTLEDGTTK---KMRIAASTLRT 57

Query: 59 VERQ 62
          +++Q
Sbjct: 58 LKKQ 61


>gi|77461758|ref|YP_351265.1| 50S ribosomal protein L28 [Pseudomonas fluorescens Pf0-1]
 gi|123602799|sp|Q3K4N0|RL28_PSEPF RecName: Full=50S ribosomal protein L28
 gi|77385761|gb|ABA77274.1| 50S ribosomal protein L28 [Pseudomonas fluorescens Pf0-1]
          Length = 77

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 44/63 (69%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  ++GN +SHANNKTRRRFLPNL       +  ++  +LR+S   +R ++
Sbjct: 1  MSRVCQVTGKGPVTGNNISHANNKTRRRFLPNLQHHRFWVEEEKRFVRLRVSAKGMRIID 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KRG 63


>gi|300113188|ref|YP_003759763.1| 50S ribosomal protein L28 [Nitrosococcus watsonii C-113]
 gi|299539125|gb|ADJ27442.1| ribosomal protein L28 [Nitrosococcus watsonii C-113]
          Length = 78

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 47/71 (66%), Gaps = 1/71 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS+VC++T K   SGN VSHA+NKTRRRFLPNL       +   +  +L++S   LR ++
Sbjct: 1  MSKVCQVTGKRPASGNNVSHAHNKTRRRFLPNLHTHRFWVEGENRWVKLKVSGKGLRMID 60

Query: 61 RQGGLDRFLSN 71
          +  G+DR L++
Sbjct: 61 KL-GIDRVLAD 70


>gi|292490694|ref|YP_003526133.1| ribosomal protein L28 [Nitrosococcus halophilus Nc4]
 gi|291579289|gb|ADE13746.1| ribosomal protein L28 [Nitrosococcus halophilus Nc4]
          Length = 78

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 31/71 (43%), Positives = 50/71 (70%), Gaps = 1/71 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  +SGN VSHA+NKT+RRFLPNL       +  ++  +L++S   LR ++
Sbjct: 1  MSRVCQVTGKRPVSGNNVSHAHNKTKRRFLPNLHTHRFWVESEKRWVKLKVSSKGLRIID 60

Query: 61 RQGGLDRFLSN 71
          ++ G+D+ L++
Sbjct: 61 KR-GIDQVLAD 70


>gi|104784326|ref|YP_610824.1| 50S ribosomal protein L28 [Pseudomonas entomophila L48]
 gi|122401257|sp|Q1I2U5|RL28_PSEE4 RecName: Full=50S ribosomal protein L28
 gi|95113313|emb|CAK18041.1| 50S ribosomal protein L28 [Pseudomonas entomophila L48]
          Length = 78

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 43/63 (68%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  ++GN +SHANNKTRRRFLPNL       +   +  +LR+S   +R ++
Sbjct: 1  MSRVCQVTGKGPVTGNNISHANNKTRRRFLPNLQHHRFWVESENRFVRLRVSAKGMRIID 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KRG 63


>gi|330890936|gb|EGH23597.1| 50S ribosomal protein L28 [Pseudomonas syringae pv. mori str.
          301020]
          Length = 77

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 44/63 (69%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  ++GN +SHANNKTRRRFLPNL       +  ++  +LR+S   +R ++
Sbjct: 1  MSRVCQVTGKGPVTGNNISHANNKTRRRFLPNLQHHRFWIEGEKRFVRLRVSAKGMRIID 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KRG 63


>gi|71066265|ref|YP_264992.1| 50S ribosomal protein L28 [Psychrobacter arcticus 273-4]
 gi|93006813|ref|YP_581250.1| 50S ribosomal protein L28 [Psychrobacter cryohalolentis K5]
 gi|122414948|sp|Q1Q987|RL28_PSYCK RecName: Full=50S ribosomal protein L28
 gi|123648080|sp|Q4FR00|RL28_PSYA2 RecName: Full=50S ribosomal protein L28
 gi|71039250|gb|AAZ19558.1| LSU ribosomal protein L28P [Psychrobacter arcticus 273-4]
 gi|92394491|gb|ABE75766.1| LSU ribosomal protein L28P [Psychrobacter cryohalolentis K5]
          Length = 78

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 33/69 (47%), Positives = 45/69 (65%), Gaps = 1/69 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  M GN VSHANNKTRRRFLPNL       +   +  +LR+S   +R ++
Sbjct: 1  MSRVCQVTGKRPMVGNNVSHANNKTRRRFLPNLHNHRFWVESENRFVRLRVSTKGMRIID 60

Query: 61 RQGGLDRFL 69
          +  G+D+ L
Sbjct: 61 KL-GIDKVL 68


>gi|229593346|ref|YP_002875465.1| 50S ribosomal protein L28 [Pseudomonas fluorescens SBW25]
 gi|312963848|ref|ZP_07778319.1| 50S ribosomal protein L28 [Pseudomonas fluorescens WH6]
 gi|259646747|sp|C3K469|RL28_PSEFS RecName: Full=50S ribosomal protein L28
 gi|229365212|emb|CAY53501.1| 50S ribosomal protein L28 [Pseudomonas fluorescens SBW25]
 gi|311281883|gb|EFQ60493.1| 50S ribosomal protein L28 [Pseudomonas fluorescens WH6]
          Length = 77

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 44/63 (69%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  ++GN +SHANNKTRRRFLPNL       +  ++  +LR+S   +R ++
Sbjct: 1  MSRVCQVTGKGPVTGNNISHANNKTRRRFLPNLQHHRFWVEEEKRFVRLRVSAKGMRIID 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KRG 63


>gi|124002613|ref|ZP_01687465.1| ribosomal protein L28 [Microscilla marina ATCC 23134]
 gi|123991841|gb|EAY31228.1| ribosomal protein L28 [Microscilla marina ATCC 23134]
          Length = 83

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 42/63 (66%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+R+CE+T K   SGN VSHANNKTRR+F PNL +     +   +   L++S  A+R++ 
Sbjct: 1  MARICEVTGKRTQSGNNVSHANNKTRRKFYPNLQKKRFFLESKGEWITLKVSTQAIRTIN 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|145589914|ref|YP_001156511.1| ribosomal protein L28 [Polynucleobacter necessarius subsp.
          asymbioticus QLW-P1DMWA-1]
 gi|189029449|sp|A4SZN3|RL28_POLSQ RecName: Full=50S ribosomal protein L28
 gi|145048320|gb|ABP34947.1| LSU ribosomal protein L28P [Polynucleobacter necessarius subsp.
          asymbioticus QLW-P1DMWA-1]
          Length = 77

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 31/71 (43%), Positives = 45/71 (63%), Gaps = 1/71 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M++VC++T K  M GN VSHANNKT+RRFLPNL       +   +   LR++   LR ++
Sbjct: 1  MAKVCQVTGKKPMVGNNVSHANNKTKRRFLPNLQNRRFWVESENRWISLRLTNAGLRVID 60

Query: 61 RQGGLDRFLSN 71
          +  G+D  LS+
Sbjct: 61 KN-GIDAVLSD 70


>gi|297537562|ref|YP_003673331.1| 50S ribosomal protein L28 [Methylotenera sp. 301]
 gi|297256909|gb|ADI28754.1| ribosomal protein L28 [Methylotenera sp. 301]
          Length = 78

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 31/71 (43%), Positives = 46/71 (64%), Gaps = 1/71 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVC +T K  M GN VSHANN+T+RRFLPNL       +   +   +RI+  ALR+++
Sbjct: 1  MARVCMVTGKKPMVGNNVSHANNRTKRRFLPNLQNRKFWVESENRWVSMRITNNALRTID 60

Query: 61 RQGGLDRFLSN 71
          +  G+D  L++
Sbjct: 61 KN-GIDAVLAD 70


>gi|205355326|ref|ZP_03222097.1| 50S ribosomal protein L28 [Campylobacter jejuni subsp. jejuni
          CG8421]
 gi|205346560|gb|EDZ33192.1| 50S ribosomal protein L28 [Campylobacter jejuni subsp. jejuni
          CG8421]
          Length = 78

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 46/64 (71%), Gaps = 5/64 (7%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNL--CRITLISDIMEQKYQLRISKCALRS 58
          M+RVC++T K  M GN VSHANNKT+RRFLPNL   R+TL  D   +K  +RI+   LR+
Sbjct: 15 MARVCQITGKGPMVGNNVSHANNKTKRRFLPNLRTVRVTL-EDGTTRK--MRIAASTLRT 71

Query: 59 VERQ 62
          +++Q
Sbjct: 72 LKKQ 75


>gi|222824028|ref|YP_002575602.1| 50S ribosomal protein L28 [Campylobacter lari RM2100]
 gi|254801348|sp|B9KCR2|RL28_CAMLR RecName: Full=50S ribosomal protein L28
 gi|222539250|gb|ACM64351.1| 50S ribosomal protein L28 [Campylobacter lari RM2100]
          Length = 64

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 46/64 (71%), Gaps = 5/64 (7%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNL--CRITLISDIMEQKYQLRISKCALRS 58
          MSR+C++T K  M GN VSHANNKT+RRFLPNL   RITL  D   +K  +R++   LR+
Sbjct: 1  MSRICQITGKGPMVGNNVSHANNKTKRRFLPNLRTVRITL-EDGTTRK--VRVAASTLRT 57

Query: 59 VERQ 62
          +++Q
Sbjct: 58 LKKQ 61


>gi|91789646|ref|YP_550598.1| 50S ribosomal protein L28 [Polaromonas sp. JS666]
 gi|123355325|sp|Q125U2|RL28_POLSJ RecName: Full=50S ribosomal protein L28
 gi|91698871|gb|ABE45700.1| LSU ribosomal protein L28P [Polaromonas sp. JS666]
          Length = 77

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 42/63 (66%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVC++T K  M GN VSHANNKT+RRF+PNL       +   +  +LRI+   LR ++
Sbjct: 1  MARVCQVTGKGPMVGNNVSHANNKTKRRFMPNLQYRRFWVESENRWVRLRITSAGLRLID 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|121606104|ref|YP_983433.1| 50S ribosomal protein L28 [Polaromonas naphthalenivorans CJ2]
 gi|166226597|sp|A1VS84|RL28_POLNA RecName: Full=50S ribosomal protein L28
 gi|120595073|gb|ABM38512.1| LSU ribosomal protein L28P [Polaromonas naphthalenivorans CJ2]
          Length = 77

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 42/63 (66%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVC++T K  M GN VSHANNKT+RRF+PNL    +  +   +  +LRI+   LR ++
Sbjct: 1  MARVCQVTGKGPMVGNNVSHANNKTKRRFMPNLQYRRIWVESENRWVRLRITAAGLRLID 60

Query: 61 RQG 63
          + G
Sbjct: 61 KNG 63


>gi|148925829|ref|ZP_01809516.1| 50S ribosomal protein L28 [Campylobacter jejuni subsp. jejuni
          CG8486]
 gi|145844815|gb|EDK21919.1| 50S ribosomal protein L28 [Campylobacter jejuni subsp. jejuni
          CG8486]
 gi|307747382|gb|ADN90652.1| 50S ribosomal protein L28 [Campylobacter jejuni subsp. jejuni M1]
          Length = 78

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 46/64 (71%), Gaps = 5/64 (7%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNL--CRITLISDIMEQKYQLRISKCALRS 58
          M+RVC++T K  M GN VSHANNKT+RRFLPNL   R+TL  D   +K  +RI+   LR+
Sbjct: 15 MARVCQITGKGPMVGNNVSHANNKTKRRFLPNLRTVRVTL-EDGTTRK--MRIAASTLRT 71

Query: 59 VERQ 62
          +++Q
Sbjct: 72 LKKQ 75


>gi|119475391|ref|ZP_01615744.1| 50S ribosomal subunit protein L28 [marine gamma proteobacterium
          HTCC2143]
 gi|119451594|gb|EAW32827.1| 50S ribosomal subunit protein L28 [marine gamma proteobacterium
          HTCC2143]
          Length = 78

 Score = 62.0 bits (149), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 31/71 (43%), Positives = 48/71 (67%), Gaps = 1/71 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  ++GN VSHA N+TRRRFLPNL R     +  ++   LR+S   +R ++
Sbjct: 1  MSRVCQVTGKRPITGNNVSHAKNRTRRRFLPNLHRHRFWVESEKRFVSLRVSAKGMRIID 60

Query: 61 RQGGLDRFLSN 71
          ++ G+D  L++
Sbjct: 61 KK-GIDSVLTD 70


>gi|57237504|ref|YP_178518.1| 50S ribosomal protein L28 [Campylobacter jejuni RM1221]
 gi|86149067|ref|ZP_01067299.1| ribosomal protein L28 [Campylobacter jejuni subsp. jejuni CF93-6]
 gi|86151668|ref|ZP_01069882.1| ribosomal protein L28 [Campylobacter jejuni subsp. jejuni 260.94]
 gi|86153713|ref|ZP_01071916.1| ribosomal protein L28 [Campylobacter jejuni subsp. jejuni
          HB93-13]
 gi|88597135|ref|ZP_01100371.1| ribosomal protein L28 [Campylobacter jejuni subsp. jejuni 84-25]
 gi|121613410|ref|YP_001000157.1| 50S ribosomal protein L28 [Campylobacter jejuni subsp. jejuni
          81-176]
 gi|157414743|ref|YP_001481999.1| 50S ribosomal protein L28 [Campylobacter jejuni subsp. jejuni
          81116]
 gi|167005115|ref|ZP_02270873.1| 50S ribosomal protein L28 [Campylobacter jejuni subsp. jejuni
          81-176]
 gi|218562105|ref|YP_002343884.1| 50S ribosomal protein L28 [Campylobacter jejuni subsp. jejuni
          NCTC 11168]
 gi|283955872|ref|ZP_06373362.1| ribosomal protein L28 [Campylobacter jejuni subsp. jejuni 1336]
 gi|14195144|sp|Q9PI58|RL28_CAMJE RecName: Full=50S ribosomal protein L28
 gi|67461264|sp|Q5HW17|RL28_CAMJR RecName: Full=50S ribosomal protein L28
 gi|166226560|sp|A1VYG6|RL28_CAMJJ RecName: Full=50S ribosomal protein L28
 gi|172047068|sp|A8FKN5|RL28_CAMJ8 RecName: Full=50S ribosomal protein L28
 gi|57166308|gb|AAW35087.1| ribosomal protein L28 [Campylobacter jejuni RM1221]
 gi|85840425|gb|EAQ57682.1| ribosomal protein L28 [Campylobacter jejuni subsp. jejuni CF93-6]
 gi|85841297|gb|EAQ58545.1| ribosomal protein L28 [Campylobacter jejuni subsp. jejuni 260.94]
 gi|85842674|gb|EAQ59886.1| ribosomal protein L28 [Campylobacter jejuni subsp. jejuni
          HB93-13]
 gi|87250183|gb|EAQ73141.1| ribosomal protein L28 [Campylobacter jejuni subsp. jejuni 81-176]
 gi|88190824|gb|EAQ94797.1| ribosomal protein L28 [Campylobacter jejuni subsp. jejuni 84-25]
 gi|112359811|emb|CAL34598.1| 50S ribosomal protein L28 [Campylobacter jejuni subsp. jejuni
          NCTC 11168]
 gi|157385707|gb|ABV52022.1| 50S ribosomal protein L28 [Campylobacter jejuni subsp. jejuni
          81116]
 gi|283792532|gb|EFC31311.1| ribosomal protein L28 [Campylobacter jejuni subsp. jejuni 1336]
 gi|284925717|gb|ADC28069.1| 50S ribosomal protein L28 [Campylobacter jejuni subsp. jejuni
          IA3902]
 gi|315057870|gb|ADT72199.1| LSU ribosomal protein L28p [Campylobacter jejuni subsp. jejuni
          S3]
 gi|315928222|gb|EFV07539.1| ribosomal protein L28 [Campylobacter jejuni subsp. jejuni
          DFVF1099]
 gi|315931111|gb|EFV10085.1| ribosomal protein L28 [Campylobacter jejuni subsp. jejuni 327]
          Length = 64

 Score = 62.0 bits (149), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 46/64 (71%), Gaps = 5/64 (7%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNL--CRITLISDIMEQKYQLRISKCALRS 58
          M+RVC++T K  M GN VSHANNKT+RRFLPNL   R+TL  D   +K  +RI+   LR+
Sbjct: 1  MARVCQITGKGPMVGNNVSHANNKTKRRFLPNLRTVRVTL-EDGTTRK--MRIAASTLRT 57

Query: 59 VERQ 62
          +++Q
Sbjct: 58 LKKQ 61


>gi|319941938|ref|ZP_08016259.1| ribosomal protein L28 [Sutterella wadsworthensis 3_1_45B]
 gi|319804591|gb|EFW01461.1| ribosomal protein L28 [Sutterella wadsworthensis 3_1_45B]
          Length = 77

 Score = 62.0 bits (149), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 48/71 (67%), Gaps = 1/71 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVC++T K  M G++VSHANNKT+RRF+PNL       +   +  +LR++   LR+V+
Sbjct: 1  MARVCQVTGKAPMVGHQVSHANNKTKRRFMPNLQYRRFWVESENRWVRLRLTNAGLRTVD 60

Query: 61 RQGGLDRFLSN 71
          +  G+D  L++
Sbjct: 61 KL-GIDAVLAD 70


>gi|327404678|ref|YP_004345516.1| 50S ribosomal protein L28P [Fluviicola taffensis DSM 16823]
 gi|327320186|gb|AEA44678.1| LSU ribosomal protein L28P [Fluviicola taffensis DSM 16823]
          Length = 78

 Score = 62.0 bits (149), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 30/63 (47%), Positives = 41/63 (65%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC+LT K+VM GN VSH+N KT+R+F PNL          +    L+IS  ALR++ 
Sbjct: 1  MSRVCQLTGKSVMVGNNVSHSNRKTKRKFYPNLLTKKFYVPEDDMYVTLKISASALRTIN 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|153951942|ref|YP_001398512.1| 50S ribosomal protein L28 [Campylobacter jejuni subsp. doylei
          269.97]
 gi|166226559|sp|A7H4T2|RL28_CAMJD RecName: Full=50S ribosomal protein L28
 gi|152939388|gb|ABS44129.1| ribosomal protein L28 [Campylobacter jejuni subsp. doylei 269.97]
          Length = 64

 Score = 62.0 bits (149), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 33/64 (51%), Positives = 46/64 (71%), Gaps = 5/64 (7%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNL--CRITLISDIMEQKYQLRISKCALRS 58
          M+R+C++T K  M GN VSHANNKT+RRFLPNL   R+TL  D   +K  +RI+   LR+
Sbjct: 1  MARICQITGKGPMVGNNVSHANNKTKRRFLPNLRTVRVTL-EDGTTKK--MRIAASTLRT 57

Query: 59 VERQ 62
          +++Q
Sbjct: 58 LKKQ 61


>gi|315638422|ref|ZP_07893599.1| 50S ribosomal protein L28 [Campylobacter upsaliensis JV21]
 gi|315481413|gb|EFU72040.1| 50S ribosomal protein L28 [Campylobacter upsaliensis JV21]
          Length = 64

 Score = 62.0 bits (149), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 46/64 (71%), Gaps = 5/64 (7%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNL--CRITLISDIMEQKYQLRISKCALRS 58
          M+R+C++T K  M GN VSHANNKT+RRFLPNL   RITL  D   +K  +RI+   LR+
Sbjct: 1  MARICQITGKGPMVGNNVSHANNKTKRRFLPNLRTVRITL-EDGTTRK--VRIAASTLRT 57

Query: 59 VERQ 62
          +++Q
Sbjct: 58 LKKQ 61


>gi|312795309|ref|YP_004028231.1| LSU ribosomal protein L28P [Burkholderia rhizoxinica HKI 454]
 gi|312167084|emb|CBW74087.1| LSU ribosomal protein L28P [Burkholderia rhizoxinica HKI 454]
          Length = 98

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 31/71 (43%), Positives = 45/71 (63%), Gaps = 1/71 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+R C++T K  M GN VSHANNKT+RRFLPNL       +   +  +LR+S   LR ++
Sbjct: 22 MARKCQVTGKAPMVGNNVSHANNKTKRRFLPNLQSRRFWVESENRWVRLRVSNAGLRLID 81

Query: 61 RQGGLDRFLSN 71
          +  G+D  L++
Sbjct: 82 KN-GIDPVLAD 91


>gi|300123327|emb|CBK24600.2| unnamed protein product [Blastocystis hominis]
          Length = 115

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 54/83 (65%), Gaps = 1/83 (1%)

Query: 13  MSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFLSNS 72
           + GN VSH+  KTRR + PN+  + L S+ +++K  LR++   LR +++ GGLD ++ N+
Sbjct: 27  LFGNNVSHSERKTRRDWNPNVRHVHLYSETLDRKIGLRVTSNTLRCIDKAGGLDYYVLNT 86

Query: 73  KKENLSARMRT-LRSQILKKMSE 94
           K ++L++ +   LR +IL K  E
Sbjct: 87  KDKDLNSDVALRLREEILAKQRE 109


>gi|57168586|ref|ZP_00367719.1| ribosomal protein L28 [Campylobacter coli RM2228]
 gi|305433005|ref|ZP_07402161.1| 50S ribosomal protein L28 [Campylobacter coli JV20]
 gi|57020091|gb|EAL56768.1| ribosomal protein L28 [Campylobacter coli RM2228]
 gi|304443706|gb|EFM36363.1| 50S ribosomal protein L28 [Campylobacter coli JV20]
          Length = 64

 Score = 61.6 bits (148), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 33/64 (51%), Positives = 46/64 (71%), Gaps = 5/64 (7%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNL--CRITLISDIMEQKYQLRISKCALRS 58
          M+R+C++T K  M GN VSHANNKT+RRFLPNL   R+TL  D   +K  +RI+   LR+
Sbjct: 1  MARICQITGKGPMVGNNVSHANNKTKRRFLPNLRTVRVTL-EDGTTRK--MRIAASTLRT 57

Query: 59 VERQ 62
          +++Q
Sbjct: 58 LKKQ 61


>gi|49082438|gb|AAT50619.1| PA5316 [synthetic construct]
          Length = 79

 Score = 61.2 bits (147), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 44/63 (69%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  ++GN +SHA+NKTRRRFLPNL       +  ++  +LR+S   +R ++
Sbjct: 1  MSRVCQVTGKGPVTGNNISHAHNKTRRRFLPNLQHHRFWVESEKRFVRLRVSAKGMRIID 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KRG 63


>gi|261856607|ref|YP_003263890.1| ribosomal protein L28 [Halothiobacillus neapolitanus c2]
 gi|261837076|gb|ACX96843.1| ribosomal protein L28 [Halothiobacillus neapolitanus c2]
          Length = 78

 Score = 61.2 bits (147), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 30/63 (47%), Positives = 41/63 (65%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVC++T K    GN VSHANNKTRRRFLPNL       +   +   LR+S  A+R+++
Sbjct: 1  MARVCQVTGKRPAVGNNVSHANNKTRRRFLPNLHHKRFWVESEGRFVTLRVSTNAIRTID 60

Query: 61 RQG 63
          + G
Sbjct: 61 KVG 63


>gi|15600509|ref|NP_254003.1| 50S ribosomal protein L28 [Pseudomonas aeruginosa PAO1]
 gi|116053463|ref|YP_793790.1| 50S ribosomal protein L28 [Pseudomonas aeruginosa UCBPP-PA14]
 gi|152989167|ref|YP_001351408.1| 50S ribosomal protein L28 [Pseudomonas aeruginosa PA7]
 gi|218894419|ref|YP_002443289.1| 50S ribosomal protein L28 [Pseudomonas aeruginosa LESB58]
 gi|254237990|ref|ZP_04931313.1| 50S ribosomal protein L28 [Pseudomonas aeruginosa C3719]
 gi|254243798|ref|ZP_04937120.1| 50S ribosomal protein L28 [Pseudomonas aeruginosa 2192]
 gi|296392175|ref|ZP_06881650.1| 50S ribosomal protein L28 [Pseudomonas aeruginosa PAb1]
 gi|313106742|ref|ZP_07792959.1| 50S ribosomal protein L28 [Pseudomonas aeruginosa 39016]
 gi|14195125|sp|Q9HTN8|RL28_PSEAE RecName: Full=50S ribosomal protein L28
 gi|122256516|sp|Q02E46|RL28_PSEAB RecName: Full=50S ribosomal protein L28
 gi|166226603|sp|A6VEC3|RL28_PSEA7 RecName: Full=50S ribosomal protein L28
 gi|226699149|sp|B7V5K7|RL28_PSEA8 RecName: Full=50S ribosomal protein L28
 gi|9951633|gb|AAG08701.1|AE004944_5 50S ribosomal protein L28 [Pseudomonas aeruginosa PAO1]
 gi|115588684|gb|ABJ14699.1| 50S ribosomal protein L28 [Pseudomonas aeruginosa UCBPP-PA14]
 gi|126169921|gb|EAZ55432.1| 50S ribosomal protein L28 [Pseudomonas aeruginosa C3719]
 gi|126197176|gb|EAZ61239.1| 50S ribosomal protein L28 [Pseudomonas aeruginosa 2192]
 gi|150964325|gb|ABR86350.1| ribosomal protein L28 [Pseudomonas aeruginosa PA7]
 gi|218774648|emb|CAW30465.1| 50S ribosomal protein L28 [Pseudomonas aeruginosa LESB58]
 gi|310879461|gb|EFQ38055.1| 50S ribosomal protein L28 [Pseudomonas aeruginosa 39016]
          Length = 78

 Score = 61.2 bits (147), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 44/63 (69%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  ++GN +SHA+NKTRRRFLPNL       +  ++  +LR+S   +R ++
Sbjct: 1  MSRVCQVTGKGPVTGNNISHAHNKTRRRFLPNLQHHRFWVESEKRFVRLRVSAKGMRIID 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KRG 63


>gi|57242275|ref|ZP_00370214.1| ribosomal protein L28 [Campylobacter upsaliensis RM3195]
 gi|57016955|gb|EAL53737.1| ribosomal protein L28 [Campylobacter upsaliensis RM3195]
          Length = 64

 Score = 61.2 bits (147), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 45/64 (70%), Gaps = 5/64 (7%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNL--CRITLISDIMEQKYQLRISKCALRS 58
          M+R+C++T K  M GN VSHANNKT+RRFLPNL   RITL  D   +K   RI+   LR+
Sbjct: 1  MARICQITGKGPMVGNNVSHANNKTKRRFLPNLRTVRITL-EDGTTRKA--RIAASTLRT 57

Query: 59 VERQ 62
          +++Q
Sbjct: 58 LKKQ 61


>gi|148652401|ref|YP_001279494.1| 50S ribosomal protein L28 [Psychrobacter sp. PRwf-1]
 gi|172048504|sp|A5WD03|RL28_PSYWF RecName: Full=50S ribosomal protein L28
 gi|148571485|gb|ABQ93544.1| LSU ribosomal protein L28P [Psychrobacter sp. PRwf-1]
          Length = 78

 Score = 61.2 bits (147), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 31/71 (43%), Positives = 46/71 (64%), Gaps = 1/71 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K    GN VSHA+NKTRRRFLPNL       +   +  +LR+S   +R ++
Sbjct: 1  MSRVCQVTGKRPQVGNNVSHAHNKTRRRFLPNLHNHRFWVESENRFVRLRVSTKGMRIID 60

Query: 61 RQGGLDRFLSN 71
          +  G+D+ L++
Sbjct: 61 KH-GIDKVLAD 70


>gi|77166098|ref|YP_344623.1| ribosomal protein L28 [Nitrosococcus oceani ATCC 19707]
 gi|254436099|ref|ZP_05049606.1| ribosomal protein L28 [Nitrosococcus oceani AFC27]
 gi|123593489|sp|Q3J7V3|RL28_NITOC RecName: Full=50S ribosomal protein L28
 gi|76884412|gb|ABA59093.1| LSU ribosomal protein L28P [Nitrosococcus oceani ATCC 19707]
 gi|207089210|gb|EDZ66482.1| ribosomal protein L28 [Nitrosococcus oceani AFC27]
          Length = 78

 Score = 60.8 bits (146), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 31/71 (43%), Positives = 47/71 (66%), Gaps = 1/71 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS+VC++T K   SGN VSHA+NKTRRRFLPNL       +   +  +L++S   LR ++
Sbjct: 1  MSKVCQVTGKRPASGNNVSHAHNKTRRRFLPNLHTHRFWVEGENRWVKLKVSGKGLRMID 60

Query: 61 RQGGLDRFLSN 71
          +  G+D+ L++
Sbjct: 61 KL-GIDQVLAD 70


>gi|29468214|gb|AAO85450.1| 50S ribosomal protein L28 Rpl28 [Pyrocystis lunula]
          Length = 81

 Score = 60.5 bits (145), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 41/62 (66%)

Query: 2  SRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVER 61
          SR+C+LT K  ++GN VSH+N KT+RRFLPNL +        E+   L++S  ALR++ +
Sbjct: 1  SRICQLTGKRPITGNNVSHSNRKTKRRFLPNLFKKRFFIPETEEWVTLKVSSTALRNINK 60

Query: 62 QG 63
           G
Sbjct: 61 LG 62


>gi|307824752|ref|ZP_07654975.1| ribosomal protein L28 [Methylobacter tundripaludum SV96]
 gi|307734110|gb|EFO04964.1| ribosomal protein L28 [Methylobacter tundripaludum SV96]
          Length = 78

 Score = 60.5 bits (145), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 31/74 (41%), Positives = 49/74 (66%), Gaps = 1/74 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  ++GN VSHANN+T+RRF PNL       +   +  +LRIS   +R ++
Sbjct: 1  MSRVCQVTGKRPVTGNNVSHANNRTKRRFCPNLQHHRFWVESENRWVRLRISTKGMRIID 60

Query: 61 RQGGLDRFLSNSKK 74
          ++ G+D  L++ +K
Sbjct: 61 KK-GIDAVLADLRK 73


>gi|284041382|ref|YP_003391312.1| ribosomal protein L28 [Spirosoma linguale DSM 74]
 gi|283820675|gb|ADB42513.1| ribosomal protein L28 [Spirosoma linguale DSM 74]
          Length = 79

 Score = 60.5 bits (145), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 25/63 (39%), Positives = 41/63 (65%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVC++T K   +GN VSHANNKT+R+F PNL +     +   +   LR++  A++++ 
Sbjct: 1  MARVCQITGKRTRTGNNVSHANNKTKRKFFPNLQKKRFFVESTGEWVTLRVATSAIKTIN 60

Query: 61 RQG 63
          + G
Sbjct: 61 KNG 63


>gi|296112807|ref|YP_003626745.1| 50S ribosomal protein L28 [Moraxella catarrhalis RH4]
 gi|295920501|gb|ADG60852.1| 50S ribosomal protein L28 [Moraxella catarrhalis RH4]
 gi|326561053|gb|EGE11418.1| 50S ribosomal protein L28 [Moraxella catarrhalis 7169]
 gi|326561481|gb|EGE11825.1| 50S ribosomal protein L28 [Moraxella catarrhalis 46P47B1]
 gi|326564428|gb|EGE14656.1| 50S ribosomal protein L28 [Moraxella catarrhalis 12P80B1]
 gi|326566725|gb|EGE16864.1| 50S ribosomal protein L28 [Moraxella catarrhalis 103P14B1]
 gi|326567513|gb|EGE17628.1| 50S ribosomal protein L28 [Moraxella catarrhalis BC1]
 gi|326569359|gb|EGE19419.1| 50S ribosomal protein L28 [Moraxella catarrhalis BC8]
 gi|326571442|gb|EGE21457.1| 50S ribosomal protein L28 [Moraxella catarrhalis BC7]
 gi|326575275|gb|EGE25203.1| 50S ribosomal protein L28 [Moraxella catarrhalis CO72]
 gi|326576638|gb|EGE26545.1| 50S ribosomal protein L28 [Moraxella catarrhalis 101P30B1]
 gi|326577494|gb|EGE27374.1| 50S ribosomal protein L28 [Moraxella catarrhalis O35E]
          Length = 78

 Score = 60.5 bits (145), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 41/63 (65%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  + GN VSHA+NKTRRRFLPNL       +   +  +LR+S   +R ++
Sbjct: 1  MSRVCQVTGKRPLVGNNVSHAHNKTRRRFLPNLHNHRFWVESENRFVRLRVSSKGMRIID 60

Query: 61 RQG 63
          + G
Sbjct: 61 KHG 63


>gi|313676115|ref|YP_004054111.1| LSU ribosomal protein l28p [Marivirga tractuosa DSM 4126]
 gi|312942813|gb|ADR22003.1| LSU ribosomal protein L28P [Marivirga tractuosa DSM 4126]
          Length = 79

 Score = 60.1 bits (144), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 41/63 (65%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVC++T K    GN VSH+NNKTRRRFLPNL +        ++   L++S  A+R++ 
Sbjct: 1  MARVCQITGKRPQVGNNVSHSNNKTRRRFLPNLQKKRFYLPEEDKWITLKVSASAIRTIN 60

Query: 61 RQG 63
          + G
Sbjct: 61 KNG 63


>gi|268680228|ref|YP_003304659.1| ribosomal protein L28 [Sulfurospirillum deleyianum DSM 6946]
 gi|268618259|gb|ACZ12624.1| ribosomal protein L28 [Sulfurospirillum deleyianum DSM 6946]
          Length = 62

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 43/65 (66%), Gaps = 5/65 (7%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNL--CRITLISDIMEQKYQLRISKCALRS 58
          M+R C LT K  M GN VSHANNKT+RRFLPNL   R+TL     +   ++RI+   LR+
Sbjct: 1  MARKCALTGKGPMVGNNVSHANNKTKRRFLPNLRTVRVTLEDGTTK---KIRIAASTLRT 57

Query: 59 VERQG 63
          +++ G
Sbjct: 58 MKKNG 62


>gi|270159135|ref|ZP_06187791.1| ribosomal protein L28 [Legionella longbeachae D-4968]
 gi|289166031|ref|YP_003456169.1| 50S ribosomal protein L28 [Legionella longbeachae NSW150]
 gi|269987474|gb|EEZ93729.1| ribosomal protein L28 [Legionella longbeachae D-4968]
 gi|288859204|emb|CBJ13136.1| 50S ribosomal protein L28 [Legionella longbeachae NSW150]
          Length = 78

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 44/63 (69%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  M+G+KVSHANNKT+RRFLPN+   +   +  ++   L++S   +R ++
Sbjct: 1  MSRVCQVTGKRPMTGHKVSHANNKTKRRFLPNIQNHSFWVEEEKRFVTLKLSTKGMRIID 60

Query: 61 RQG 63
          + G
Sbjct: 61 KLG 63


>gi|119503523|ref|ZP_01625606.1| 50S ribosomal subunit protein L28 [marine gamma proteobacterium
          HTCC2080]
 gi|119460585|gb|EAW41677.1| 50S ribosomal subunit protein L28 [marine gamma proteobacterium
          HTCC2080]
          Length = 78

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 46/70 (65%), Gaps = 1/70 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  ++GN VSHA N+TRRRFLPNL       +  ++   LRIS   +R ++
Sbjct: 1  MSRVCQVTGKRPVTGNNVSHAKNRTRRRFLPNLHNHRFWVESEKRFVSLRISPKGMRIID 60

Query: 61 RQGGLDRFLS 70
          ++ G+D  L+
Sbjct: 61 KR-GIDTVLA 69


>gi|237745385|ref|ZP_04575866.1| ribosomal protein L28 [Oxalobacter formigenes HOxBLS]
 gi|229378880|gb|EEO28971.1| ribosomal protein L28 [Oxalobacter formigenes HOxBLS]
          Length = 75

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 40/64 (62%), Gaps = 1/64 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVC++T K  MSGN VSHANNK+RRRF+PNL       +   +   LR+S   L   +
Sbjct: 1  MARVCQVTGKKPMSGNTVSHANNKSRRRFMPNLHYRRFFVESENRWVSLRVSNAGLPG-D 59

Query: 61 RQGG 64
          RQ G
Sbjct: 60 RQVG 63


>gi|171464048|ref|YP_001798161.1| ribosomal protein L28 [Polynucleobacter necessarius subsp.
          necessarius STIR1]
 gi|226699144|sp|B1XW20|RL28_POLNS RecName: Full=50S ribosomal protein L28
 gi|171193586|gb|ACB44547.1| ribosomal protein L28 [Polynucleobacter necessarius subsp.
          necessarius STIR1]
          Length = 77

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 44/71 (61%), Gaps = 1/71 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M++VC++T K  M GN VSHA NKT+RRFLPNL       +   +   LR++   LR ++
Sbjct: 1  MAKVCQVTGKKPMVGNNVSHAKNKTKRRFLPNLQNRRFWVESENRWISLRLTNAGLRVID 60

Query: 61 RQGGLDRFLSN 71
          +  G+D  LS+
Sbjct: 61 KN-GIDAVLSD 70


>gi|330720901|gb|EGG99084.1| LSU ribosomal protein L28p [gamma proteobacterium IMCC2047]
          Length = 78

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 49/71 (69%), Gaps = 1/71 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS+VC++T K  ++GN VSHA N+TRRRFLPNL       +  ++  +LR+S   +R ++
Sbjct: 1  MSKVCQVTGKRPVTGNNVSHAKNRTRRRFLPNLHTHRFWVESEKRFVKLRVSTKGMRIID 60

Query: 61 RQGGLDRFLSN 71
          ++ G+D+ L++
Sbjct: 61 KK-GIDQVLAD 70


>gi|254258430|ref|ZP_04949484.1| 50S ribosomal protein L28 [Burkholderia pseudomallei 1710a]
 gi|254217119|gb|EET06503.1| 50S ribosomal protein L28 [Burkholderia pseudomallei 1710a]
          Length = 454

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 31/63 (49%), Positives = 42/63 (66%)

Query: 1   MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
           M+RVC++T K  MSGN VSHANNKT+RRFLPNL       +   +  +LR+S   LR ++
Sbjct: 378 MARVCQVTGKAPMSGNNVSHANNKTKRRFLPNLQNRRFWVESENRWVRLRVSNAGLRLID 437

Query: 61  RQG 63
           + G
Sbjct: 438 KNG 440


>gi|260072713|gb|ACX30609.1| ribosomal protein L28 [uncultured bacterium ARCTIC96BD-19]
          Length = 78

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 42/63 (66%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS+VC++T K  +SGN VSHANN+TRRRF PNL       +   +  +L++S   LR ++
Sbjct: 1  MSKVCQVTGKRPISGNNVSHANNRTRRRFYPNLHTHRFWVEAENRFVKLKLSARGLRVID 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|257454608|ref|ZP_05619864.1| ribosomal protein L28 [Enhydrobacter aerosaccus SK60]
 gi|257447918|gb|EEV22905.1| ribosomal protein L28 [Enhydrobacter aerosaccus SK60]
          Length = 78

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 31/71 (43%), Positives = 46/71 (64%), Gaps = 1/71 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K    GN VSHANNKTRRRFLPNL       +   +  +LR++   +R ++
Sbjct: 1  MSRVCQVTGKRPAVGNNVSHANNKTRRRFLPNLHTHRFWVESENRFVKLRLTTKGMRIID 60

Query: 61 RQGGLDRFLSN 71
          +  G+D+ L++
Sbjct: 61 KV-GIDQVLTD 70


>gi|311696213|gb|ADP99086.1| ribosomal protein L28 [marine bacterium HP15]
          Length = 78

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 31/71 (43%), Positives = 47/71 (66%), Gaps = 1/71 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  +SGN VSHA N TRRRFLPNL       +  ++  +LR+S   +R ++
Sbjct: 1  MSRVCQVTGKRPVSGNNVSHAMNHTRRRFLPNLQNHRFWVESEKRFVKLRVSTKGMRIID 60

Query: 61 RQGGLDRFLSN 71
          ++ G+D  L++
Sbjct: 61 KK-GIDAVLAD 70


>gi|329896523|ref|ZP_08271581.1| LSU ribosomal protein L28p [gamma proteobacterium IMCC3088]
 gi|328921740|gb|EGG29113.1| LSU ribosomal protein L28p [gamma proteobacterium IMCC3088]
          Length = 78

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 30/70 (42%), Positives = 47/70 (67%), Gaps = 1/70 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  ++GN VSHA N+TRRRFLPNL       +  ++  +LR+S   +R ++
Sbjct: 1  MSRVCQVTGKRPVTGNNVSHAKNRTRRRFLPNLHSHRFWVESEKRFVRLRVSSKGMRVID 60

Query: 61 RQGGLDRFLS 70
          ++ G+D  L+
Sbjct: 61 KR-GIDTVLA 69


>gi|19112705|ref|NP_595913.1| mitochondrial ribosomal protein subunit L28 [Schizosaccharomyces
           pombe 972h-]
 gi|74626794|sp|O60091|RM24_SCHPO RecName: Full=60S ribosomal protein L24, mitochondrial; Flags:
           Precursor
 gi|3006168|emb|CAA18428.1| mitochondrial ribosomal protein subunit L28 [Schizosaccharomyces
           pombe]
          Length = 176

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 30/91 (32%), Positives = 55/91 (60%), Gaps = 3/91 (3%)

Query: 10  KTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFL 69
           KT    NK+    +KTRR ++PN     L S+++E+K+ L ++   LR+++++GGLD +L
Sbjct: 36  KTEAGNNKIPKFGHKTRRVWIPNGHSKWLYSNVLEEKFHLYVTSRVLRTIDKEGGLDEYL 95

Query: 70  ---SNSKKENLSARMRTLRSQILKKMSEKSS 97
              + S+ ++L  R   LR+ +L K+  K+ 
Sbjct: 96  VKSTPSRLKSLGLRGVELRALVLHKLGAKNP 126


>gi|254515837|ref|ZP_05127897.1| ribosomal protein L28 [gamma proteobacterium NOR5-3]
 gi|219675559|gb|EED31925.1| ribosomal protein L28 [gamma proteobacterium NOR5-3]
          Length = 78

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 27/63 (42%), Positives = 44/63 (69%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVC++T K  ++GN VSHA N+TRRRFLPNL +     +  ++  +LR+S   +R ++
Sbjct: 1  MARVCQVTGKRPVTGNNVSHAKNRTRRRFLPNLHQHRFWVESEKRFVRLRVSSKGMRIID 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|254482757|ref|ZP_05095995.1| ribosomal protein L28 [marine gamma proteobacterium HTCC2148]
 gi|214037116|gb|EEB77785.1| ribosomal protein L28 [marine gamma proteobacterium HTCC2148]
          Length = 78

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 27/63 (42%), Positives = 43/63 (68%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVC++T K  ++GN VSHA N+TRRRFLPNL +     +  ++   LR+S   +R ++
Sbjct: 1  MARVCQVTGKRPVTGNNVSHAKNRTRRRFLPNLHKHRFWVESEKRFVSLRVSSKGMRIID 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|121999092|ref|YP_001003879.1| ribosomal protein L28 [Halorhodospira halophila SL1]
 gi|166226580|sp|A1WZG5|RL28_HALHL RecName: Full=50S ribosomal protein L28
 gi|121590497|gb|ABM63077.1| LSU ribosomal protein L28P [Halorhodospira halophila SL1]
          Length = 78

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 46/71 (64%), Gaps = 1/71 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS+VC++T     +GN VSHANNKTRRRFLPNL       +   +  +LR+S   +R ++
Sbjct: 1  MSKVCQVTGTRPGTGNNVSHANNKTRRRFLPNLHDHRYWVESENRWVRLRVSAKGMRIID 60

Query: 61 RQGGLDRFLSN 71
          ++ G+D  L++
Sbjct: 61 KR-GIDAVLAD 70


>gi|88705461|ref|ZP_01103172.1| 50S ribosomal protein L28 [Congregibacter litoralis KT71]
 gi|88700551|gb|EAQ97659.1| 50S ribosomal protein L28 [Congregibacter litoralis KT71]
          Length = 78

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 27/63 (42%), Positives = 44/63 (69%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVC++T K  ++GN VSHA N+TRRRFLPNL +     +  ++  +LR+S   +R ++
Sbjct: 1  MARVCQVTGKRPVTGNNVSHAKNRTRRRFLPNLHQHRFWVESEKRFVRLRVSSKGMRIID 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|90415485|ref|ZP_01223419.1| 50S ribosomal protein L28 [marine gamma proteobacterium HTCC2207]
 gi|90332808|gb|EAS47978.1| 50S ribosomal protein L28 [marine gamma proteobacterium HTCC2207]
          Length = 78

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 42/63 (66%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  M+GN VSHA N+TRRRF PNL       +  ++  +LR+S   +R ++
Sbjct: 1  MSRVCQVTGKRPMAGNNVSHAKNRTRRRFEPNLHSHRFWVEAEKRFVKLRVSTKGMRIID 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|88813415|ref|ZP_01128651.1| Ribosomal protein L28 [Nitrococcus mobilis Nb-231]
 gi|88789286|gb|EAR20417.1| Ribosomal protein L28 [Nitrococcus mobilis Nb-231]
          Length = 78

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 27/63 (42%), Positives = 42/63 (66%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M++VC++T K   +GN VSHANNKT+RRFLPNL       +  ++  +LR+S   +R ++
Sbjct: 1  MAKVCQVTGKRPTTGNNVSHANNKTKRRFLPNLHYHRFWVETEQRWVRLRVSSKGMRIID 60

Query: 61 RQG 63
          + G
Sbjct: 61 KIG 63


>gi|254579857|ref|XP_002495914.1| ZYRO0C05940p [Zygosaccharomyces rouxii]
 gi|238938805|emb|CAR26981.1| ZYRO0C05940p [Zygosaccharomyces rouxii]
          Length = 256

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 47/73 (64%), Gaps = 4/73 (5%)

Query: 12  VMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFLSN 71
           V  GN ++ +  KTRRR+LPN+ R  L S+ +E+K  L ++   LR++ ++GG+D +L+ 
Sbjct: 76  VQYGNNIAESKTKTRRRWLPNVIRKGLWSETLERKISLGMTAKVLRTISKEGGIDNYLTK 135

Query: 72  SKKENLSARMRTL 84
            K    SAR++ L
Sbjct: 136 DK----SARIKEL 144


>gi|332666735|ref|YP_004449523.1| 50S ribosomal protein L28 [Haliscomenobacter hydrossis DSM 1100]
 gi|332335549|gb|AEE52650.1| 50S ribosomal protein L28 [Haliscomenobacter hydrossis DSM 1100]
          Length = 87

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 31/78 (39%), Positives = 48/78 (61%), Gaps = 1/78 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS+VC+LT K  + GN VSH+N KT+RRFLPNL +        +Q   L++S  A+R++ 
Sbjct: 1  MSKVCQLTGKRPIVGNNVSHSNRKTKRRFLPNLQKKRFFIPETDQWVTLKLSTSAMRNIS 60

Query: 61 RQGGLDRFLSNSKKENLS 78
          +  G+  +L   +KE + 
Sbjct: 61 KL-GIYEYLQRLEKEGVD 77


>gi|40063305|gb|AAR38123.1| ribosomal protein L28 [uncultured marine bacterium 578]
          Length = 78

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 42/63 (66%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M++VC++T K  +SGN VSHANNKTRRRF PNL       +   +  +L++S   LR ++
Sbjct: 1  MAKVCQVTGKRPISGNNVSHANNKTRRRFYPNLHTHRFWVENENRFVKLKLSARGLRVID 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|328675491|gb|AEB28166.1| LSU ribosomal protein L28p [Francisella cf. novicida 3523]
          Length = 78

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 31/71 (43%), Positives = 45/71 (63%), Gaps = 1/71 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS+VC +T K   +GN VSHA NKTRRRFLPNL       +   +  +LR+S   +R ++
Sbjct: 1  MSKVCIVTGKRPATGNNVSHAQNKTRRRFLPNLHTHRFWVESENRYIKLRVSSKGMRIID 60

Query: 61 RQGGLDRFLSN 71
          ++ G+D  LS+
Sbjct: 61 KK-GIDTVLSD 70


>gi|52840724|ref|YP_094523.1| 50S ribosomal protein L28 [Legionella pneumophila subsp.
          pneumophila str. Philadelphia 1]
 gi|54293471|ref|YP_125886.1| 50S ribosomal protein L28 [Legionella pneumophila str. Lens]
 gi|54296513|ref|YP_122882.1| 50S ribosomal protein L28 [Legionella pneumophila str. Paris]
 gi|148360905|ref|YP_001252112.1| 50S ribosomal protein L28 [Legionella pneumophila str. Corby]
 gi|67461335|sp|Q5WZ62|RL28_LEGPL RecName: Full=50S ribosomal protein L28
 gi|67461340|sp|Q5X7R1|RL28_LEGPA RecName: Full=50S ribosomal protein L28
 gi|67461348|sp|Q5ZY93|RL28_LEGPH RecName: Full=50S ribosomal protein L28
 gi|166226585|sp|A5IHB6|RL28_LEGPC RecName: Full=50S ribosomal protein L28
 gi|46430436|emb|CAE45004.1| putative 50s ribosomal protein L28 [Legionella pneumophila str.
          Corby]
 gi|52627835|gb|AAU26576.1| 50S ribosomal protein L28 [Legionella pneumophila subsp.
          pneumophila str. Philadelphia 1]
 gi|53750298|emb|CAH11692.1| 50S ribosomal protein L28 [Legionella pneumophila str. Paris]
 gi|53753303|emb|CAH14750.1| 50S ribosomal protein L28 [Legionella pneumophila str. Lens]
 gi|148282678|gb|ABQ56766.1| 50S ribosomal protein L28 [Legionella pneumophila str. Corby]
          Length = 78

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 41/63 (65%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  M G+KVSHANNKT+RRFLPN+       +   +   LR+S   +R ++
Sbjct: 1  MSRVCQVTGKRPMVGHKVSHANNKTKRRFLPNIQNHKFWVEEENRFVTLRLSTKGMRIID 60

Query: 61 RQG 63
          + G
Sbjct: 61 KLG 63


>gi|120556470|ref|YP_960821.1| 50S ribosomal protein L28 [Marinobacter aquaeolei VT8]
 gi|166226587|sp|A1U6L5|RL28_MARAV RecName: Full=50S ribosomal protein L28
 gi|120326319|gb|ABM20634.1| LSU ribosomal protein L28P [Marinobacter aquaeolei VT8]
          Length = 78

 Score = 58.2 bits (139), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 47/71 (66%), Gaps = 1/71 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  ++GN VSHA N TRRRFLPNL       +  ++  +LR+S   +R ++
Sbjct: 1  MSRVCQVTGKRPVTGNNVSHAMNHTRRRFLPNLQNHRFWVESEKRFVKLRVSTKGMRIID 60

Query: 61 RQGGLDRFLSN 71
          ++ G+D  L++
Sbjct: 61 KK-GIDAVLAD 70


>gi|126664653|ref|ZP_01735637.1| 50S ribosomal subunit protein L28 [Marinobacter sp. ELB17]
 gi|126630979|gb|EBA01593.1| 50S ribosomal subunit protein L28 [Marinobacter sp. ELB17]
          Length = 78

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 47/71 (66%), Gaps = 1/71 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  ++GN VSHA N TRRRFLPNL       +  ++  +LR+S   +R ++
Sbjct: 1  MSRVCQVTGKRPVAGNNVSHAMNHTRRRFLPNLQSHRFWVETEKRFVKLRVSTKGMRIID 60

Query: 61 RQGGLDRFLSN 71
          ++ G+D  L++
Sbjct: 61 KK-GIDIVLAD 70


>gi|153877669|ref|ZP_02004325.1| Ribosomal protein L28 [Beggiatoa sp. PS]
 gi|152065867|gb|EDN65675.1| Ribosomal protein L28 [Beggiatoa sp. PS]
          Length = 78

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 46/65 (70%), Gaps = 4/65 (6%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNL-CRITLISDIMEQKY-QLRISKCALRS 58
          MS+VC++T K  +SGN VSHA+NKT+RRFLPNL      + D  E +Y +LR++   +R 
Sbjct: 1  MSKVCQVTGKRPISGNNVSHAHNKTKRRFLPNLHTHRFWVPD--ENRYIKLRVTTKGMRI 58

Query: 59 VERQG 63
          ++++G
Sbjct: 59 IDKKG 63


>gi|189501983|ref|YP_001957700.1| hypothetical protein Aasi_0570 [Candidatus Amoebophilus asiaticus
          5a2]
 gi|226738025|sp|B3ERW9|RL28_AMOA5 RecName: Full=50S ribosomal protein L28
 gi|189497424|gb|ACE05971.1| hypothetical protein Aasi_0570 [Candidatus Amoebophilus asiaticus
          5a2]
          Length = 83

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 31/78 (39%), Positives = 44/78 (56%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS+VC++T K    GNKVSHANNKT+RRF PNL               LR+S   +R++ 
Sbjct: 1  MSKVCDITGKRPRVGNKVSHANNKTKRRFYPNLQFKKFYVPETNSWIVLRVSTSVIRTIN 60

Query: 61 RQGGLDRFLSNSKKENLS 78
          ++G L+      +K  +S
Sbjct: 61 KKGILEVIKEAQRKGTIS 78


>gi|258543788|ref|ZP_05704022.1| 50S ribosomal protein L28 [Cardiobacterium hominis ATCC 15826]
 gi|258520963|gb|EEV89822.1| 50S ribosomal protein L28 [Cardiobacterium hominis ATCC 15826]
          Length = 78

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 45/70 (64%), Gaps = 1/70 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR+C++T K  M GN VSHANNK +RRFLPN+       +   +  +L++S   +R ++
Sbjct: 1  MSRICQVTGKKPMVGNTVSHANNKNKRRFLPNIQEHRFWVESENRFVKLKVSTHGMRIID 60

Query: 61 RQGGLDRFLS 70
          ++ G+D  L+
Sbjct: 61 KR-GIDAVLA 69


>gi|86142312|ref|ZP_01060822.1| ribosomal protein L28 [Leeuwenhoekiella blandensis MED217]
 gi|85831064|gb|EAQ49521.1| ribosomal protein L28 [Leeuwenhoekiella blandensis MED217]
          Length = 79

 Score = 57.8 bits (138), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 40/63 (63%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVCELT K  M GN VSHA NKT+R+F  NL +        ++   L+IS  AL+++ 
Sbjct: 1  MSRVCELTGKKAMVGNNVSHAMNKTKRKFDANLIKKRFYIPEEDKWITLKISTAALKNIN 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|304310174|ref|YP_003809772.1| 50S ribosomal protein L28 [gamma proteobacterium HdN1]
 gi|301795907|emb|CBL44108.1| 50S ribosomal protein L28 [gamma proteobacterium HdN1]
          Length = 78

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 48/71 (67%), Gaps = 1/71 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M++VC++T K  ++GN VSHAN KTRRRF PNL    +  +  ++  +LR+S   LR ++
Sbjct: 1  MAKVCQVTGKRPITGNNVSHANRKTRRRFEPNLHHHRIWVESEKRFVRLRVSNHGLRIID 60

Query: 61 RQGGLDRFLSN 71
          +  G+D+ L++
Sbjct: 61 KV-GIDQVLAD 70


>gi|169862685|ref|XP_001837968.1| 50S ribosomal protein L24 [Coprinopsis cinerea okayama7#130]
 gi|116500955|gb|EAU83850.1| 50S ribosomal protein L24 [Coprinopsis cinerea okayama7#130]
          Length = 192

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 47/69 (68%)

Query: 10 KTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFL 69
          K++  GN V  + +KTRR +LPN+ R  L S+++ +K +++++  ALR++++ GGLD +L
Sbjct: 26 KSIQYGNNVPFSKHKTRRTWLPNVQRKRLDSEVLGEKVRIKVTTRALRTIKKYGGLDNYL 85

Query: 70 SNSKKENLS 78
            ++   LS
Sbjct: 86 KGTQSHKLS 94


>gi|194099564|ref|YP_002002694.1| 50S ribosomal protein L28 [Neisseria gonorrhoeae NCCP11945]
 gi|313667723|ref|YP_004048007.1| 50S ribosomal protein L28 [Neisseria lactamica ST-640]
 gi|193934854|gb|ACF30678.1| 50S ribosomal protein L28 [Neisseria gonorrhoeae NCCP11945]
 gi|313005185|emb|CBN86618.1| 50S ribosomal protein L28 [Neisseria lactamica 020-06]
 gi|316984322|gb|EFV63296.1| ribosomal protein L28 [Neisseria meningitidis H44/76]
 gi|317165059|gb|ADV08600.1| 50S ribosomal protein L28 [Neisseria gonorrhoeae TCDC-NG08107]
          Length = 71

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 43/65 (66%), Gaps = 1/65 (1%)

Query: 7  LTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLD 66
          +T K  MSGN VSHANNKT+RRFLPNL       +   +  +LR+S  ALR++++  G+D
Sbjct: 1  MTGKRPMSGNNVSHANNKTKRRFLPNLQSRRFWVESENRWVRLRVSNAALRTIDKV-GID 59

Query: 67 RFLSN 71
            L++
Sbjct: 60 VVLAD 64


>gi|119773469|ref|YP_926209.1| 50S ribosomal protein L28 [Shewanella amazonensis SB2B]
 gi|166226616|sp|A1S2D3|RL28_SHEAM RecName: Full=50S ribosomal protein L28
 gi|119765969|gb|ABL98539.1| LSU ribosomal protein L28P [Shewanella amazonensis SB2B]
          Length = 78

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 40/63 (63%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  M GN  SHA N TRRRFLPNL       +  ++  QLR+S   +R ++
Sbjct: 1  MSRVCQVTGKRPMVGNNRSHAKNATRRRFLPNLQNHRFWLETEKRFVQLRVSTKGMRIID 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|332977907|gb|EGK14655.1| 50S ribosomal protein L28 [Psychrobacter sp. 1501(2011)]
          Length = 78

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 45/71 (63%), Gaps = 1/71 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K    GN VSHA N+TRRRFLPNL       +   +  +LR+S   +R ++
Sbjct: 1  MSRVCQVTGKRPQVGNNVSHALNRTRRRFLPNLHNHRFWVESENRFVRLRVSTKGMRIID 60

Query: 61 RQGGLDRFLSN 71
          +  G+D+ L++
Sbjct: 61 KH-GIDKVLAD 70


>gi|148245024|ref|YP_001219718.1| 50S ribosomal protein L28 [Candidatus Vesicomyosocius okutanii
          HA]
 gi|166228171|sp|A5CVN4|RL28_VESOH RecName: Full=50S ribosomal protein L28
 gi|146326851|dbj|BAF61994.1| 50S ribosomal protein L28 [Candidatus Vesicomyosocius okutanii
          HA]
          Length = 82

 Score = 57.8 bits (138), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 27/63 (42%), Positives = 41/63 (65%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M++VC +T K  +SGN VSHANNKTRRRF PNL +     +   +  +L++S    R ++
Sbjct: 1  MAKVCMVTGKRPISGNNVSHANNKTRRRFYPNLHKHRFWVESENRFVKLKLSAKGFRIID 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|167626711|ref|YP_001677211.1| 50S ribosomal protein L28 [Francisella philomiragia subsp.
          philomiragia ATCC 25017]
 gi|241667286|ref|ZP_04754864.1| 50S ribosomal protein L28 [Francisella philomiragia subsp.
          philomiragia ATCC 25015]
 gi|254875837|ref|ZP_05248547.1| 50S ribosomal protein L28 [Francisella philomiragia subsp.
          philomiragia ATCC 25015]
 gi|189029441|sp|B0U0F9|RL28_FRAP2 RecName: Full=50S ribosomal protein L28
 gi|167596712|gb|ABZ86710.1| 50S ribosomal protein L28 [Francisella philomiragia subsp.
          philomiragia ATCC 25017]
 gi|254841858|gb|EET20272.1| 50S ribosomal protein L28 [Francisella philomiragia subsp.
          philomiragia ATCC 25015]
          Length = 78

 Score = 57.4 bits (137), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 45/71 (63%), Gaps = 1/71 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS+VC +T K   +GN VSHA NKTRRRFLPNL       +   +  +L++S   +R ++
Sbjct: 1  MSKVCIVTGKRPATGNNVSHAQNKTRRRFLPNLHTHRFWVESENKYIKLKVSSKGMRIID 60

Query: 61 RQGGLDRFLSN 71
          ++ G+D  LS+
Sbjct: 61 KK-GIDTVLSD 70


>gi|295133100|ref|YP_003583776.1| 50S ribosomal protein L28 [Zunongwangia profunda SM-A87]
 gi|294981115|gb|ADF51580.1| 50S ribosomal protein L28 [Zunongwangia profunda SM-A87]
          Length = 79

 Score = 57.4 bits (137), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 40/63 (63%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVCELT K  M GN VSHA NKT+R+F  NL +        ++   L++S  AL+++ 
Sbjct: 1  MSRVCELTGKKAMVGNNVSHAMNKTKRKFNANLVKKRFFIPEEDKWITLKVSTSALKNIN 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|262341283|ref|YP_003284138.1| 50S ribosomal protein L28 [Blattabacterium sp. (Blattella
          germanica) str. Bge]
 gi|262272620|gb|ACY40528.1| 50S ribosomal protein L28 [Blattabacterium sp. (Blattella
          germanica) str. Bge]
          Length = 76

 Score = 57.4 bits (137), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 40/63 (63%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS+VCELT K  M GNKVSHANNK +RRF  NLC+     +  ++   L+I   A++ + 
Sbjct: 1  MSKVCELTGKKAMIGNKVSHANNKKKRRFNINLCKKRFFFNKRKKWITLKICAYAVKIIN 60

Query: 61 RQG 63
          + G
Sbjct: 61 KIG 63


>gi|127514408|ref|YP_001095605.1| ribosomal protein L28 [Shewanella loihica PV-4]
 gi|166226619|sp|A3QIP8|RL28_SHELP RecName: Full=50S ribosomal protein L28
 gi|126639703|gb|ABO25346.1| LSU ribosomal protein L28P [Shewanella loihica PV-4]
          Length = 78

 Score = 57.4 bits (137), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 40/63 (63%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  M GN  SHA N TRRRFLPNL       +  ++  QLR+S   +R ++
Sbjct: 1  MSRVCQVTGKKPMVGNNRSHAKNATRRRFLPNLQNHRFWLEDEKRFVQLRVSTKGMRIID 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|56708623|ref|YP_170519.1| 50S ribosomal protein L28 [Francisella tularensis subsp.
          tularensis SCHU S4]
 gi|89255929|ref|YP_513291.1| 50S ribosomal protein L28 [Francisella tularensis subsp.
          holarctica LVS]
 gi|110671094|ref|YP_667651.1| 50S ribosomal protein L28 [Francisella tularensis subsp.
          tularensis FSC198]
 gi|115314411|ref|YP_763134.1| 50S ribosomal protein L28 [Francisella tularensis subsp.
          holarctica OSU18]
 gi|118496943|ref|YP_897993.1| 50S ribosomal protein L28 [Francisella tularensis subsp. novicida
          U112]
 gi|134301431|ref|YP_001121399.1| 50S ribosomal protein L28 [Francisella tularensis subsp.
          tularensis WY96-3418]
 gi|156501918|ref|YP_001427983.1| 50S ribosomal protein L28 [Francisella tularensis subsp.
          holarctica FTNF002-00]
 gi|167009168|ref|ZP_02274099.1| ribosomal protein L28 [Francisella tularensis subsp. holarctica
          FSC200]
 gi|187931156|ref|YP_001891140.1| 50S ribosomal protein L28 [Francisella tularensis subsp.
          mediasiatica FSC147]
 gi|194324171|ref|ZP_03057945.1| ribosomal protein L28 [Francisella tularensis subsp. novicida
          FTE]
 gi|208780396|ref|ZP_03247737.1| ribosomal protein L28 [Francisella novicida FTG]
 gi|224457816|ref|ZP_03666289.1| 50S ribosomal protein L28 [Francisella tularensis subsp.
          tularensis MA00-2987]
 gi|254367287|ref|ZP_04983314.1| 50S ribosomal protein L28 [Francisella tularensis subsp.
          holarctica 257]
 gi|254368763|ref|ZP_04984776.1| 50S ribosomal protein L28 [Francisella tularensis subsp.
          holarctica FSC022]
 gi|254371256|ref|ZP_04987258.1| 50S ribosomal protein L28 [Francisella tularensis subsp.
          tularensis FSC033]
 gi|254372313|ref|ZP_04987804.1| 50S ribosomal protein L28 [Francisella tularensis subsp. novicida
          GA99-3549]
 gi|254373787|ref|ZP_04989270.1| ribosomal protein L28 [Francisella novicida GA99-3548]
 gi|254875487|ref|ZP_05248197.1| 50S ribosomal protein L28 [Francisella tularensis subsp.
          tularensis MA00-2987]
 gi|290953710|ref|ZP_06558331.1| 50S ribosomal protein L28 [Francisella tularensis subsp.
          holarctica URFT1]
 gi|295312945|ref|ZP_06803664.1| 50S ribosomal protein L28 [Francisella tularensis subsp.
          holarctica URFT1]
 gi|67461296|sp|Q5NEM3|RL28_FRATT RecName: Full=50S ribosomal protein L28
 gi|122325562|sp|Q0BN37|RL28_FRATO RecName: Full=50S ribosomal protein L28
 gi|122501078|sp|Q2A4R1|RL28_FRATH RecName: Full=50S ribosomal protein L28
 gi|123063365|sp|Q14G26|RL28_FRAT1 RecName: Full=50S ribosomal protein L28
 gi|166226572|sp|A7NAM4|RL28_FRATF RecName: Full=50S ribosomal protein L28
 gi|166226573|sp|A0Q4S4|RL28_FRATN RecName: Full=50S ribosomal protein L28
 gi|166226574|sp|A4IWH7|RL28_FRATW RecName: Full=50S ribosomal protein L28
 gi|226694923|sp|B2SFK9|RL28_FRATM RecName: Full=50S ribosomal protein L28
 gi|56605115|emb|CAG46236.1| 50S ribosomal protein L28 [Francisella tularensis subsp.
          tularensis SCHU S4]
 gi|89143760|emb|CAJ78962.1| 50S ribosomal protein L28 [Francisella tularensis subsp.
          holarctica LVS]
 gi|110321427|emb|CAL09619.1| 50S ribosomal protein L28 [Francisella tularensis subsp.
          tularensis FSC198]
 gi|115129310|gb|ABI82497.1| ribosomal protein L28 [Francisella tularensis subsp. holarctica
          OSU18]
 gi|118422849|gb|ABK89239.1| 50S ribosomal protein L28 [Francisella novicida U112]
 gi|134049208|gb|ABO46279.1| ribosomal protein L28 [Francisella tularensis subsp. tularensis
          WY96-3418]
 gi|134253104|gb|EBA52198.1| 50S ribosomal protein L28 [Francisella tularensis subsp.
          holarctica 257]
 gi|151569496|gb|EDN35150.1| 50S ribosomal protein L28 [Francisella tularensis subsp.
          tularensis FSC033]
 gi|151570042|gb|EDN35696.1| 50S ribosomal protein L28 [Francisella novicida GA99-3549]
 gi|151571508|gb|EDN37162.1| ribosomal protein L28 [Francisella novicida GA99-3548]
 gi|156252521|gb|ABU61027.1| ribosomal protein L28 [Francisella tularensis subsp. holarctica
          FTNF002-00]
 gi|157121684|gb|EDO65854.1| 50S ribosomal protein L28 [Francisella tularensis subsp.
          holarctica FSC022]
 gi|187712065|gb|ACD30362.1| 50S ribosomal protein L28 [Francisella tularensis subsp.
          mediasiatica FSC147]
 gi|194321618|gb|EDX19102.1| ribosomal protein L28 [Francisella tularensis subsp. novicida
          FTE]
 gi|208743764|gb|EDZ90067.1| ribosomal protein L28 [Francisella novicida FTG]
 gi|254841486|gb|EET19922.1| 50S ribosomal protein L28 [Francisella tularensis subsp.
          tularensis MA00-2987]
 gi|282159860|gb|ADA79251.1| 50S ribosomal protein L28 [Francisella tularensis subsp.
          tularensis NE061598]
 gi|328676415|gb|AEB27285.1| LSU ribosomal protein L28p [Francisella cf. novicida Fx1]
          Length = 78

 Score = 57.4 bits (137), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 45/71 (63%), Gaps = 1/71 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS+VC +T K   +GN VSHA NKT+RRFLPNL       +   +  +LR+S   +R ++
Sbjct: 1  MSKVCIVTGKRPATGNNVSHAQNKTKRRFLPNLHAHRFWVESENRYIKLRVSSKGMRIID 60

Query: 61 RQGGLDRFLSN 71
          ++ G+D  LS+
Sbjct: 61 KK-GIDTVLSD 70


>gi|126661955|ref|ZP_01732954.1| 50S ribosomal protein L28 [Flavobacteria bacterium BAL38]
 gi|126625334|gb|EAZ96023.1| 50S ribosomal protein L28 [Flavobacteria bacterium BAL38]
          Length = 80

 Score = 57.4 bits (137), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 44/73 (60%), Gaps = 1/73 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVCELT K  M GN VSHA NKT+R+F  NL +        ++   L+IS  AL+++ 
Sbjct: 1  MSRVCELTGKRAMVGNNVSHAMNKTKRKFSVNLVKKRFYIPEEDRWVTLKISTAALKTIN 60

Query: 61 RQGGLDRFLSNSK 73
          +  G+   L N+K
Sbjct: 61 KN-GIAAVLKNAK 72


>gi|331005612|ref|ZP_08328982.1| LSU ribosomal protein L28p [gamma proteobacterium IMCC1989]
 gi|330420585|gb|EGG94881.1| LSU ribosomal protein L28p [gamma proteobacterium IMCC1989]
          Length = 78

 Score = 57.4 bits (137), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 27/63 (42%), Positives = 42/63 (66%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  ++GN VSHA N T+RRFLPNL       +  ++  +LR+S   +R ++
Sbjct: 1  MSRVCQVTGKRPVTGNNVSHAKNHTKRRFLPNLHSHRFWVESEKRFVKLRVSTKGMRIID 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|167622370|ref|YP_001672664.1| 50S ribosomal protein L28 [Shewanella halifaxensis HAW-EB4]
 gi|189029454|sp|B0TQL2|RL28_SHEHH RecName: Full=50S ribosomal protein L28
 gi|167352392|gb|ABZ75005.1| ribosomal protein L28 [Shewanella halifaxensis HAW-EB4]
          Length = 78

 Score = 57.0 bits (136), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 30/63 (47%), Positives = 40/63 (63%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  M GN  SHA N TRRRFLPNL       +  ++  QLRIS   +R ++
Sbjct: 1  MSRVCQVTGKRPMVGNNRSHAKNATRRRFLPNLQNHRFWLENEKRFVQLRISTKGMRIID 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|157963647|ref|YP_001503681.1| 50S ribosomal protein L28 [Shewanella pealeana ATCC 700345]
 gi|189029455|sp|A8H9A9|RL28_SHEPA RecName: Full=50S ribosomal protein L28
 gi|157848647|gb|ABV89146.1| ribosomal protein L28 [Shewanella pealeana ATCC 700345]
          Length = 78

 Score = 57.0 bits (136), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 30/63 (47%), Positives = 40/63 (63%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  M GN  SHA N TRRRFLPNL       +  ++  QLRIS   +R ++
Sbjct: 1  MSRVCQVTGKRPMVGNNRSHAKNSTRRRFLPNLQNHRFWLENEKRFVQLRISTKGMRIID 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|238898969|ref|YP_002924651.1| 50S ribosomal subunit protein L28 [Candidatus Hamiltonella
          defensa 5AT (Acyrthosiphon pisum)]
 gi|259646741|sp|C4K7G0|RL28_HAMD5 RecName: Full=50S ribosomal protein L28
 gi|229466729|gb|ACQ68503.1| 50S ribosomal subunit protein L28 [Candidatus Hamiltonella
          defensa 5AT (Acyrthosiphon pisum)]
          Length = 78

 Score = 57.0 bits (136), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 43/63 (68%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++TKK  ++GN+ SHA N T+RRFLPNL R     +  ++   LR+S   +R ++
Sbjct: 1  MSRVCQVTKKRPVTGNRRSHAMNATKRRFLPNLHRHRFWIESEKRFITLRLSAKGIRIID 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|149376402|ref|ZP_01894164.1| 50S ribosomal protein L28 [Marinobacter algicola DG893]
 gi|149359243|gb|EDM47705.1| 50S ribosomal protein L28 [Marinobacter algicola DG893]
          Length = 78

 Score = 57.0 bits (136), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 47/71 (66%), Gaps = 1/71 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  ++GN VSHA N +RRRFLPNL       +  ++  +LR+S   +R ++
Sbjct: 1  MSRVCQVTGKRPVTGNNVSHAMNHSRRRFLPNLQNHRFWVESEKRFVRLRVSTKGMRVID 60

Query: 61 RQGGLDRFLSN 71
          ++ G+D  L++
Sbjct: 61 KK-GIDAVLAD 70


>gi|114564977|ref|YP_752491.1| ribosomal protein L28 [Shewanella frigidimarina NCIMB 400]
 gi|122298393|sp|Q07WG2|RL28_SHEFN RecName: Full=50S ribosomal protein L28
 gi|114336270|gb|ABI73652.1| LSU ribosomal protein L28P [Shewanella frigidimarina NCIMB 400]
          Length = 78

 Score = 57.0 bits (136), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 40/63 (63%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  M GN  SHA N TRRRFLPNL       +  ++  QLR+S   +R ++
Sbjct: 1  MSRVCQVTGKKPMVGNNRSHAKNSTRRRFLPNLQNHRFWLEEEKRFVQLRVSTKGIRIID 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|24375731|ref|NP_719774.1| ribosomal protein L28 [Shewanella oneidensis MR-1]
 gi|113971924|ref|YP_735717.1| 50S ribosomal protein L28 [Shewanella sp. MR-4]
 gi|114045870|ref|YP_736420.1| 50S ribosomal protein L28 [Shewanella sp. MR-7]
 gi|117922201|ref|YP_871393.1| 50S ribosomal protein L28 [Shewanella sp. ANA-3]
 gi|120597170|ref|YP_961744.1| 50S ribosomal protein L28 [Shewanella sp. W3-18-1]
 gi|126172630|ref|YP_001048779.1| 50S ribosomal protein L28 [Shewanella baltica OS155]
 gi|146291570|ref|YP_001181994.1| 50S ribosomal protein L28 [Shewanella putrefaciens CN-32]
 gi|152998928|ref|YP_001364609.1| 50S ribosomal protein L28 [Shewanella baltica OS185]
 gi|160873514|ref|YP_001552830.1| 50S ribosomal protein L28 [Shewanella baltica OS195]
 gi|217971609|ref|YP_002356360.1| 50S ribosomal protein L28 [Shewanella baltica OS223]
 gi|304411667|ref|ZP_07393279.1| ribosomal protein L28 [Shewanella baltica OS183]
 gi|307306281|ref|ZP_07586026.1| ribosomal protein L28 [Shewanella baltica BA175]
 gi|67461528|sp|Q8E9M3|RL28_SHEON RecName: Full=50S ribosomal protein L28
 gi|122945022|sp|Q0HZU2|RL28_SHESR RecName: Full=50S ribosomal protein L28
 gi|123130027|sp|Q0HE57|RL28_SHESM RecName: Full=50S ribosomal protein L28
 gi|166226617|sp|A3CZJ7|RL28_SHEB5 RecName: Full=50S ribosomal protein L28
 gi|166226618|sp|A6WIA7|RL28_SHEB8 RecName: Full=50S ribosomal protein L28
 gi|166226620|sp|A4Y2L2|RL28_SHEPC RecName: Full=50S ribosomal protein L28
 gi|166226621|sp|A0L1R8|RL28_SHESA RecName: Full=50S ribosomal protein L28
 gi|166226622|sp|A1REU5|RL28_SHESW RecName: Full=50S ribosomal protein L28
 gi|189029453|sp|A9KY05|RL28_SHEB9 RecName: Full=50S ribosomal protein L28
 gi|254801375|sp|B8E4J6|RL28_SHEB2 RecName: Full=50S ribosomal protein L28
 gi|24350668|gb|AAN57218.1|AE015857_11 ribosomal protein L28 [Shewanella oneidensis MR-1]
 gi|113886608|gb|ABI40660.1| LSU ribosomal protein L28P [Shewanella sp. MR-4]
 gi|113887312|gb|ABI41363.1| LSU ribosomal protein L28P [Shewanella sp. MR-7]
 gi|117614533|gb|ABK49987.1| LSU ribosomal protein L28P [Shewanella sp. ANA-3]
 gi|120557263|gb|ABM23190.1| LSU ribosomal protein L28P [Shewanella sp. W3-18-1]
 gi|125995835|gb|ABN59910.1| LSU ribosomal protein L28P [Shewanella baltica OS155]
 gi|145563260|gb|ABP74195.1| LSU ribosomal protein L28P [Shewanella putrefaciens CN-32]
 gi|151363546|gb|ABS06546.1| ribosomal protein L28 [Shewanella baltica OS185]
 gi|160859036|gb|ABX47570.1| ribosomal protein L28 [Shewanella baltica OS195]
 gi|217496744|gb|ACK44937.1| ribosomal protein L28 [Shewanella baltica OS223]
 gi|304349855|gb|EFM14261.1| ribosomal protein L28 [Shewanella baltica OS183]
 gi|306911154|gb|EFN41581.1| ribosomal protein L28 [Shewanella baltica BA175]
 gi|315265743|gb|ADT92596.1| ribosomal protein L28 [Shewanella baltica OS678]
 gi|319424743|gb|ADV52817.1| ribosomal protein L28 [Shewanella putrefaciens 200]
          Length = 78

 Score = 57.0 bits (136), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 40/63 (63%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  M GN  SHA N TRRRFLPNL       +  ++  QLR+S   +R ++
Sbjct: 1  MSRVCQVTGKKPMVGNNRSHAKNATRRRFLPNLQNHRFWLEEEKRFVQLRVSTKGIRLID 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|269468151|gb|EEZ79855.1| ribosomal protein L28 [uncultured SUP05 cluster bacterium]
 gi|269468485|gb|EEZ80146.1| ribosomal protein L28 [uncultured SUP05 cluster bacterium]
          Length = 78

 Score = 57.0 bits (136), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 46/70 (65%), Gaps = 1/70 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+++C++T K  +SGN VSHANN+TRRRF PNL       +   +  +L+++   LR V+
Sbjct: 1  MAKICQVTGKRPISGNNVSHANNRTRRRFYPNLHTHRFWVESENRFVKLKLTAKGLRIVD 60

Query: 61 RQGGLDRFLS 70
          ++ G+D  L+
Sbjct: 61 KK-GIDTVLA 69


>gi|212635016|ref|YP_002311541.1| 50S ribosomal protein L28 [Shewanella piezotolerans WP3]
 gi|226699164|sp|B8CM30|RL28_SHEPW RecName: Full=50S ribosomal protein L28
 gi|212556500|gb|ACJ28954.1| Ribosomal protein L28 [Shewanella piezotolerans WP3]
          Length = 78

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 40/63 (63%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  M GN  SHA N TRRRFLPNL       +  ++  +LRIS   +R ++
Sbjct: 1  MSRVCQVTGKKPMVGNNRSHAKNATRRRFLPNLQNHRFWLETEKRFVKLRISTKGMRIID 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|86131782|ref|ZP_01050379.1| 50S ribosomal protein L28 [Dokdonia donghaensis MED134]
 gi|85817604|gb|EAQ38778.1| 50S ribosomal protein L28 [Dokdonia donghaensis MED134]
          Length = 79

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 40/63 (63%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVCELT K  M GN VSHA NKT+R+F  NL +        ++   L++S  AL+++ 
Sbjct: 1  MSRVCELTGKKAMVGNNVSHAMNKTKRKFNVNLMKKRFYLPAEDKWITLKVSASALKNIN 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|90408983|ref|ZP_01217114.1| ribosomal protein L28 [Psychromonas sp. CNPT3]
 gi|90309897|gb|EAS38051.1| ribosomal protein L28 [Psychromonas sp. CNPT3]
          Length = 73

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 46/71 (64%), Gaps = 1/71 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K   +GN VSHA N+TRRRFLPNL       +   +  +LR++   +R ++
Sbjct: 1  MSRVCQVTGKRPATGNNVSHAKNRTRRRFLPNLQSHRFWVESENRFVKLRLTTKGMRIID 60

Query: 61 RQGGLDRFLSN 71
          ++ G+D  L++
Sbjct: 61 KK-GIDTVLAD 70


>gi|149371253|ref|ZP_01890739.1| 50S ribosomal protein L28 [unidentified eubacterium SCB49]
 gi|149355391|gb|EDM43950.1| 50S ribosomal protein L28 [unidentified eubacterium SCB49]
          Length = 79

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 40/63 (63%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVCELT K  M GN VSHA NKT+R+F  NL +        ++   LR+S  AL+++ 
Sbjct: 1  MSRVCELTGKKAMVGNNVSHAMNKTKRKFNVNLMKKRFYIPEEDKWITLRVSTSALKNIN 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|154173798|ref|YP_001408511.1| 50S ribosomal protein L28 [Campylobacter curvus 525.92]
 gi|166226556|sp|A7GZ69|RL28_CAMC5 RecName: Full=50S ribosomal protein L28
 gi|112803079|gb|EAU00423.1| ribosomal protein L28 [Campylobacter curvus 525.92]
          Length = 63

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 44/64 (68%), Gaps = 5/64 (7%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNL--CRITLISDIMEQKYQLRISKCALRS 58
          MSR C +T K  M GN VSHANNKT+RRFLPNL   R+TL  D   +K  ++++   LR+
Sbjct: 1  MSRRCAITGKGPMVGNNVSHANNKTKRRFLPNLRTIRVTL-EDGTTRK--IKVAASTLRT 57

Query: 59 VERQ 62
          +++Q
Sbjct: 58 MKKQ 61


>gi|163755937|ref|ZP_02163054.1| 50S ribosomal protein L28 [Kordia algicida OT-1]
 gi|161324108|gb|EDP95440.1| 50S ribosomal protein L28 [Kordia algicida OT-1]
          Length = 78

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 27/63 (42%), Positives = 40/63 (63%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR+CELT K  M GN VSHA NKT+R+F  NL +        ++   L++S  AL+++ 
Sbjct: 1  MSRICELTGKKAMVGNNVSHAMNKTKRKFNANLTKKRFYIPEEDKWVTLKVSTSALKTIN 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|146329689|ref|YP_001208992.1| 50S ribosomal protein L28 [Dichelobacter nodosus VCS1703A]
 gi|166226570|sp|A5EWV8|RL28_DICNV RecName: Full=50S ribosomal protein L28
 gi|146233159|gb|ABQ14137.1| 50S ribosomal protein L28 [Dichelobacter nodosus VCS1703A]
          Length = 78

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 43/70 (61%), Gaps = 1/70 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR+C++T K  M GN VSHANNK +RRFLPN+           +   L++S   +R ++
Sbjct: 1  MSRICQVTGKKPMVGNTVSHANNKGKRRFLPNIQEHRFWVQSENRFITLKVSAHGMRIID 60

Query: 61 RQGGLDRFLS 70
          ++ G+D  L+
Sbjct: 61 KK-GIDAVLA 69


>gi|332291042|ref|YP_004429651.1| ribosomal protein L28 [Krokinobacter diaphorus 4H-3-7-5]
 gi|332169128|gb|AEE18383.1| ribosomal protein L28 [Krokinobacter diaphorus 4H-3-7-5]
          Length = 79

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 40/63 (63%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVCELT K  M GN VSHA NKT+R+F  NL +        ++   L++S  AL+++ 
Sbjct: 1  MSRVCELTGKKAMVGNNVSHAMNKTKRKFNVNLMKKRFYLPAEDKWITLKVSTSALKNIN 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|284008823|emb|CBA75592.1| 50S ribosomal protein L28 [Arsenophonus nasoniae]
          Length = 78

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 30/70 (42%), Positives = 45/70 (64%), Gaps = 1/70 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  MSGN  SHA N T+RRFLPNL       +  ++  +LR+S   +R ++
Sbjct: 1  MSRVCQVTGKRPMSGNNRSHAMNATKRRFLPNLHSHRFWVESEKRFVKLRVSAKGMRIID 60

Query: 61 RQGGLDRFLS 70
          ++ G+D  L+
Sbjct: 61 KK-GIDAVLA 69


>gi|163787977|ref|ZP_02182423.1| uridine kinase [Flavobacteriales bacterium ALC-1]
 gi|159876297|gb|EDP70355.1| uridine kinase [Flavobacteriales bacterium ALC-1]
          Length = 78

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 39/63 (61%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVCELT K  M GN VSHA NKT+R+F  NL +        ++   L++S  AL+++ 
Sbjct: 1  MSRVCELTGKKAMVGNNVSHAMNKTKRKFNANLVKKRFFIPEEDKWVTLKVSTSALKTIN 60

Query: 61 RQG 63
          + G
Sbjct: 61 KIG 63


>gi|311745778|ref|ZP_07719563.1| ribosomal protein L28 [Algoriphagus sp. PR1]
 gi|126575977|gb|EAZ80255.1| ribosomal protein L28 [Algoriphagus sp. PR1]
          Length = 80

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 40/63 (63%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M++VC++T K    GN VSHANNKT+RRF PNL + T      +    L++   AL+++ 
Sbjct: 1  MAKVCDITGKRPRVGNNVSHANNKTKRRFYPNLHKKTFYVPEEDAWITLKVCTKALKTIN 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|115372990|ref|ZP_01460294.1| ribosomal protein L28 [Stigmatella aurantiaca DW4/3-1]
 gi|310818660|ref|YP_003951018.1| 50S ribosomal protein L28 [Stigmatella aurantiaca DW4/3-1]
 gi|115370068|gb|EAU68999.1| ribosomal protein L28 [Stigmatella aurantiaca DW4/3-1]
 gi|309391732|gb|ADO69191.1| 50S ribosomal protein L28 [Stigmatella aurantiaca DW4/3-1]
          Length = 78

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 30/70 (42%), Positives = 45/70 (64%), Gaps = 1/70 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS+VC++T K  + GN VSH+NNKT+RR LPNL       +   +  +LR+S   +R + 
Sbjct: 1  MSKVCQVTGKRPLVGNNVSHSNNKTKRRSLPNLQWKRFWVEKENRFVRLRVSAHGIRIIN 60

Query: 61 RQGGLDRFLS 70
          +Q G++R LS
Sbjct: 61 KQ-GIERVLS 69


>gi|298209275|ref|YP_003717454.1| ribosomal protein L28 [Croceibacter atlanticus HTCC2559]
 gi|83849202|gb|EAP87071.1| ribosomal protein L28 [Croceibacter atlanticus HTCC2559]
          Length = 79

 Score = 56.2 bits (134), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 40/63 (63%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVCELT K  M GN VSHA NKT+R+F  NL +        ++   L+IS  AL+++ 
Sbjct: 1  MSRVCELTGKRAMVGNNVSHAMNKTKRKFNVNLIKKRFYIPEEDKWMTLKISTSALKTIN 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|332521173|ref|ZP_08397631.1| ribosomal protein L28 [Lacinutrix algicola 5H-3-7-4]
 gi|332043266|gb|EGI79463.1| ribosomal protein L28 [Lacinutrix algicola 5H-3-7-4]
          Length = 78

 Score = 56.2 bits (134), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 39/63 (61%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVCELT K  M GN VSHA NKT+R+F  NL +        ++   L++S  AL+++ 
Sbjct: 1  MSRVCELTGKKAMVGNNVSHAMNKTKRKFNANLIKKRFFLPEEDKWITLKVSTSALKTIN 60

Query: 61 RQG 63
          + G
Sbjct: 61 KIG 63


>gi|170728879|ref|YP_001762905.1| 50S ribosomal protein L28 [Shewanella woodyi ATCC 51908]
 gi|226699165|sp|B1KL04|RL28_SHEWM RecName: Full=50S ribosomal protein L28
 gi|169814226|gb|ACA88810.1| ribosomal protein L28 [Shewanella woodyi ATCC 51908]
          Length = 78

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 40/63 (63%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  M GN  SHA N TRRRFLPNL       +  ++  +LRIS   +R ++
Sbjct: 1  MSRVCQVTGKKPMVGNNRSHAKNATRRRFLPNLQNHRFWLEGEKRFVKLRISTKGMRIID 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|256823437|ref|YP_003147400.1| 50S ribosomal protein L28 [Kangiella koreensis DSM 16069]
 gi|256796976|gb|ACV27632.1| ribosomal protein L28 [Kangiella koreensis DSM 16069]
          Length = 78

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 27/70 (38%), Positives = 47/70 (67%), Gaps = 1/70 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M++VC++T K  ++GN VSHA N+T+RRFLPNL       +  ++  +LR+S   +R ++
Sbjct: 1  MAKVCQVTGKRPVTGNNVSHAKNRTKRRFLPNLHSHRFWVESEKRFVRLRVSAKGMRVID 60

Query: 61 RQGGLDRFLS 70
          ++ G+D  L+
Sbjct: 61 KK-GIDTVLT 69


>gi|91791694|ref|YP_561345.1| ribosomal protein L28 [Shewanella denitrificans OS217]
 gi|91713696|gb|ABE53622.1| LSU ribosomal protein L28P [Shewanella denitrificans OS217]
          Length = 106

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 40/63 (63%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR+C++T K  M GN  SHA N TRRRFLPNL       +  ++  QLR+S   +R ++
Sbjct: 29 MSRICQVTGKKPMVGNNRSHAKNSTRRRFLPNLQNHRFWLEEEKRFVQLRVSTKGIRIID 88

Query: 61 RQG 63
          ++G
Sbjct: 89 KKG 91


>gi|118602956|ref|YP_904171.1| 50S ribosomal protein L28 [Candidatus Ruthia magnifica str. Cm
          (Calyptogena magnifica)]
 gi|166226615|sp|A1AXP3|RL28_RUTMC RecName: Full=50S ribosomal protein L28
 gi|118567895|gb|ABL02700.1| LSU ribosomal protein L28P [Candidatus Ruthia magnifica str. Cm
          (Calyptogena magnifica)]
          Length = 78

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 45/70 (64%), Gaps = 1/70 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M++VC +T K  +SGN VSHANN+TRRRF PNL       +   +  +L++S   LR ++
Sbjct: 1  MAKVCVVTGKRPISGNNVSHANNRTRRRFYPNLHTHRFWVENENRFVKLKLSAKGLRIID 60

Query: 61 RQGGLDRFLS 70
          ++ G+D  L+
Sbjct: 61 KK-GIDTVLA 69


>gi|157373527|ref|YP_001472127.1| ribosomal protein L28 [Shewanella sediminis HAW-EB3]
 gi|189029456|sp|A8FQ76|RL28_SHESH RecName: Full=50S ribosomal protein L28
 gi|157315901|gb|ABV34999.1| ribosomal protein L28 [Shewanella sediminis HAW-EB3]
          Length = 78

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 40/63 (63%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  M GN  SHA N TRRRFLPNL       +  ++  +LRIS   +R ++
Sbjct: 1  MSRVCQVTGKKPMVGNNRSHAKNSTRRRFLPNLQNHRFWLEGEKRFVKLRISTKGMRIID 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|326793824|ref|YP_004311644.1| 50S ribosomal protein L28 [Marinomonas mediterranea MMB-1]
 gi|326544588|gb|ADZ89808.1| 50S ribosomal protein L28 [Marinomonas mediterranea MMB-1]
          Length = 78

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 46/71 (64%), Gaps = 1/71 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  ++GN VSH+  +T+RRFLPNL       D   +  ++R+S   +R ++
Sbjct: 1  MSRVCQVTGKRPVTGNNVSHSKRRTKRRFLPNLHWHRFWVDSENRYVRIRVSSKGMRIID 60

Query: 61 RQGGLDRFLSN 71
          ++ G+D  L++
Sbjct: 61 KK-GIDAVLAD 70


>gi|313206700|ref|YP_004045877.1| LSU ribosomal protein l28p [Riemerella anatipestifer DSM 15868]
 gi|312446016|gb|ADQ82371.1| LSU ribosomal protein L28P [Riemerella anatipestifer DSM 15868]
 gi|315023767|gb|EFT36769.1| LSU ribosomal protein L28p [Riemerella anatipestifer RA-YM]
          Length = 78

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 37/63 (58%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR+C++T K  M GN VSHANNKT+RRF  NL          E+   L++S   LR + 
Sbjct: 1  MSRICQITGKRAMVGNHVSHANNKTKRRFEINLLEKKFYLPEQEKHITLKVSAHGLRVIN 60

Query: 61 RQG 63
          + G
Sbjct: 61 KIG 63


>gi|255536299|ref|YP_003096670.1| LSU ribosomal protein L28p [Flavobacteriaceae bacterium 3519-10]
 gi|255342495|gb|ACU08608.1| LSU ribosomal protein L28p [Flavobacteriaceae bacterium 3519-10]
          Length = 95

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 37/63 (58%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR+C++T K  M GN VSHANNKT+RRF  NL          E+   L++S   LR + 
Sbjct: 15 MSRICQITGKRAMVGNNVSHANNKTKRRFEINLLEKKFYLPEQEKSVTLKVSAHGLRIIN 74

Query: 61 RQG 63
          + G
Sbjct: 75 KVG 77


>gi|45439916|ref|NP_991455.1| 50S ribosomal protein L28 [Yersinia pestis biovar Microtus str.
          91001]
 gi|51594405|ref|YP_068596.1| 50S ribosomal protein L28 [Yersinia pseudotuberculosis IP 32953]
 gi|108809483|ref|YP_653399.1| 50S ribosomal protein L28 [Yersinia pestis Antiqua]
 gi|108813960|ref|YP_649727.1| 50S ribosomal protein L28 [Yersinia pestis Nepal516]
 gi|145601095|ref|YP_001165171.1| 50S ribosomal protein L28 [Yersinia pestis Pestoides F]
 gi|150260886|ref|ZP_01917614.1| 50S ribosomal protein L28 [Yersinia pestis CA88-4125]
 gi|153948103|ref|YP_001399063.1| 50S ribosomal protein L28 [Yersinia pseudotuberculosis IP 31758]
 gi|162421887|ref|YP_001604696.1| 50S ribosomal protein L28 [Yersinia pestis Angola]
 gi|165926158|ref|ZP_02221990.1| ribosomal protein L28 [Yersinia pestis biovar Orientalis str.
          F1991016]
 gi|165936126|ref|ZP_02224695.1| ribosomal protein L28 [Yersinia pestis biovar Orientalis str.
          IP275]
 gi|166011434|ref|ZP_02232332.1| ribosomal protein L28 [Yersinia pestis biovar Antiqua str.
          E1979001]
 gi|166213673|ref|ZP_02239708.1| ribosomal protein L28 [Yersinia pestis biovar Antiqua str.
          B42003004]
 gi|167402130|ref|ZP_02307607.1| ribosomal protein L28 [Yersinia pestis biovar Antiqua str.
          UG05-0454]
 gi|167419031|ref|ZP_02310784.1| ribosomal protein L28 [Yersinia pestis biovar Orientalis str.
          MG05-1020]
 gi|167426680|ref|ZP_02318433.1| ribosomal protein L28 [Yersinia pestis biovar Mediaevalis str.
          K1973002]
 gi|170026361|ref|YP_001722866.1| 50S ribosomal protein L28 [Yersinia pseudotuberculosis YPIII]
 gi|186893393|ref|YP_001870505.1| 50S ribosomal protein L28 [Yersinia pseudotuberculosis PB1/+]
 gi|218927271|ref|YP_002345146.1| 50S ribosomal protein L28 [Yersinia pestis CO92]
 gi|229836163|ref|ZP_04456331.1| 50S ribosomal subunit protein L28 [Yersinia pestis Pestoides A]
 gi|229839899|ref|ZP_04460058.1| 50S ribosomal subunit protein L28 [Yersinia pestis biovar
          Orientalis str. PEXU2]
 gi|229841981|ref|ZP_04462136.1| 50S ribosomal subunit protein L28 [Yersinia pestis biovar
          Orientalis str. India 195]
 gi|229904490|ref|ZP_04519601.1| 50S ribosomal subunit protein L28 [Yersinia pestis Nepal516]
 gi|270488489|ref|ZP_06205563.1| ribosomal protein L28 [Yersinia pestis KIM D27]
 gi|20139509|sp|Q8ZJP2|RL28_YERPE RecName: Full=50S ribosomal protein L28
 gi|67461380|sp|Q66GD5|RL28_YERPS RecName: Full=50S ribosomal protein L28
 gi|122382630|sp|Q1C268|RL28_YERPA RecName: Full=50S ribosomal protein L28
 gi|122384027|sp|Q1CD03|RL28_YERPN RecName: Full=50S ribosomal protein L28
 gi|166228174|sp|A4TSD6|RL28_YERPP RecName: Full=50S ribosomal protein L28
 gi|166987918|sp|A7FCT5|RL28_YERP3 RecName: Full=50S ribosomal protein L28
 gi|226699188|sp|B2JYN4|RL28_YERPB RecName: Full=50S ribosomal protein L28
 gi|226699189|sp|A9R675|RL28_YERPG RecName: Full=50S ribosomal protein L28
 gi|226699190|sp|B1JQX2|RL28_YERPY RecName: Full=50S ribosomal protein L28
 gi|45434771|gb|AAS60332.1| 50S ribosomal protein L28 [Yersinia pestis biovar Microtus str.
          91001]
 gi|51587687|emb|CAH19287.1| 50S ribosomal protein L28 [Yersinia pseudotuberculosis IP 32953]
 gi|108777608|gb|ABG20127.1| LSU ribosomal protein L28P [Yersinia pestis Nepal516]
 gi|108781396|gb|ABG15454.1| LSU ribosomal protein L28P [Yersinia pestis Antiqua]
 gi|115345882|emb|CAL18740.1| 50S ribosomal protein L28 [Yersinia pestis CO92]
 gi|145212791|gb|ABP42198.1| LSU ribosomal protein L28P [Yersinia pestis Pestoides F]
 gi|149290294|gb|EDM40371.1| 50S ribosomal protein L28 [Yersinia pestis CA88-4125]
 gi|152959598|gb|ABS47059.1| ribosomal protein L28 [Yersinia pseudotuberculosis IP 31758]
 gi|162354702|gb|ABX88650.1| ribosomal protein L28 [Yersinia pestis Angola]
 gi|165915740|gb|EDR34348.1| ribosomal protein L28 [Yersinia pestis biovar Orientalis str.
          IP275]
 gi|165922018|gb|EDR39195.1| ribosomal protein L28 [Yersinia pestis biovar Orientalis str.
          F1991016]
 gi|165989580|gb|EDR41881.1| ribosomal protein L28 [Yersinia pestis biovar Antiqua str.
          E1979001]
 gi|166205075|gb|EDR49555.1| ribosomal protein L28 [Yersinia pestis biovar Antiqua str.
          B42003004]
 gi|166963025|gb|EDR59046.1| ribosomal protein L28 [Yersinia pestis biovar Orientalis str.
          MG05-1020]
 gi|167048505|gb|EDR59913.1| ribosomal protein L28 [Yersinia pestis biovar Antiqua str.
          UG05-0454]
 gi|167054369|gb|EDR64186.1| ribosomal protein L28 [Yersinia pestis biovar Mediaevalis str.
          K1973002]
 gi|169752895|gb|ACA70413.1| ribosomal protein L28 [Yersinia pseudotuberculosis YPIII]
 gi|186696419|gb|ACC87048.1| ribosomal protein L28 [Yersinia pseudotuberculosis PB1/+]
 gi|229678608|gb|EEO74713.1| 50S ribosomal subunit protein L28 [Yersinia pestis Nepal516]
 gi|229690291|gb|EEO82345.1| 50S ribosomal subunit protein L28 [Yersinia pestis biovar
          Orientalis str. India 195]
 gi|229696265|gb|EEO86312.1| 50S ribosomal subunit protein L28 [Yersinia pestis biovar
          Orientalis str. PEXU2]
 gi|229706611|gb|EEO92617.1| 50S ribosomal subunit protein L28 [Yersinia pestis Pestoides A]
 gi|270336993|gb|EFA47770.1| ribosomal protein L28 [Yersinia pestis KIM D27]
 gi|320013404|gb|ADV96975.1| 50S ribosomal subunit protein L28 [Yersinia pestis biovar
          Medievalis str. Harbin 35]
          Length = 78

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 40/63 (63%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  MSGN  SHA N T+RRFLPNL       +  ++   LR+S   +R ++
Sbjct: 1  MSRVCQVTGKRPMSGNNRSHAMNATKRRFLPNLHSHRFWVEGEKRFVTLRVSAKGMRVID 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|294142829|ref|YP_003558807.1| 50S ribosomal protein L28 [Shewanella violacea DSS12]
 gi|293329298|dbj|BAJ04029.1| ribosomal protein L28 [Shewanella violacea DSS12]
          Length = 78

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 40/63 (63%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  M GN  SHA N TRRRFLPNL       +  ++  +LRIS   +R ++
Sbjct: 1  MSRVCQVTGKRPMVGNNRSHAKNATRRRFLPNLQNHRFWLEGEKRFVKLRISTKGIRIID 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|40062599|gb|AAR37528.1| ribosomal protein L28 [uncultured marine bacterium 311]
          Length = 78

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 27/70 (38%), Positives = 45/70 (64%), Gaps = 1/70 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M++VC++T K  + GNKVSHA N+TRR F PNL +     +  ++   L +S   +R ++
Sbjct: 1  MAKVCQVTGKKPLKGNKVSHAKNRTRRTFEPNLHKHKFWIESEKRHVSLTVSAKGMRIID 60

Query: 61 RQGGLDRFLS 70
          ++ G+D+ LS
Sbjct: 61 KK-GIDKVLS 69


>gi|255037319|ref|YP_003087940.1| 50S ribosomal protein L28 [Dyadobacter fermentans DSM 18053]
 gi|254950075|gb|ACT94775.1| ribosomal protein L28 [Dyadobacter fermentans DSM 18053]
          Length = 79

 Score = 55.5 bits (132), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 39/63 (61%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M++VC+++ K    GN VSHANNKT+R+F PNL +         +   L+++  ALR++ 
Sbjct: 1  MAKVCQISGKRTRVGNNVSHANNKTKRKFFPNLQKKRFFLPSSGEWVTLKVAASALRTIN 60

Query: 61 RQG 63
          + G
Sbjct: 61 KNG 63


>gi|119943848|ref|YP_941528.1| ribosomal protein L28 [Psychromonas ingrahamii 37]
 gi|166226607|sp|A1SR14|RL28_PSYIN RecName: Full=50S ribosomal protein L28
 gi|119862452|gb|ABM01929.1| LSU ribosomal protein L28P [Psychromonas ingrahamii 37]
          Length = 78

 Score = 55.5 bits (132), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 45/71 (63%), Gaps = 1/71 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K    GN VSHA N+TRRRFLPNL       +   +  +LR++   +R ++
Sbjct: 1  MSRVCQVTGKRPAVGNNVSHAKNRTRRRFLPNLQTHRFWVESENRFVKLRLTTKGMRIID 60

Query: 61 RQGGLDRFLSN 71
          ++ G+D  L++
Sbjct: 61 KK-GIDSVLTD 70


>gi|261749205|ref|YP_003256890.1| 50S ribosomal protein L28 [Blattabacterium sp. (Periplaneta
          americana) str. BPLAN]
 gi|261497297|gb|ACX83747.1| 50S ribosomal protein L28 [Blattabacterium sp. (Periplaneta
          americana) str. BPLAN]
          Length = 75

 Score = 55.5 bits (132), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 31/71 (43%), Positives = 42/71 (59%), Gaps = 3/71 (4%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS+VCELT K  M GN+VSHANNK +RRF  NLC+        ++   L+I   A++ + 
Sbjct: 1  MSKVCELTGKRAMIGNRVSHANNKNKRRFNINLCKKRFFLTKEKKWITLKICTSAIKLIN 60

Query: 61 RQG---GLDRF 68
          + G    L RF
Sbjct: 61 KIGIEKALKRF 71


>gi|45198359|ref|NP_985388.1| AFL162Cp [Ashbya gossypii ATCC 10895]
 gi|44984246|gb|AAS53212.1| AFL162Cp [Ashbya gossypii ATCC 10895]
          Length = 261

 Score = 55.5 bits (132), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 48/73 (65%), Gaps = 4/73 (5%)

Query: 12  VMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFLSN 71
           +  GN +S +  KTRR +LPN+ R +L S+ +++  +++++   LR++ ++GGLD +L+ 
Sbjct: 82  IQFGNNISESKTKTRRTWLPNIVRKSLWSEALQKDVRIKLTAKVLRTISKEGGLDNYLTK 141

Query: 72  SKKENLSARMRTL 84
            K    SAR++ L
Sbjct: 142 DK----SARIKEL 150


>gi|319760721|ref|YP_004124659.1| 50S ribosomal protein L28 [Candidatus Blochmannia vafer str.
          BVAF]
 gi|318039435|gb|ADV33985.1| 50S ribosomal protein L28 [Candidatus Blochmannia vafer str.
          BVAF]
          Length = 82

 Score = 55.5 bits (132), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 29/77 (37%), Positives = 49/77 (63%), Gaps = 1/77 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR+C +T K  ++GNK SH+ N T+R F+PN+    +  D  ++   +RIS   LR ++
Sbjct: 1  MSRICRITGKRPINGNKRSHSMNATKRWFIPNIHYHRIWIDSKKKFCSIRISAKGLRFID 60

Query: 61 RQGGLDRFLSNSKKENL 77
          +  G+D++LSN   +N+
Sbjct: 61 KL-GIDQYLSNLSSKNI 76


>gi|253991843|ref|YP_003043199.1| 50S ribosomal protein L28 [Photorhabdus asymbiotica subsp.
          asymbiotica ATCC 43949]
 gi|268593308|ref|ZP_06127529.1| ribosomal protein L28 [Providencia rettgeri DSM 1131]
 gi|253783293|emb|CAQ86458.1| 50s ribosomal protein l28 [Photorhabdus asymbiotica]
 gi|291311005|gb|EFE51458.1| ribosomal protein L28 [Providencia rettgeri DSM 1131]
          Length = 78

 Score = 55.5 bits (132), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 30/70 (42%), Positives = 44/70 (62%), Gaps = 1/70 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  MSGN  SHA N T+RRFLPNL       +  ++   LR+S   +R ++
Sbjct: 1  MSRVCQVTGKRPMSGNNRSHALNATKRRFLPNLHSHRFWVESEKRFVTLRVSAKGMRVID 60

Query: 61 RQGGLDRFLS 70
          ++ G+D  L+
Sbjct: 61 KK-GIDAVLA 69


>gi|301166341|emb|CBW25917.1| 50S ribosomal protein L28 [Bacteriovorax marinus SJ]
          Length = 76

 Score = 55.5 bits (132), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 44/73 (60%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVC+LT K  + GNKVSHA N+T+    PNL    +      Q  +LR+S  A+R+++
Sbjct: 1  MARVCDLTGKRRLVGNKVSHAKNRTKMTQKPNLQTKRVFDPESGQTIKLRLSTSAIRTLD 60

Query: 61 RQGGLDRFLSNSK 73
          + G L +FL   K
Sbjct: 61 KVGSLSKFLKKYK 73


>gi|156844322|ref|XP_001645224.1| hypothetical protein Kpol_1060p22 [Vanderwaltozyma polyspora DSM
           70294]
 gi|156115883|gb|EDO17366.1| hypothetical protein Kpol_1060p22 [Vanderwaltozyma polyspora DSM
           70294]
          Length = 256

 Score = 55.5 bits (132), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 26/73 (35%), Positives = 46/73 (63%), Gaps = 4/73 (5%)

Query: 12  VMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFLSN 71
           +  GN +S + +KTRR +LPN+ +  L S+ + +K  L+++   LR++ ++GGLD +L  
Sbjct: 78  IQHGNTISESKHKTRRTWLPNIVKKALWSETLNKKVSLKMTTKVLRTISKEGGLDNYLIK 137

Query: 72  SKKENLSARMRTL 84
            K    SAR++ L
Sbjct: 138 EK----SARIKEL 146


>gi|223041138|ref|ZP_03611392.1| ribosomal protein L28 [Campylobacter rectus RM3267]
 gi|222877574|gb|EEF12701.1| ribosomal protein L28 [Campylobacter rectus RM3267]
          Length = 63

 Score = 55.5 bits (132), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 43/64 (67%), Gaps = 5/64 (7%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNL--CRITLISDIMEQKYQLRISKCALRS 58
          MSRVC +T K  M GN VSHA N+T+RRFLPNL   R+TL  D   +K  ++++   LR+
Sbjct: 1  MSRVCAITGKGPMVGNNVSHAKNRTKRRFLPNLRTIRVTL-EDGTTRK--IKVAASTLRT 57

Query: 59 VERQ 62
          + +Q
Sbjct: 58 MRKQ 61


>gi|269215114|ref|ZP_05987771.2| ribosomal protein L28 [Neisseria lactamica ATCC 23970]
 gi|288576203|ref|ZP_05978387.2| ribosomal protein L28 [Neisseria mucosa ATCC 25996]
 gi|304386501|ref|ZP_07368789.1| 50S ribosomal protein L28 [Neisseria meningitidis ATCC 13091]
 gi|269208287|gb|EEZ74742.1| ribosomal protein L28 [Neisseria lactamica ATCC 23970]
 gi|288566043|gb|EFC87603.1| ribosomal protein L28 [Neisseria mucosa ATCC 25996]
 gi|304339330|gb|EFM05402.1| 50S ribosomal protein L28 [Neisseria meningitidis ATCC 13091]
          Length = 65

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 26/51 (50%), Positives = 35/51 (68%)

Query: 13 MSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQG 63
          MSGN VSHANNKT+RRFLPNL       +   +  +LR+S  ALR++++ G
Sbjct: 1  MSGNNVSHANNKTKRRFLPNLQSRRFWVESENRWVRLRVSNAALRTIDKVG 51


>gi|254427932|ref|ZP_05041639.1| ribosomal protein L28 [Alcanivorax sp. DG881]
 gi|196194101|gb|EDX89060.1| ribosomal protein L28 [Alcanivorax sp. DG881]
          Length = 78

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 48/71 (67%), Gaps = 1/71 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS+VC++T K  ++GN+VSH+N KT+RRF PNL       +  ++  +LR+S   +R ++
Sbjct: 1  MSKVCQVTGKRPVTGNRVSHSNIKTKRRFEPNLHHHRFWVESEKRFVRLRVSSKGMRIID 60

Query: 61 RQGGLDRFLSN 71
          ++ G+D  LS+
Sbjct: 61 KK-GIDSVLSD 70


>gi|183597218|ref|ZP_02958711.1| hypothetical protein PROSTU_00460 [Providencia stuartii ATCC
          25827]
 gi|188023531|gb|EDU61571.1| hypothetical protein PROSTU_00460 [Providencia stuartii ATCC
          25827]
          Length = 78

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 30/70 (42%), Positives = 44/70 (62%), Gaps = 1/70 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  MSGN  SHA N T+RRFLPNL       +  ++   LR+S   +R ++
Sbjct: 1  MSRVCQVTGKRPMSGNNRSHALNATKRRFLPNLHSHRFWVESEKRFVTLRVSAKGMRIID 60

Query: 61 RQGGLDRFLS 70
          ++ G+D  L+
Sbjct: 61 KK-GIDAVLA 69


>gi|289209156|ref|YP_003461222.1| ribosomal protein L28 [Thioalkalivibrio sp. K90mix]
 gi|288944787|gb|ADC72486.1| ribosomal protein L28 [Thioalkalivibrio sp. K90mix]
          Length = 78

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 29/73 (39%), Positives = 46/73 (63%), Gaps = 1/73 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVC++T K   +GN VSHA+ KTRRRFLPNL       +   +  +LR+S   +R ++
Sbjct: 1  MARVCQVTGKRPATGNNVSHAHRKTRRRFLPNLHTHRFWVESENRFVRLRVSSKGMRIID 60

Query: 61 RQGGLDRFLSNSK 73
          +  G+D  L++ +
Sbjct: 61 KL-GIDAVLADCR 72


>gi|262273496|ref|ZP_06051310.1| LSU ribosomal protein L28p [Grimontia hollisae CIP 101886]
 gi|262222474|gb|EEY73785.1| LSU ribosomal protein L28p [Grimontia hollisae CIP 101886]
          Length = 78

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 30/79 (37%), Positives = 51/79 (64%), Gaps = 3/79 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  + GN  SHANN T+RRFLPNL       +  ++  +LR++   +R ++
Sbjct: 1  MSRVCQVTGKRPVVGNNRSHANNATKRRFLPNLQTHRFWVESEKRFVKLRLTPKGMRIID 60

Query: 61 RQGGLDRFLSN--SKKENL 77
          ++ G+D  L++  ++ EN+
Sbjct: 61 KK-GIDAVLADIRARGENV 78


>gi|299136010|ref|ZP_07029194.1| ribosomal protein L28 [Acidobacterium sp. MP5ACTX8]
 gi|298602134|gb|EFI58288.1| ribosomal protein L28 [Acidobacterium sp. MP5ACTX8]
          Length = 75

 Score = 55.1 bits (131), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 45/65 (69%), Gaps = 4/65 (6%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLC--RITLISDIMEQKYQLRISKCALRS 58
          M++VC +T K  ++GN VSHANNKTRRR+ PNL   RI + S+   +  ++R+S   +R+
Sbjct: 1  MAKVCPITGKRTVTGNNVSHANNKTRRRWEPNLQLKRIWIPSE--NRFVRMRVSARGIRT 58

Query: 59 VERQG 63
          +++ G
Sbjct: 59 IQKLG 63


>gi|188579179|ref|YP_001916108.1| ribosomal protein L28 [Xanthomonas oryzae pv. oryzae PXO99A]
 gi|188523631|gb|ACD61576.1| ribosomal protein L28 [Xanthomonas oryzae pv. oryzae PXO99A]
          Length = 72

 Score = 55.1 bits (131), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 26/57 (45%), Positives = 37/57 (64%)

Query: 7  LTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQG 63
          ++ K V +GN VSHANN+TRRRFLPNL           +  +LR+S  ALR++++ G
Sbjct: 1  MSGKRVQTGNNVSHANNRTRRRFLPNLHERRFWVASENRWVKLRVSAHALRTIDKNG 57


>gi|32491152|ref|NP_871406.1| hypothetical protein WGLp403 [Wigglesworthia glossinidia
          endosymbiont of Glossina brevipalpis]
 gi|31340353|sp|Q8D2F1|RL28_WIGBR RecName: Full=50S ribosomal protein L28
 gi|25166359|dbj|BAC24549.1| rpmB [Wigglesworthia glossinidia endosymbiont of Glossina
          brevipalpis]
          Length = 78

 Score = 55.1 bits (131), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 27/63 (42%), Positives = 39/63 (61%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR+C++T K  +SGNK SH+ N  +R+F PNL       D  ++   LRISK  LR ++
Sbjct: 1  MSRICQITGKKPLSGNKRSHSMNAKKRKFFPNLHNHRFWLDKEKKFINLRISKQGLRLID 60

Query: 61 RQG 63
          + G
Sbjct: 61 KYG 63


>gi|326336203|ref|ZP_08202375.1| 50S ribosomal protein L28 [Capnocytophaga sp. oral taxon 338 str.
          F0234]
 gi|325691712|gb|EGD33679.1| 50S ribosomal protein L28 [Capnocytophaga sp. oral taxon 338 str.
          F0234]
          Length = 100

 Score = 54.7 bits (130), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 29/77 (37%), Positives = 45/77 (58%), Gaps = 1/77 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M++VCELT K  M GN VSHA NKT+R+F  NL          ++   LR+S  A++++ 
Sbjct: 23 MAQVCELTGKKAMGGNNVSHAMNKTKRKFKANLTTKRFYIPEEDRWITLRVSTSAIKTIN 82

Query: 61 RQGGLDRFLSNSKKENL 77
          ++ G+   L  +KK+  
Sbjct: 83 KK-GITAVLKEAKKQGF 98


>gi|157163889|ref|YP_001466762.1| 50S ribosomal protein L28 [Campylobacter concisus 13826]
 gi|166226555|sp|A7ZDA4|RL28_CAMC1 RecName: Full=50S ribosomal protein L28
 gi|112800136|gb|EAT97480.1| ribosomal protein L28 [Campylobacter concisus 13826]
          Length = 63

 Score = 54.7 bits (130), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 42/64 (65%), Gaps = 5/64 (7%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNL--CRITLISDIMEQKYQLRISKCALRS 58
          MS+ C +T K  M GN VSHANNKT+RRFLPNL   R+TL         +++++   LR+
Sbjct: 1  MSKRCAITGKGPMVGNNVSHANNKTKRRFLPNLRTIRVTLEDGTTR---RIKVAASTLRT 57

Query: 59 VERQ 62
          +++Q
Sbjct: 58 MKKQ 61


>gi|308047855|ref|YP_003911421.1| 50S ribosomal protein L28P [Ferrimonas balearica DSM 9799]
 gi|307630045|gb|ADN74347.1| LSU ribosomal protein L28P [Ferrimonas balearica DSM 9799]
          Length = 78

 Score = 54.7 bits (130), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 42/63 (66%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS+VC++T K  ++GN  SHANN T+RRFLPNL       +  ++  +LR+S   +R ++
Sbjct: 1  MSKVCQVTGKRPVTGNNRSHANNATKRRFLPNLQTHRFWVEGEKRFVKLRVSTKGMRIID 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|320539886|ref|ZP_08039545.1| 50S ribosomal subunit protein L28 [Serratia symbiotica str.
          Tucson]
 gi|322835041|ref|YP_004215068.1| ribosomal protein L28 [Rahnella sp. Y9602]
 gi|320030072|gb|EFW12092.1| 50S ribosomal subunit protein L28 [Serratia symbiotica str.
          Tucson]
 gi|321170242|gb|ADW75941.1| ribosomal protein L28 [Rahnella sp. Y9602]
          Length = 78

 Score = 54.7 bits (130), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 27/63 (42%), Positives = 40/63 (63%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  +SGN  SHA N T+RRFLPNL       +  ++   LR+S   +R ++
Sbjct: 1  MSRVCQVTGKRPVSGNNRSHAMNATKRRFLPNLHSHRFWVEAEKRFVTLRVSAKGMRVID 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|297171145|gb|ADI22155.1| hypothetical protein [uncultured gamma proteobacterium
          HF0200_24F15]
          Length = 78

 Score = 54.7 bits (130), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 30/77 (38%), Positives = 46/77 (59%), Gaps = 1/77 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  ++GN VSHANN+ +R F PNL       +   +  +LRIS   LR ++
Sbjct: 1  MSRVCQITGKRSVAGNNVSHANNRNKRLFKPNLHVRKFWVESENRWVRLRISNKGLRIID 60

Query: 61 RQGGLDRFLSNSKKENL 77
          +  G+D  L + +K  +
Sbjct: 61 KN-GIDAVLKDIRKRGI 76


>gi|33520048|ref|NP_878880.1| 50S ribosomal protein L28 [Candidatus Blochmannia floridanus]
 gi|67461506|sp|Q7VRK1|RL28_BLOFL RecName: Full=50S ribosomal protein L28
 gi|33504394|emb|CAD83287.1| 50S ribosomal subunit protein L28 [Candidatus Blochmannia
          floridanus]
          Length = 79

 Score = 54.7 bits (130), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 46/70 (65%), Gaps = 1/70 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR C++T+K  M+GNK SHA N T+R F+PN+       +  ++  +LRIS   +R V+
Sbjct: 1  MSRTCQITRKKPMNGNKRSHAMNATKRWFIPNIHSHRFWIENKKKFIKLRISTKGIRLVD 60

Query: 61 RQGGLDRFLS 70
          +  G+++FLS
Sbjct: 61 KL-GIEQFLS 69


>gi|157373073|ref|YP_001481062.1| 50S ribosomal protein L28 [Serratia proteamaculans 568]
 gi|270265227|ref|ZP_06193489.1| 50S ribosomal protein L28 [Serratia odorifera 4Rx13]
 gi|166987916|sp|A8GLE4|RL28_SERP5 RecName: Full=50S ribosomal protein L28
 gi|157324837|gb|ABV43934.1| ribosomal protein L28 [Serratia proteamaculans 568]
 gi|270040861|gb|EFA13963.1| 50S ribosomal protein L28 [Serratia odorifera 4Rx13]
          Length = 78

 Score = 54.7 bits (130), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 27/63 (42%), Positives = 40/63 (63%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  +SGN  SHA N T+RRFLPNL       +  ++   LR+S   +R ++
Sbjct: 1  MSRVCQVTGKRPVSGNNRSHAMNATKRRFLPNLHSHRFWVEAEKRFVTLRVSAKGMRVID 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|37528673|ref|NP_932018.1| 50S ribosomal protein L28 [Photorhabdus luminescens subsp.
          laumondii TTO1]
 gi|67461490|sp|Q7MY29|RL28_PHOLL RecName: Full=50S ribosomal protein L28
 gi|36788112|emb|CAE17236.1| 50S ribosomal protein L28 [Photorhabdus luminescens subsp.
          laumondii TTO1]
          Length = 78

 Score = 54.7 bits (130), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 30/70 (42%), Positives = 44/70 (62%), Gaps = 1/70 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  MSGN  SHA N T+RRFLPNL       +  ++   LR+S   +R ++
Sbjct: 1  MSRVCQVTGKRPMSGNNRSHALNATKRRFLPNLHSHRFWVESEKRFVTLRVSVKGMRVID 60

Query: 61 RQGGLDRFLS 70
          ++ G+D  L+
Sbjct: 61 KK-GIDAVLA 69


>gi|325955095|ref|YP_004238755.1| 50S ribosomal protein L28 [Weeksella virosa DSM 16922]
 gi|323437713|gb|ADX68177.1| 50S ribosomal protein L28 [Weeksella virosa DSM 16922]
          Length = 78

 Score = 54.7 bits (130), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 29/77 (37%), Positives = 47/77 (61%), Gaps = 1/77 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS++C++T K  + GNKVSHANNKT+R F  NL +        ++   LR+S   L+++ 
Sbjct: 1  MSKICQITGKRRLVGNKVSHANNKTKRTFEVNLFKKRFYLPEADEWITLRVSANGLKTIN 60

Query: 61 RQGGLDRFLSNSKKENL 77
          +  G+D  +  ++KE L
Sbjct: 61 KL-GVDEAVKRARKEGL 76


>gi|238021654|ref|ZP_04602080.1| hypothetical protein GCWU000324_01557 [Kingella oralis ATCC
          51147]
 gi|237866268|gb|EEP67310.1| hypothetical protein GCWU000324_01557 [Kingella oralis ATCC
          51147]
          Length = 66

 Score = 54.3 bits (129), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 40/59 (67%), Gaps = 1/59 (1%)

Query: 13 MSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFLSN 71
          MSGN VSHANNKT+RRFLPNL       +   +  ++R++  ALR++++  G+D  L++
Sbjct: 1  MSGNNVSHANNKTKRRFLPNLQSRRFWVESENRWIRIRVTNAALRTIDKN-GIDAVLAD 58


>gi|92115087|ref|YP_575015.1| 50S ribosomal protein L28P [Chromohalobacter salexigens DSM 3043]
 gi|122419199|sp|Q1QT92|RL28_CHRSD RecName: Full=50S ribosomal protein L28
 gi|91798177|gb|ABE60316.1| LSU ribosomal protein L28P [Chromohalobacter salexigens DSM 3043]
          Length = 78

 Score = 54.3 bits (129), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 28/74 (37%), Positives = 49/74 (66%), Gaps = 1/74 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS+VC++T K  ++GN VSH+  KTRRRF+PNL       +  ++  +LR+S   +R ++
Sbjct: 1  MSQVCQVTGKRPVTGNNVSHSQRKTRRRFVPNLHTHRFWVEGEKRFVKLRVSSKGMRIID 60

Query: 61 RQGGLDRFLSNSKK 74
          ++ G++  LS+ +K
Sbjct: 61 KK-GIEEVLSDIRK 73


>gi|300776246|ref|ZP_07086104.1| 50S ribosomal protein L28 [Chryseobacterium gleum ATCC 35910]
 gi|300501756|gb|EFK32896.1| 50S ribosomal protein L28 [Chryseobacterium gleum ATCC 35910]
          Length = 80

 Score = 54.3 bits (129), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 27/63 (42%), Positives = 37/63 (58%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR+C++T K  M GN VSHANNKT+RRF  NL          ++   L++S   LR + 
Sbjct: 1  MSRICQITGKRAMVGNNVSHANNKTKRRFEINLLEKKFYLPEQDKHVTLKVSAHGLRVIN 60

Query: 61 RQG 63
          + G
Sbjct: 61 KIG 63


>gi|110833076|ref|YP_691935.1| 50S ribosomal protein L28 [Alcanivorax borkumensis SK2]
 gi|123345877|sp|Q0VT57|RL28_ALCBS RecName: Full=50S ribosomal protein L28
 gi|110646187|emb|CAL15663.1| ribosomal protein L28 [Alcanivorax borkumensis SK2]
          Length = 78

 Score = 54.3 bits (129), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 48/71 (67%), Gaps = 1/71 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS+VC++T K  ++GN+VSH+N KT+RRF PNL       +  ++  +LR+S   +R ++
Sbjct: 1  MSKVCQVTGKRPVTGNRVSHSNIKTKRRFEPNLHHHRFWVESEKRFVRLRVSSKGMRIID 60

Query: 61 RQGGLDRFLSN 71
          ++ G+D  L++
Sbjct: 61 KK-GIDSVLAD 70


>gi|255719428|ref|XP_002555994.1| KLTH0H02618p [Lachancea thermotolerans]
 gi|238941960|emb|CAR30132.1| KLTH0H02618p [Lachancea thermotolerans]
          Length = 273

 Score = 54.3 bits (129), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 26/73 (35%), Positives = 46/73 (63%), Gaps = 4/73 (5%)

Query: 12  VMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFLSN 71
           +  GN V+ +  KTRRR+LPN+ +  L S+ + +   +R++   LR+V ++GG+D +L+ 
Sbjct: 94  IQYGNNVAESKTKTRRRWLPNVIKKGLWSEALSRNVSIRMTAKVLRTVTKEGGIDNYLTK 153

Query: 72  SKKENLSARMRTL 84
            K    SAR++ L
Sbjct: 154 EK----SARIKEL 162


>gi|296273765|ref|YP_003656396.1| 50S ribosomal protein L28 [Arcobacter nitrofigilis DSM 7299]
 gi|296097939|gb|ADG93889.1| ribosomal protein L28 [Arcobacter nitrofigilis DSM 7299]
          Length = 62

 Score = 54.3 bits (129), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 32/63 (50%), Positives = 43/63 (68%), Gaps = 5/63 (7%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNL--CRITLISDIMEQKYQLRISKCALRS 58
          MSR C ++ K  MSGN VSHA N+T+RRFLPNL   R+TL  D   QK  ++IS   LR+
Sbjct: 1  MSRRCAISGKGPMSGNNVSHAKNRTKRRFLPNLRTVRVTL-DDGTTQK--IKISAKELRT 57

Query: 59 VER 61
          +++
Sbjct: 58 LKK 60


>gi|90023319|ref|YP_529146.1| 50S ribosomal protein L28 [Saccharophagus degradans 2-40]
 gi|123276030|sp|Q21EE5|RL28_SACD2 RecName: Full=50S ribosomal protein L28
 gi|89952919|gb|ABD82934.1| LSU ribosomal protein L28P [Saccharophagus degradans 2-40]
          Length = 78

 Score = 53.9 bits (128), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 27/70 (38%), Positives = 46/70 (65%), Gaps = 1/70 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M++VC++T K  ++G+ VSHA N T+RRFLPNL       +  ++  +LRIS   +R ++
Sbjct: 1  MAKVCQVTGKRPVTGHNVSHAKNHTKRRFLPNLHSHRFWVESEKRFVKLRISTKGMRIID 60

Query: 61 RQGGLDRFLS 70
          ++ G+D  L+
Sbjct: 61 KK-GIDTVLA 69


>gi|156972976|ref|YP_001443883.1| ribosomal protein L28 [Vibrio harveyi ATCC BAA-1116]
 gi|262392594|ref|YP_003284448.1| 50S ribosomal protein L28p [Vibrio sp. Ex25]
 gi|269959365|ref|ZP_06173748.1| ribosomal protein L28 [Vibrio harveyi 1DA3]
 gi|269965913|ref|ZP_06180006.1| ribosomal protein L28 [Vibrio alginolyticus 40B]
 gi|166228172|sp|A7MSP8|RL28_VIBHB RecName: Full=50S ribosomal protein L28
 gi|156524570|gb|ABU69656.1| hypothetical protein VIBHAR_00654 [Vibrio harveyi ATCC BAA-1116]
 gi|262336188|gb|ACY49983.1| LSU ribosomal protein L28p [Vibrio sp. Ex25]
 gi|269829466|gb|EEZ83707.1| ribosomal protein L28 [Vibrio alginolyticus 40B]
 gi|269835802|gb|EEZ89878.1| ribosomal protein L28 [Vibrio harveyi 1DA3]
          Length = 78

 Score = 53.9 bits (128), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 30/79 (37%), Positives = 51/79 (64%), Gaps = 3/79 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  ++GN  SHA N T+RRFLPNL       +  ++  +LR+S   +R ++
Sbjct: 1  MSRVCQVTGKRPVTGNNRSHARNATKRRFLPNLQTHRFWVESEKRFVKLRLSAKGMRIID 60

Query: 61 RQGGLDRFLSN--SKKENL 77
          ++ G+D  L++  ++ EN+
Sbjct: 61 KK-GIDTVLADMRARGENV 78


>gi|228474070|ref|ZP_04058811.1| ribosomal protein L28 [Capnocytophaga gingivalis ATCC 33624]
 gi|228274584|gb|EEK13425.1| ribosomal protein L28 [Capnocytophaga gingivalis ATCC 33624]
          Length = 78

 Score = 53.9 bits (128), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 29/77 (37%), Positives = 45/77 (58%), Gaps = 1/77 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M++VCELT K  M GN VSHA NKT+R+F  NL          ++   LR+S  A++++ 
Sbjct: 1  MAQVCELTGKKAMGGNNVSHAMNKTKRKFKVNLTTKRFYIPEEDRWITLRVSTNAIKTIN 60

Query: 61 RQGGLDRFLSNSKKENL 77
          ++ G+   L  +KK+  
Sbjct: 61 KK-GISAVLKEAKKQGF 76


>gi|329120724|ref|ZP_08249386.1| 50S ribosomal protein L28 [Neisseria bacilliformis ATCC BAA-1200]
 gi|327460521|gb|EGF06857.1| 50S ribosomal protein L28 [Neisseria bacilliformis ATCC BAA-1200]
          Length = 65

 Score = 53.9 bits (128), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 27/59 (45%), Positives = 39/59 (66%), Gaps = 1/59 (1%)

Query: 13 MSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFLSN 71
          MSGN VSHANNKT+RRFLPNL       +   +  +LR+S   LR++++  G+D  L++
Sbjct: 1  MSGNNVSHANNKTKRRFLPNLQTRRFWVESENRWVRLRVSNAGLRTIDKL-GIDAVLAD 58


>gi|31340362|sp|Q8DDY1|RL28_VIBVU RecName: Full=50S ribosomal protein L28
          Length = 78

 Score = 53.9 bits (128), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 30/79 (37%), Positives = 50/79 (63%), Gaps = 3/79 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K    GN  SHA N T+RRFLPNL  I    +  ++  +LR++   +R ++
Sbjct: 1  MSRVCQVTGKRPAVGNNRSHARNATKRRFLPNLQTIRFWVESEKRFVKLRLTAKGMRIID 60

Query: 61 RQGGLDRFLSN--SKKENL 77
          ++ G+D  L++  ++ EN+
Sbjct: 61 KK-GIDVVLADMRARGENV 78


>gi|88797505|ref|ZP_01113094.1| 50S ribosomal protein L28 [Reinekea sp. MED297]
 gi|88779677|gb|EAR10863.1| 50S ribosomal protein L28 [Reinekea sp. MED297]
          Length = 78

 Score = 53.9 bits (128), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 42/63 (66%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  ++GN VSH+  KT+RRFLPNL       +  ++  +LR+S   +R ++
Sbjct: 1  MSRVCQVTGKRPVTGNNVSHSQIKTKRRFLPNLHSHRFWVESEKRFVKLRVSTKGMRIID 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|145301063|ref|YP_001143904.1| 50S ribosomal protein L28 [Aeromonas salmonicida subsp.
          salmonicida A449]
 gi|166226536|sp|A4STD4|RL28_AERS4 RecName: Full=50S ribosomal protein L28
 gi|142853835|gb|ABO92156.1| ribosomal protein L28 [Aeromonas salmonicida subsp. salmonicida
          A449]
          Length = 78

 Score = 53.9 bits (128), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 27/63 (42%), Positives = 39/63 (61%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K    GN  SHANN T+RRFLPNL       +  ++   LR+S   +R ++
Sbjct: 1  MSRVCQVTGKRPAVGNNRSHANNATKRRFLPNLHTHRFWVEGEKRFVSLRVSAKGMRIID 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KRG 63


>gi|145346206|ref|XP_001417584.1| Putative mitochondrial ribosomal protein L28 [Ostreococcus
          lucimarinus CCE9901]
 gi|144577811|gb|ABO95877.1| Putative mitochondrial ribosomal protein L28 [Ostreococcus
          lucimarinus CCE9901]
          Length = 125

 Score = 53.9 bits (128), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 45/72 (62%), Gaps = 1/72 (1%)

Query: 7  LTKKTVMSGNKVSH-ANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGL 65
             K +  GN VS    NKTRRR+LPN  +  + S+++E+   +R++  ALR +++ GGL
Sbjct: 26 FAGKHIKFGNNVSEDGGNKTRRRWLPNAQKKRVYSELLEEMIPMRVTAHALRCMDKAGGL 85

Query: 66 DRFLSNSKKENL 77
          D ++  ++ ++L
Sbjct: 86 DEYILRTRDQDL 97


>gi|117621560|ref|YP_854694.1| 50S ribosomal protein L28 [Aeromonas hydrophila subsp. hydrophila
          ATCC 7966]
 gi|330831604|ref|YP_004394556.1| 50S ribosomal protein L28 [Aeromonas veronii B565]
 gi|166226535|sp|A0KEM9|RL28_AERHH RecName: Full=50S ribosomal protein L28
 gi|117562967|gb|ABK39915.1| ribosomal protein L28 [Aeromonas hydrophila subsp. hydrophila
          ATCC 7966]
 gi|328806740|gb|AEB51939.1| 50S ribosomal protein L28 [Aeromonas veronii B565]
          Length = 78

 Score = 53.9 bits (128), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 27/63 (42%), Positives = 39/63 (61%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K    GN  SHANN T+RRFLPNL       +  ++   LR+S   +R ++
Sbjct: 1  MSRVCQVTGKRPAVGNNRSHANNATKRRFLPNLHTHRFWVESEKRFVSLRVSAKGMRIID 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KRG 63


>gi|225023630|ref|ZP_03712822.1| hypothetical protein EIKCOROL_00490 [Eikenella corrodens ATCC
          23834]
 gi|224943512|gb|EEG24721.1| hypothetical protein EIKCOROL_00490 [Eikenella corrodens ATCC
          23834]
          Length = 65

 Score = 53.9 bits (128), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 39/59 (66%), Gaps = 1/59 (1%)

Query: 13 MSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFLSN 71
          MSGN VSHANNKT+RRFLPNL       +   +  +LR+S  ALR +++  G+D  L++
Sbjct: 1  MSGNNVSHANNKTKRRFLPNLQSRRFWVESENRWVRLRVSNAALRLIDKV-GIDAVLAD 58


>gi|123440464|ref|YP_001004458.1| 50S ribosomal protein L28 [Yersinia enterocolitica subsp.
          enterocolitica 8081]
 gi|332159687|ref|YP_004296264.1| 50S ribosomal protein L28 [Yersinia enterocolitica subsp.
          palearctica 105.5R(r)]
 gi|166228173|sp|A1JHR2|RL28_YERE8 RecName: Full=50S ribosomal protein L28
 gi|122087425|emb|CAL10206.1| 50S ribosomal protein L28 [Yersinia enterocolitica subsp.
          enterocolitica 8081]
 gi|318603786|emb|CBY25284.1| LSU ribosomal protein L28p [Yersinia enterocolitica subsp.
          palearctica Y11]
 gi|325663917|gb|ADZ40561.1| 50S ribosomal protein L28 [Yersinia enterocolitica subsp.
          palearctica 105.5R(r)]
 gi|330859990|emb|CBX70318.1| 50S ribosomal protein L28 [Yersinia enterocolitica W22703]
          Length = 78

 Score = 53.9 bits (128), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 27/63 (42%), Positives = 40/63 (63%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  +SGN  SHA N T+RRFLPNL       +  ++   LR+S   +R ++
Sbjct: 1  MSRVCQVTGKRPVSGNNRSHAMNATKRRFLPNLHSHRFWVEGEKRFVTLRVSAKGMRVID 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|152994663|ref|YP_001339498.1| 50S ribosomal protein L28 [Marinomonas sp. MWYL1]
 gi|189029445|sp|A6VSY4|RL28_MARMS RecName: Full=50S ribosomal protein L28
 gi|150835587|gb|ABR69563.1| ribosomal protein L28 [Marinomonas sp. MWYL1]
          Length = 78

 Score = 53.9 bits (128), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 25/63 (39%), Positives = 41/63 (65%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  ++GN VSH+  +T+RRFLPNL       +   +  +LR+S   +R ++
Sbjct: 1  MSRVCQVTGKRPITGNNVSHSKRRTKRRFLPNLHWHRFWVEGENRYIRLRVSSKGMRIID 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|108762247|ref|YP_634649.1| 50S ribosomal protein L28 [Myxococcus xanthus DK 1622]
 gi|108466127|gb|ABF91312.1| ribosomal protein L28 [Myxococcus xanthus DK 1622]
          Length = 78

 Score = 53.9 bits (128), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 42/69 (60%), Gaps = 1/69 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS+VC++T K  + GN VSHANN+ +RR LPNL         M +  +LR+S   +R + 
Sbjct: 1  MSKVCQVTGKRPLVGNTVSHANNRHKRRSLPNLQWHRFWVPSMNRFVKLRVSTHGIRIIN 60

Query: 61 RQGGLDRFL 69
           Q G+DR +
Sbjct: 61 -QRGIDRVV 68


>gi|120436590|ref|YP_862276.1| 50S ribosomal protein L28 [Gramella forsetii KT0803]
 gi|166226577|sp|A0M3L4|RL28_GRAFK RecName: Full=50S ribosomal protein L28
 gi|117578740|emb|CAL67209.1| 50S ribosomal protein L28 [Gramella forsetii KT0803]
          Length = 79

 Score = 53.9 bits (128), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 27/63 (42%), Positives = 38/63 (60%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVCELT K  M GN VSHA NKT+R+F  NL +        ++   L++   AL+ + 
Sbjct: 1  MSRVCELTGKRAMVGNNVSHAMNKTKRKFNANLVKKRFFLPEEDRWVTLKVCTSALKDIN 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|255533402|ref|YP_003093774.1| 50S ribosomal protein L28 [Pedobacter heparinus DSM 2366]
 gi|255346386|gb|ACU05712.1| ribosomal protein L28 [Pedobacter heparinus DSM 2366]
          Length = 77

 Score = 53.5 bits (127), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 27/72 (37%), Positives = 44/72 (61%), Gaps = 3/72 (4%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC+LT K  M+G  VSH+N KT+R+F PNL          ++   L++S  A++++ 
Sbjct: 1  MSRVCDLTGKMAMAGFNVSHSNVKTKRKFYPNLQLQKFYIPEEDRWITLKVSTSAIKTIN 60

Query: 61 RQG---GLDRFL 69
          + G    ++RF+
Sbjct: 61 KIGITEAINRFV 72


>gi|332284893|ref|YP_004416804.1| 50S ribosomal protein L28 [Pusillimonas sp. T7-7]
 gi|330428846|gb|AEC20180.1| 50S ribosomal protein L28 [Pusillimonas sp. T7-7]
          Length = 66

 Score = 53.5 bits (127), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 27/59 (45%), Positives = 39/59 (66%), Gaps = 1/59 (1%)

Query: 13 MSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFLSN 71
          M GN VSHANNKT+RRFLPNL       +   +  +LR+S  ALR++++  G+D  L++
Sbjct: 1  MVGNNVSHANNKTKRRFLPNLQSRRFWVESENRWVRLRVSTSALRTIDKN-GIDSVLAD 58


>gi|197286971|ref|YP_002152843.1| 50S ribosomal protein L28 [Proteus mirabilis HI4320]
 gi|227354790|ref|ZP_03839207.1| 50S ribosomal protein L28 [Proteus mirabilis ATCC 29906]
 gi|226699148|sp|B4F0W9|RL28_PROMH RecName: Full=50S ribosomal protein L28
 gi|194684458|emb|CAR46203.1| 50S ribosomal protein L28 [Proteus mirabilis HI4320]
 gi|227165108|gb|EEI49939.1| 50S ribosomal protein L28 [Proteus mirabilis ATCC 29906]
 gi|301072221|gb|ADK56075.1| RpmB [Proteus mirabilis]
 gi|301072244|gb|ADK56097.1| RpmB [Proteus mirabilis]
 gi|312598045|gb|ADQ89979.1| ribosomal protein [Proteus mirabilis]
 gi|312598062|gb|ADQ89995.1| ribosomal protein [Proteus mirabilis]
          Length = 78

 Score = 53.5 bits (127), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 27/63 (42%), Positives = 40/63 (63%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  +SGN  SHA N T+RRFLPNL       +  ++   LR+S   +R ++
Sbjct: 1  MSRVCQVTGKRPVSGNNRSHALNATKRRFLPNLHSHRFWVESEKRFVTLRVSAKGMRVID 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|312882920|ref|ZP_07742652.1| 50S ribosomal protein L28 [Vibrio caribbenthicus ATCC BAA-2122]
 gi|323495230|ref|ZP_08100312.1| 50S ribosomal protein L28 [Vibrio brasiliensis LMG 20546]
 gi|323497064|ref|ZP_08102087.1| 50S ribosomal protein L28 [Vibrio sinaloensis DSM 21326]
 gi|309369439|gb|EFP96959.1| 50S ribosomal protein L28 [Vibrio caribbenthicus ATCC BAA-2122]
 gi|323310490|gb|EGA63672.1| 50S ribosomal protein L28 [Vibrio brasiliensis LMG 20546]
 gi|323317908|gb|EGA70896.1| 50S ribosomal protein L28 [Vibrio sinaloensis DSM 21326]
          Length = 78

 Score = 53.5 bits (127), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 46/71 (64%), Gaps = 1/71 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  ++GN  SHA N T+RRFLPNL       +  ++  +LR+S   +R ++
Sbjct: 1  MSRVCQVTGKRPVTGNNRSHARNATKRRFLPNLQTHRFWVESEKRFVKLRLSAKGMRIID 60

Query: 61 RQGGLDRFLSN 71
          ++ G+D  L++
Sbjct: 61 KK-GIDAVLAD 70


>gi|308188655|ref|YP_003932786.1| 50S ribosomal protein L28 [Pantoea vagans C9-1]
 gi|308059165|gb|ADO11337.1| 50S ribosomal protein L28 [Pantoea vagans C9-1]
          Length = 78

 Score = 53.5 bits (127), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 45/71 (63%), Gaps = 1/71 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  ++GN  SHA N T+RRFLPNL       +  ++   LR+S   +R ++
Sbjct: 1  MSRVCQVTGKRPVTGNNRSHAMNATKRRFLPNLHSHRFWVESEKRFVTLRVSVKGMRIID 60

Query: 61 RQGGLDRFLSN 71
          ++ G+D  LS+
Sbjct: 61 KK-GIDTVLSD 70


>gi|146309769|ref|YP_001174843.1| 50S ribosomal protein L28 [Enterobacter sp. 638]
 gi|206578199|ref|YP_002236001.1| ribosomal protein L28 [Klebsiella pneumoniae 342]
 gi|288933008|ref|YP_003437067.1| ribosomal protein L28 [Klebsiella variicola At-22]
 gi|290511801|ref|ZP_06551169.1| 50S ribosomal protein L28 [Klebsiella sp. 1_1_55]
 gi|311277442|ref|YP_003939673.1| ribosomal protein L28 [Enterobacter cloacae SCF1]
 gi|166987912|sp|A4W512|RL28_ENT38 RecName: Full=50S ribosomal protein L28
 gi|226694950|sp|B5XTG6|RL28_KLEP3 RecName: Full=50S ribosomal protein L28
 gi|145316645|gb|ABP58792.1| LSU ribosomal protein L28P [Enterobacter sp. 638]
 gi|206567257|gb|ACI09033.1| ribosomal protein L28 [Klebsiella pneumoniae 342]
 gi|288887737|gb|ADC56055.1| ribosomal protein L28 [Klebsiella variicola At-22]
 gi|289775591|gb|EFD83591.1| 50S ribosomal protein L28 [Klebsiella sp. 1_1_55]
 gi|308746637|gb|ADO46389.1| ribosomal protein L28 [Enterobacter cloacae SCF1]
          Length = 78

 Score = 53.5 bits (127), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 44/70 (62%), Gaps = 1/70 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  ++GN  SHA N T+RRFLPNL       +  ++   LR+S   +R ++
Sbjct: 1  MSRVCQVTGKRPVTGNNRSHALNATKRRFLPNLHSHRFWVESEKRFVTLRVSAKGMRVID 60

Query: 61 RQGGLDRFLS 70
          ++ G+D  LS
Sbjct: 61 KK-GIDTVLS 69


>gi|118475728|ref|YP_892139.1| 50S ribosomal protein L28 [Campylobacter fetus subsp. fetus
          82-40]
 gi|166226557|sp|A0RPK6|RL28_CAMFF RecName: Full=50S ribosomal protein L28
 gi|118414954|gb|ABK83374.1| ribosomal protein L28 [Campylobacter fetus subsp. fetus 82-40]
          Length = 63

 Score = 53.5 bits (127), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 27/63 (42%), Positives = 43/63 (68%), Gaps = 3/63 (4%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRI-TLISDIMEQKYQLRISKCALRSV 59
          MS+ C +T K  M GN VSHANN+T+RRF+PNL  +  ++ D   +K  +R++   LR++
Sbjct: 1  MSKRCAITGKGPMVGNNVSHANNRTKRRFMPNLRTVRVMLEDGTTRK--IRVAASTLRTM 58

Query: 60 ERQ 62
          ++Q
Sbjct: 59 KKQ 61


>gi|134281303|ref|ZP_01768012.1| 50S ribosomal protein L28 [Burkholderia pseudomallei 305]
 gi|226194518|ref|ZP_03790116.1| 50S ribosomal protein L28 [Burkholderia pseudomallei Pakistan 9]
 gi|134247609|gb|EBA47694.1| 50S ribosomal protein L28 [Burkholderia pseudomallei 305]
 gi|225933603|gb|EEH29592.1| 50S ribosomal protein L28 [Burkholderia pseudomallei Pakistan 9]
          Length = 65

 Score = 53.5 bits (127), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 27/59 (45%), Positives = 38/59 (64%), Gaps = 1/59 (1%)

Query: 13 MSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFLSN 71
          MSGN VSHANNKT+RRFLPNL       +   +  +LR+S   LR +++  G+D  L++
Sbjct: 1  MSGNNVSHANNKTKRRFLPNLQNRRFWVESENRWVRLRVSNAGLRLIDKN-GIDSVLAD 58


>gi|291000967|ref|XP_002683050.1| predicted protein [Naegleria gruberi]
 gi|284096679|gb|EFC50306.1| predicted protein [Naegleria gruberi]
          Length = 87

 Score = 53.5 bits (127), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 45/70 (64%)

Query: 12 VMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFLSN 71
          + +GN+ S +  KT+R+++PN   + L S+ ++ + QLR +  ALR +++ GGLD +L  
Sbjct: 13 IQTGNQRSFSERKTKRKWMPNSHWVKLYSEALDTRVQLRATSKALRCIDKSGGLDNYLIE 72

Query: 72 SKKENLSARM 81
          ++ E + +R 
Sbjct: 73 TRPELVGSRY 82


>gi|56459352|ref|YP_154633.1| ribosomal protein L28 [Idiomarina loihiensis L2TR]
 gi|67461323|sp|Q5QZB3|RL28_IDILO RecName: Full=50S ribosomal protein L28
 gi|56178362|gb|AAV81084.1| Ribosomal protein L28 [Idiomarina loihiensis L2TR]
          Length = 78

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 44/71 (61%), Gaps = 1/71 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS+VC++T K  + GN  SHA N TRRRFLPNL       +  ++  +LRIS   +R ++
Sbjct: 1  MSQVCQVTGKRPVVGNNRSHARNATRRRFLPNLQSHRFWVESEKRWVKLRISTKGMRIID 60

Query: 61 RQGGLDRFLSN 71
          +  G+D  L++
Sbjct: 61 KN-GIDTVLAD 70


>gi|262374142|ref|ZP_06067419.1| ribosomal protein L28 [Acinetobacter junii SH205]
 gi|262311153|gb|EEY92240.1| ribosomal protein L28 [Acinetobacter junii SH205]
          Length = 78

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 41/63 (65%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS+VC++T K  + GN VSHANNKT+RRF PNL       +  ++  +LR++   +R ++
Sbjct: 1  MSKVCQVTGKRPIVGNNVSHANNKTKRRFEPNLHHHRFWLESEKRFVRLRLTTKGMRIID 60

Query: 61 RQG 63
          + G
Sbjct: 61 KLG 63


>gi|226951952|ref|ZP_03822416.1| 50S ribosomal protein L28 [Acinetobacter sp. ATCC 27244]
 gi|294649214|ref|ZP_06726652.1| 50S ribosomal protein L28 [Acinetobacter haemolyticus ATCC 19194]
 gi|226837290|gb|EEH69673.1| 50S ribosomal protein L28 [Acinetobacter sp. ATCC 27244]
 gi|292824881|gb|EFF83646.1| 50S ribosomal protein L28 [Acinetobacter haemolyticus ATCC 19194]
          Length = 82

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 41/63 (65%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS+VC++T K  + GN VSHANNKT+RRF PNL       +  ++  +LR++   +R ++
Sbjct: 5  MSKVCQVTGKRPIVGNNVSHANNKTKRRFEPNLHHHRFWLESEKRFVRLRLTTKGMRIID 64

Query: 61 RQG 63
          + G
Sbjct: 65 KLG 67


>gi|85060186|ref|YP_455888.1| 50S ribosomal protein L28 [Sodalis glossinidius str. 'morsitans']
 gi|123518742|sp|Q2NQU2|RL28_SODGM RecName: Full=50S ribosomal protein L28
 gi|84780706|dbj|BAE75483.1| 50S ribosomal protein L28 [Sodalis glossinidius str. 'morsitans']
          Length = 78

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 27/63 (42%), Positives = 40/63 (63%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  +SGN  SHA N T+RRFLPNL       +  ++   LR+S   +R ++
Sbjct: 1  MSRVCQVTGKRPVSGNNRSHAMNATKRRFLPNLHSHRFWVESEKRFVTLRVSAKGMRVID 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|89094939|ref|ZP_01167870.1| 50S ribosomal protein L28 [Oceanospirillum sp. MED92]
 gi|89080805|gb|EAR60046.1| 50S ribosomal protein L28 [Oceanospirillum sp. MED92]
          Length = 78

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 44/70 (62%), Gaps = 1/70 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS+VC +T K  ++GN VSH+  KTRRRFLPNL       +   +  +LR+S   +R ++
Sbjct: 1  MSKVCMVTGKRPVTGNNVSHSQRKTRRRFLPNLHWHRFWVESENKFVRLRVSAKGMRIID 60

Query: 61 RQGGLDRFLS 70
          ++ G+D  L+
Sbjct: 61 KK-GIDAVLT 69


>gi|9971882|gb|AAG10444.1|AF279106_6 predicted 50S ribosomal protein L28 [uncultured marine gamma
          proteobacterium EBAC31A08]
          Length = 78

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 39/63 (61%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS++C++T K   SGN VSHA N+T+R+F PNL       +   +   L++S   +R ++
Sbjct: 1  MSKICQVTGKIPQSGNNVSHAKNRTKRKFFPNLHTHKFWVESENRFVNLKVSAKGMRIID 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|50083741|ref|YP_045251.1| 50S ribosomal protein L28 [Acinetobacter sp. ADP1]
 gi|126640521|ref|YP_001083505.1| 50S ribosomal protein L28 [Acinetobacter baumannii ATCC 17978]
 gi|169634455|ref|YP_001708191.1| 50S ribosomal protein L28 [Acinetobacter baumannii SDF]
 gi|169797300|ref|YP_001715093.1| 50S ribosomal protein L28 [Acinetobacter baumannii AYE]
 gi|184156778|ref|YP_001845117.1| 50S ribosomal protein L28 [Acinetobacter baumannii ACICU]
 gi|213155890|ref|YP_002317935.1| ribosomal protein L28 [Acinetobacter baumannii AB0057]
 gi|215484737|ref|YP_002326972.1| ribosomal protein L28 [Acinetobacter baumannii AB307-0294]
 gi|239500819|ref|ZP_04660129.1| 50S ribosomal protein L28 [Acinetobacter baumannii AB900]
 gi|255321191|ref|ZP_05362357.1| ribosomal protein L28 [Acinetobacter radioresistens SK82]
 gi|260549128|ref|ZP_05823349.1| ribosomal protein L28 [Acinetobacter sp. RUH2624]
 gi|260556188|ref|ZP_05828407.1| ribosomal protein L28 [Acinetobacter baumannii ATCC 19606]
 gi|262280873|ref|ZP_06058656.1| ribosomal protein L28 [Acinetobacter calcoaceticus RUH2202]
 gi|262369955|ref|ZP_06063282.1| ribosomal protein L28 [Acinetobacter johnsonii SH046]
 gi|262375013|ref|ZP_06068247.1| ribosomal protein L28 [Acinetobacter lwoffii SH145]
 gi|262380123|ref|ZP_06073278.1| ribosomal protein L28 [Acinetobacter radioresistens SH164]
 gi|293610244|ref|ZP_06692545.1| 50S ribosomal protein L28 [Acinetobacter sp. SH024]
 gi|299771669|ref|YP_003733695.1| 50S ribosomal protein L28 [Acinetobacter sp. DR1]
 gi|301346579|ref|ZP_07227320.1| 50S ribosomal protein L28 [Acinetobacter baumannii AB056]
 gi|301511046|ref|ZP_07236283.1| 50S ribosomal protein L28 [Acinetobacter baumannii AB058]
 gi|301596908|ref|ZP_07241916.1| 50S ribosomal protein L28 [Acinetobacter baumannii AB059]
 gi|332853001|ref|ZP_08434511.1| ribosomal protein L28 [Acinetobacter baumannii 6013150]
 gi|332866451|ref|ZP_08437020.1| ribosomal protein L28 [Acinetobacter baumannii 6013113]
 gi|332873190|ref|ZP_08441147.1| ribosomal protein L28 [Acinetobacter baumannii 6014059]
 gi|67461401|sp|Q6FES9|RL28_ACIAD RecName: Full=50S ribosomal protein L28
 gi|166226530|sp|A3M1V9|RL28_ACIBT RecName: Full=50S ribosomal protein L28
 gi|226738013|sp|B7H0Q4|RL28_ACIB3 RecName: Full=50S ribosomal protein L28
 gi|226738014|sp|B7I4T0|RL28_ACIB5 RecName: Full=50S ribosomal protein L28
 gi|226738015|sp|B2I392|RL28_ACIBC RecName: Full=50S ribosomal protein L28
 gi|226738016|sp|B0VL79|RL28_ACIBS RecName: Full=50S ribosomal protein L28
 gi|226738017|sp|B0V4N1|RL28_ACIBY RecName: Full=50S ribosomal protein L28
 gi|49529717|emb|CAG67429.1| 50S ribosomal protein L28 [Acinetobacter sp. ADP1]
 gi|126386405|gb|ABO10903.1| 50S ribosomal protein L28 [Acinetobacter baumannii ATCC 17978]
 gi|169150227|emb|CAM88123.1| 50S ribosomal protein L28 [Acinetobacter baumannii AYE]
 gi|169153247|emb|CAP02347.1| 50S ribosomal protein L28 [Acinetobacter baumannii]
 gi|183208372|gb|ACC55770.1| putative ribosomal protein L28 [Acinetobacter baumannii ACICU]
 gi|213055050|gb|ACJ39952.1| ribosomal protein L28 [Acinetobacter baumannii AB0057]
 gi|213986890|gb|ACJ57189.1| ribosomal protein L28 [Acinetobacter baumannii AB307-0294]
 gi|255301745|gb|EET80996.1| ribosomal protein L28 [Acinetobacter radioresistens SK82]
 gi|260407856|gb|EEX01328.1| ribosomal protein L28 [Acinetobacter sp. RUH2624]
 gi|260410243|gb|EEX03542.1| ribosomal protein L28 [Acinetobacter baumannii ATCC 19606]
 gi|262257773|gb|EEY76508.1| ribosomal protein L28 [Acinetobacter calcoaceticus RUH2202]
 gi|262298317|gb|EEY86231.1| ribosomal protein L28 [Acinetobacter radioresistens SH164]
 gi|262310026|gb|EEY91155.1| ribosomal protein L28 [Acinetobacter lwoffii SH145]
 gi|262314994|gb|EEY96034.1| ribosomal protein L28 [Acinetobacter johnsonii SH046]
 gi|292827476|gb|EFF85840.1| 50S ribosomal protein L28 [Acinetobacter sp. SH024]
 gi|298701757|gb|ADI92322.1| 50S ribosomal protein L28 [Acinetobacter sp. DR1]
 gi|322506670|gb|ADX02124.1| rpmB [Acinetobacter baumannii 1656-2]
 gi|323516545|gb|ADX90926.1| 50S ribosomal protein L28 [Acinetobacter baumannii TCDC-AB0715]
 gi|325124423|gb|ADY83946.1| 50S ribosomal protein L28 [Acinetobacter calcoaceticus PHEA-2]
 gi|332728937|gb|EGJ60292.1| ribosomal protein L28 [Acinetobacter baumannii 6013150]
 gi|332734608|gb|EGJ65715.1| ribosomal protein L28 [Acinetobacter baumannii 6013113]
 gi|332738702|gb|EGJ69572.1| ribosomal protein L28 [Acinetobacter baumannii 6014059]
          Length = 78

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 41/63 (65%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS+VC++T K  + GN VSHANNKT+RRF PNL       +  ++  +LR++   +R ++
Sbjct: 1  MSKVCQVTGKRPVVGNNVSHANNKTKRRFEPNLHHHRFWLESEKRFVRLRLTTKGMRIID 60

Query: 61 RQG 63
          + G
Sbjct: 61 KLG 63


>gi|87120856|ref|ZP_01076748.1| ribosomal protein L28 [Marinomonas sp. MED121]
 gi|86163694|gb|EAQ64967.1| ribosomal protein L28 [Marinomonas sp. MED121]
          Length = 78

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 25/63 (39%), Positives = 41/63 (65%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  ++GN VSH+  +T+RRFLPNL       +   +  +LR+S   +R ++
Sbjct: 1  MSRVCQVTGKRPVTGNNVSHSKRRTKRRFLPNLHWHRFWVEGENRFVRLRVSSKGIRIID 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|329296439|ref|ZP_08253775.1| 50S ribosomal protein L28 [Plautia stali symbiont]
          Length = 78

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 44/70 (62%), Gaps = 1/70 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  ++GN  SHA N T+RRFLPNL       +  ++   LR+S   +R ++
Sbjct: 1  MSRVCQVTGKRPVTGNNRSHAMNATKRRFLPNLHSHRFWVESEKRFVTLRVSAKGMRVID 60

Query: 61 RQGGLDRFLS 70
          ++ G+D  L+
Sbjct: 61 KK-GIDTVLA 69


>gi|281203401|gb|EFA77601.1| hypothetical protein PPL_12207 [Polysphondylium pallidum PN500]
          Length = 142

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 45/72 (62%)

Query: 10  KTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFL 69
           +T+  GN +S ++ KTRR + PN+   T  SDI+ Q  ++ ++   +R +++ G  D ++
Sbjct: 36  RTIQYGNSISFSHKKTRRTWKPNVQSKTYHSDILNQDIKVDVTTYTMRCIDKAGNFDNYI 95

Query: 70  SNSKKENLSARM 81
            N+K ++L +++
Sbjct: 96  INTKDKDLDSKL 107


>gi|28896959|ref|NP_796564.1| 50S ribosomal protein L28 [Vibrio parahaemolyticus RIMD 2210633]
 gi|153842080|ref|ZP_01993469.1| ribosomal protein L28 [Vibrio parahaemolyticus AQ3810]
 gi|163803270|ref|ZP_02197149.1| hypothetical protein 1103602000575_AND4_17901 [Vibrio sp. AND4]
 gi|260362384|ref|ZP_05775342.1| ribosomal protein L28 [Vibrio parahaemolyticus K5030]
 gi|260877859|ref|ZP_05890214.1| ribosomal protein L28 [Vibrio parahaemolyticus AN-5034]
 gi|260897662|ref|ZP_05906158.1| ribosomal protein L28 [Vibrio parahaemolyticus Peru-466]
 gi|260899592|ref|ZP_05907987.1| ribosomal protein L28 [Vibrio parahaemolyticus AQ4037]
 gi|31340345|sp|Q87T85|RL28_VIBPA RecName: Full=50S ribosomal protein L28
 gi|28805167|dbj|BAC58448.1| ribosomal protein L28 [Vibrio parahaemolyticus RIMD 2210633]
 gi|149745415|gb|EDM56666.1| ribosomal protein L28 [Vibrio parahaemolyticus AQ3810]
 gi|159172907|gb|EDP57745.1| hypothetical protein AND4_17901 [Vibrio sp. AND4]
 gi|308087500|gb|EFO37195.1| ribosomal protein L28 [Vibrio parahaemolyticus Peru-466]
 gi|308089836|gb|EFO39531.1| ribosomal protein L28 [Vibrio parahaemolyticus AN-5034]
 gi|308108807|gb|EFO46347.1| ribosomal protein L28 [Vibrio parahaemolyticus AQ4037]
 gi|308115155|gb|EFO52695.1| ribosomal protein L28 [Vibrio parahaemolyticus K5030]
 gi|328471755|gb|EGF42632.1| 50S ribosomal protein L28 [Vibrio parahaemolyticus 10329]
          Length = 78

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 29/79 (36%), Positives = 51/79 (64%), Gaps = 3/79 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  ++GN  SHA N T+RRFLPNL       +  ++  +LR++   +R ++
Sbjct: 1  MSRVCQVTGKRPVTGNNRSHARNATKRRFLPNLQTHRFWVESEKRFVKLRLTAKGMRIID 60

Query: 61 RQGGLDRFLSN--SKKENL 77
          ++ G+D  L++  ++ EN+
Sbjct: 61 KK-GIDTVLADIRARGENV 78


>gi|260599934|ref|YP_003212505.1| 50S ribosomal protein L28 [Cronobacter turicensis z3032]
 gi|260219111|emb|CBA34466.1| 50S ribosomal protein L28 [Cronobacter turicensis z3032]
          Length = 80

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 44/70 (62%), Gaps = 1/70 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  ++GN  SHA N T+RRFLPNL       +  ++   LR+S   +R ++
Sbjct: 3  MSRVCQVTGKRPVTGNNRSHALNATKRRFLPNLHSHRFWVESEKRFVTLRVSAKGMRVID 62

Query: 61 RQGGLDRFLS 70
          ++ G+D  LS
Sbjct: 63 KK-GIDVVLS 71


>gi|313681501|ref|YP_004059239.1| LSU ribosomal protein l28p [Sulfuricurvum kujiense DSM 16994]
 gi|313154361|gb|ADR33039.1| LSU ribosomal protein L28P [Sulfuricurvum kujiense DSM 16994]
          Length = 62

 Score = 52.8 bits (125), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 28/64 (43%), Positives = 42/64 (65%), Gaps = 5/64 (7%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNL--CRITLISDIMEQKYQLRISKCALRS 58
          M+R C ++ K  MSGN VSHA N+T+RRFLPNL   R+TL     +   +L+I+   LR+
Sbjct: 1  MARKCAISGKGPMSGNNVSHAKNRTKRRFLPNLRTVRVTLEDGTTK---KLKIAASELRT 57

Query: 59 VERQ 62
          +++ 
Sbjct: 58 LKKD 61


>gi|242237619|ref|YP_002985800.1| 50S ribosomal protein L28 [Dickeya dadantii Ech703]
 gi|251791517|ref|YP_003006238.1| 50S ribosomal protein L28 [Dickeya zeae Ech1591]
 gi|271498729|ref|YP_003331754.1| 50S ribosomal protein L28 [Dickeya dadantii Ech586]
 gi|307133080|ref|YP_003885096.1| 50S ribosomal subunit protein L28 [Dickeya dadantii 3937]
 gi|242129676|gb|ACS83978.1| ribosomal protein L28 [Dickeya dadantii Ech703]
 gi|247540138|gb|ACT08759.1| ribosomal protein L28 [Dickeya zeae Ech1591]
 gi|270342284|gb|ACZ75049.1| ribosomal protein L28 [Dickeya dadantii Ech586]
 gi|306530609|gb|ADN00540.1| 50S ribosomal subunit protein L28 [Dickeya dadantii 3937]
          Length = 78

 Score = 52.8 bits (125), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 40/63 (63%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  ++GN  SHA N T+RRFLPNL       +  ++   LR+S   +R ++
Sbjct: 1  MSRVCQVTGKRPVTGNNRSHAMNATKRRFLPNLHSHRFWVEGEKRFVTLRVSAKGMRVID 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|307546415|ref|YP_003898894.1| 50S ribosomal protein L28 [Halomonas elongata DSM 2581]
 gi|307218439|emb|CBV43709.1| 50S ribosomal protein L28 [Halomonas elongata DSM 2581]
          Length = 78

 Score = 52.8 bits (125), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 48/74 (64%), Gaps = 1/74 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS+VC++T K  ++G+ VSH+  KT RRF+PNL       +  ++  +LR+S   +R ++
Sbjct: 1  MSKVCQVTGKRPVTGHNVSHSQRKTPRRFVPNLHTHRFWVEAEKRFVKLRVSTKGMRIID 60

Query: 61 RQGGLDRFLSNSKK 74
          ++ G+D  LS+ +K
Sbjct: 61 KK-GIDAVLSDIRK 73


>gi|317494720|ref|ZP_07953132.1| ribosomal L28 family protein [Enterobacteriaceae bacterium
          9_2_54FAA]
 gi|316917322|gb|EFV38669.1| ribosomal L28 family protein [Enterobacteriaceae bacterium
          9_2_54FAA]
          Length = 78

 Score = 52.8 bits (125), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 40/63 (63%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  ++GN  SHA N T+RRFLPNL       +  ++   LR+S   +R ++
Sbjct: 1  MSRVCQVTGKRPVAGNNRSHAMNATKRRFLPNLHSHRFWVEGEKRFVTLRVSAKGMRVID 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|254495923|ref|ZP_05108831.1| 50S ribosomal protein L28 [Legionella drancourtii LLAP12]
 gi|254354801|gb|EET13428.1| 50S ribosomal protein L28 [Legionella drancourtii LLAP12]
          Length = 66

 Score = 52.8 bits (125), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 41/65 (63%), Gaps = 3/65 (4%)

Query: 13 MSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQG---GLDRFL 69
          M+GNKVSHANNKTRRRFLPN+   +   +   +   LR+S   +R +++ G    LD+  
Sbjct: 1  MTGNKVSHANNKTRRRFLPNIQNHSFWVEEENRFVTLRVSTKGMRIIDKLGIKAVLDKIR 60

Query: 70 SNSKK 74
          +N +K
Sbjct: 61 ANGEK 65


>gi|254523115|ref|ZP_05135170.1| ribosomal protein L28 [Stenotrophomonas sp. SKA14]
 gi|219720706|gb|EED39231.1| ribosomal protein L28 [Stenotrophomonas sp. SKA14]
          Length = 67

 Score = 52.8 bits (125), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 37/57 (64%), Gaps = 1/57 (1%)

Query: 14 SGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFLS 70
          +GN VSHANNKTRRRFLPNL           +  +LR+S  ALR++++  G+D  L+
Sbjct: 3  TGNNVSHANNKTRRRFLPNLHERRFWVASENRWVKLRVSAHALRTIDKN-GIDSVLA 58


>gi|300714650|ref|YP_003739453.1| 50S ribosomal protein L28 [Erwinia billingiae Eb661]
 gi|299060486|emb|CAX57593.1| 50S ribosomal protein L28 [Erwinia billingiae Eb661]
          Length = 78

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 40/63 (63%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  +SGN  SHA N T+RRFLPNL       +  ++   LR++   +R ++
Sbjct: 1  MSRVCQVTGKRPVSGNNRSHAMNATKRRFLPNLHSHRFWVESEKRFVTLRVTAKGMRVID 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|188532228|ref|YP_001906025.1| 50S ribosomal protein L28 [Erwinia tasmaniensis Et1/99]
 gi|259906760|ref|YP_002647116.1| 50S ribosomal protein L28 [Erwinia pyrifoliae Ep1/96]
 gi|292486567|ref|YP_003529435.1| 50S ribosomal protein L28 [Erwinia amylovora CFBP1430]
 gi|292897805|ref|YP_003537174.1| 50S ribosomal protein L28 [Erwinia amylovora ATCC 49946]
 gi|226694787|sp|B2VF68|RL28_ERWT9 RecName: Full=50S ribosomal protein L28
 gi|188027270|emb|CAO95113.1| 50S ribosomal protein L28 [Erwinia tasmaniensis Et1/99]
 gi|224962382|emb|CAX53837.1| 50S ribosomal protein L28 [Erwinia pyrifoliae Ep1/96]
 gi|283476546|emb|CAY72374.1| 50S ribosomal protein L28 [Erwinia pyrifoliae DSM 12163]
 gi|291197653|emb|CBJ44748.1| 50S ribosomal protein L28 [Erwinia amylovora ATCC 49946]
 gi|291551982|emb|CBA19019.1| 50S ribosomal protein L28 [Erwinia amylovora CFBP1430]
 gi|312170628|emb|CBX78891.1| 50S ribosomal protein L28 [Erwinia amylovora ATCC BAA-2158]
          Length = 78

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 40/63 (63%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  ++GN  SHA N T+RRFLPNL       +  ++   LR+S   +R ++
Sbjct: 1  MSRVCQVTGKRPVTGNNRSHAMNATKRRFLPNLHSHRFWVESEKRFVTLRVSAKGMRVID 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|149908602|ref|ZP_01897264.1| 50S ribosomal protein L28 [Moritella sp. PE36]
 gi|149910344|ref|ZP_01898987.1| 50S ribosomal protein L28 [Moritella sp. PE36]
 gi|149806592|gb|EDM66560.1| 50S ribosomal protein L28 [Moritella sp. PE36]
 gi|149808436|gb|EDM68373.1| 50S ribosomal protein L28 [Moritella sp. PE36]
          Length = 78

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 44/70 (62%), Gaps = 1/70 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS+VC++T K    GN VSHA N+TRRRFLPNL       +   +  +LR++   +R ++
Sbjct: 1  MSKVCQVTGKKPAVGNNVSHAKNRTRRRFLPNLHTHRFWVESENRFVKLRLTCKGMRIID 60

Query: 61 RQGGLDRFLS 70
          ++ G+D  L+
Sbjct: 61 KK-GIDSVLA 69


>gi|295698711|ref|YP_003603366.1| ribosomal protein L28 [Candidatus Riesia pediculicola USDA]
 gi|291157260|gb|ADD79705.1| ribosomal protein L28 [Candidatus Riesia pediculicola USDA]
          Length = 81

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 27/63 (42%), Positives = 39/63 (61%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR+CE+T K    GN  SH+ N T+RRFLPNL       +  ++  +LRIS   +R +E
Sbjct: 1  MSRICEITGKKSTKGNHRSHSMNATKRRFLPNLHYHKFWIEKEKRFVRLRISAKGVRIIE 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|269103918|ref|ZP_06156615.1| LSU ribosomal protein L28p [Photobacterium damselae subsp.
          damselae CIP 102761]
 gi|268163816|gb|EEZ42312.1| LSU ribosomal protein L28p [Photobacterium damselae subsp.
          damselae CIP 102761]
          Length = 78

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 30/79 (37%), Positives = 50/79 (63%), Gaps = 3/79 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  ++GN  SHA N T+RRFLPNL       +  ++  +LR+S   +R ++
Sbjct: 1  MSRVCQVTGKRPVTGNNRSHARNATKRRFLPNLQTHRFWVESEKRFVKLRLSAKGMRIID 60

Query: 61 RQGGLDRFLSN--SKKENL 77
          ++ G+D  L +  ++ EN+
Sbjct: 61 KK-GIDAVLVDMRARGENV 78


>gi|315452749|ref|YP_004073019.1| 50S ribosomal protein L28 [Helicobacter felis ATCC 49179]
 gi|315131801|emb|CBY82429.1| 50S ribosomal protein L28 [Helicobacter felis ATCC 49179]
          Length = 62

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 43/63 (68%), Gaps = 5/63 (7%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNL--CRITLISDIMEQKYQLRISKCALRS 58
          M+R C+L+ K  M GN VSHANNK++RR LPNL   RITL  D  +QK  +R++   LR+
Sbjct: 1  MARRCDLSLKGPMVGNHVSHANNKSKRRLLPNLRTIRITL-EDGTKQK--IRVAASTLRT 57

Query: 59 VER 61
          + +
Sbjct: 58 MRK 60


>gi|300721249|ref|YP_003710519.1| 50S ribosomal subunit protein L28 [Xenorhabdus nematophila ATCC
          19061]
 gi|297627736|emb|CBJ88262.1| 50S ribosomal subunit protein L28 [Xenorhabdus nematophila ATCC
          19061]
          Length = 78

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 44/70 (62%), Gaps = 1/70 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  +SGN  SHA N T+RRFLPNL       +  ++   LR+S   +R ++
Sbjct: 1  MSRVCQVTGKRPVSGNNRSHALNATKRRFLPNLHSHRFWVESEKRFVTLRVSVKGMRVID 60

Query: 61 RQGGLDRFLS 70
          ++ G+D  L+
Sbjct: 61 KK-GIDTVLA 69


>gi|78486257|ref|YP_392182.1| ribosomal protein L28 [Thiomicrospira crunogena XCL-2]
 gi|123555021|sp|Q31EB5|RL28_THICR RecName: Full=50S ribosomal protein L28
 gi|78364543|gb|ABB42508.1| LSU ribosomal protein L28P [Thiomicrospira crunogena XCL-2]
          Length = 78

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/63 (39%), Positives = 40/63 (63%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS++C++T K  + GN VSH++ KTRRRFLPNL       +   +  +LR+S   +R ++
Sbjct: 1  MSKICQVTGKKPVVGNNVSHSHRKTRRRFLPNLQTHRFWVENENRFVKLRLSTSGMRIID 60

Query: 61 RQG 63
          + G
Sbjct: 61 KNG 63


>gi|90580920|ref|ZP_01236722.1| putative ribosomal protein L28 [Vibrio angustum S14]
 gi|330447139|ref|ZP_08310789.1| ribosomal protein L28 [Photobacterium leiognathi subsp.
          mandapamensis svers.1.1.]
 gi|90437991|gb|EAS63180.1| putative ribosomal protein L28 [Vibrio angustum S14]
 gi|328491330|dbj|GAA05286.1| ribosomal protein L28 [Photobacterium leiognathi subsp.
          mandapamensis svers.1.1.]
          Length = 78

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 41/63 (65%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  ++GN  SHA N T+RRFLPNL       +  ++  +LR+S   +R ++
Sbjct: 1  MSRVCQVTGKRPVTGNNRSHARNATKRRFLPNLQTHRFWVESEKRFVKLRLSAKGMRIID 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|71279933|ref|YP_266976.1| 50S ribosomal protein L28 [Colwellia psychrerythraea 34H]
 gi|123634189|sp|Q48AD7|RL28_COLP3 RecName: Full=50S ribosomal protein L28
 gi|71145673|gb|AAZ26146.1| ribosomal protein L28 [Colwellia psychrerythraea 34H]
          Length = 78

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 44/71 (61%), Gaps = 1/71 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS++C++T K  M GN  SHA N TRRRFLPNL       +   +  +LR++   +R ++
Sbjct: 1  MSKICQVTGKVPMVGNNRSHARNATRRRFLPNLQSHRFWVESENRFVKLRLTPKGMRIID 60

Query: 61 RQGGLDRFLSN 71
          ++ G+D  L++
Sbjct: 61 KK-GIDVVLTD 70


>gi|254784437|ref|YP_003071865.1| 50S ribosomal protein L28 [Teredinibacter turnerae T7901]
 gi|259646751|sp|C5BLG3|RL28_TERTT RecName: Full=50S ribosomal protein L28
 gi|237684904|gb|ACR12168.1| ribosomal protein L28 [Teredinibacter turnerae T7901]
          Length = 78

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 41/63 (65%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M++VC++T K  ++G+ VSHA N T+RRFLPNL       +  ++  +LR+S   +R ++
Sbjct: 1  MAKVCQVTGKRPVTGHNVSHAKNHTKRRFLPNLHTHRFWVESEKRFVKLRVSSKGMRIID 60

Query: 61 RQG 63
          + G
Sbjct: 61 KNG 63


>gi|325103019|ref|YP_004272673.1| LSU ribosomal protein L28P [Pedobacter saltans DSM 12145]
 gi|324971867|gb|ADY50851.1| LSU ribosomal protein L28P [Pedobacter saltans DSM 12145]
          Length = 77

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 43/72 (59%), Gaps = 3/72 (4%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR+C+LT K  M G+ VSH+N KT R+F PNL          ++   L++S  A++++ 
Sbjct: 1  MSRICDLTGKAAMKGHHVSHSNVKTIRKFYPNLQLKKFYIPEEDRWITLKVSTSAIKTIN 60

Query: 61 RQG---GLDRFL 69
          + G    ++RF+
Sbjct: 61 KIGITEAINRFI 72


>gi|298373102|ref|ZP_06983092.1| ribosomal protein L28 [Bacteroidetes oral taxon 274 str. F0058]
 gi|298276006|gb|EFI17557.1| ribosomal protein L28 [Bacteroidetes oral taxon 274 str. F0058]
          Length = 86

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 40/72 (55%), Gaps = 1/72 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  M GN VSH+N KT+R F  NL          +    LRIS   LR++ 
Sbjct: 1  MSRVCQITGKRAMGGNNVSHSNRKTKRLFDVNLFNKKFYYVEEDCWISLRISAAGLRTIN 60

Query: 61 RQGGLDRFLSNS 72
          +  GLD  L N+
Sbjct: 61 KN-GLDAALKNA 71


>gi|254491381|ref|ZP_05104560.1| ribosomal protein L28 [Methylophaga thiooxidans DMS010]
 gi|224462859|gb|EEF79129.1| ribosomal protein L28 [Methylophaga thiooxydans DMS010]
          Length = 66

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 40/59 (67%), Gaps = 1/59 (1%)

Query: 13 MSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFLSN 71
          MSGN VSHA+NKT+RRFLPNL    +  +   +  +LR+S   LR ++++ G+D  L++
Sbjct: 1  MSGNNVSHAHNKTKRRFLPNLHSHRIWVESENRWVKLRVSNHGLRIIDKK-GIDAVLTD 58


>gi|260779660|ref|ZP_05888550.1| LSU ribosomal protein L28p [Vibrio coralliilyticus ATCC BAA-450]
 gi|261250534|ref|ZP_05943109.1| LSU ribosomal protein L28p [Vibrio orientalis CIP 102891]
 gi|260604469|gb|EEX30773.1| LSU ribosomal protein L28p [Vibrio coralliilyticus ATCC BAA-450]
 gi|260939103|gb|EEX95090.1| LSU ribosomal protein L28p [Vibrio orientalis CIP 102891]
          Length = 78

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 41/63 (65%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  ++GN  SHA N T+RRFLPNL       +  ++  +LR+S   +R ++
Sbjct: 1  MSRVCQVTGKRPVTGNNRSHARNATKRRFLPNLQTHRFWVESEKRFVKLRLSAKGMRIID 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|268315599|ref|YP_003289318.1| 50S ribosomal protein L28 [Rhodothermus marinus DSM 4252]
 gi|262333133|gb|ACY46930.1| ribosomal protein L28 [Rhodothermus marinus DSM 4252]
          Length = 78

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 41/63 (65%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+R  +LT K  +SG+ VSHANNKT+RRFLPNL +        ++   LR+S   ++++ 
Sbjct: 1  MARRDQLTGKGPVSGHNVSHANNKTKRRFLPNLQKKRFYIPEEKRWITLRVSAKTMKTIN 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|322379605|ref|ZP_08053942.1| 50S ribosomal protein L28 [Helicobacter suis HS1]
 gi|322380994|ref|ZP_08055051.1| 50S ribosomal protein L28 [Helicobacter suis HS5]
 gi|321146579|gb|EFX41422.1| 50S ribosomal protein L28 [Helicobacter suis HS5]
 gi|321147999|gb|EFX42562.1| 50S ribosomal protein L28 [Helicobacter suis HS1]
          Length = 62

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 27/62 (43%), Positives = 43/62 (69%), Gaps = 3/62 (4%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITL-ISDIMEQKYQLRISKCALRSV 59
          M+R C+L+ K  M GN+VSHANNKT+RR LPNL  I + + D  +Q+  ++++   LR++
Sbjct: 1  MARRCDLSHKGPMVGNRVSHANNKTKRRLLPNLHTIHITLEDGTKQR--IKVATSTLRTM 58

Query: 60 ER 61
           +
Sbjct: 59 RK 60


>gi|317050106|ref|YP_004117754.1| 50S ribosomal protein L28 [Pantoea sp. At-9b]
 gi|316951723|gb|ADU71198.1| ribosomal protein L28 [Pantoea sp. At-9b]
          Length = 78

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 44/70 (62%), Gaps = 1/70 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  ++GN  SHA N T+RRFLPNL       +  ++   LR+S   +R ++
Sbjct: 1  MSRVCQVTGKRPVTGNNRSHALNATKRRFLPNLHSHRFWVESEKRFVTLRVSAKGMRVID 60

Query: 61 RQGGLDRFLS 70
          ++ G+D  L+
Sbjct: 61 KK-GIDTVLA 69


>gi|15804178|ref|NP_290217.1| 50S ribosomal protein L28 [Escherichia coli O157:H7 EDL933]
 gi|15833766|ref|NP_312539.1| 50S ribosomal protein L28 [Escherichia coli O157:H7 str. Sakai]
 gi|16131508|ref|NP_418094.1| 50S ribosomal subunit protein L28 [Escherichia coli str. K-12
          substr. MG1655]
 gi|24114906|ref|NP_709416.1| 50S ribosomal protein L28 [Shigella flexneri 2a str. 301]
 gi|26250283|ref|NP_756323.1| 50S ribosomal protein L28 [Escherichia coli CFT073]
 gi|30065087|ref|NP_839258.1| 50S ribosomal protein L28 [Shigella flexneri 2a str. 2457T]
 gi|74314129|ref|YP_312548.1| 50S ribosomal protein L28 [Shigella sonnei Ss046]
 gi|82779127|ref|YP_405476.1| 50S ribosomal protein L28 [Shigella dysenteriae Sd197]
 gi|89110374|ref|AP_004154.1| 50S ribosomal subunit protein L28 [Escherichia coli str. K-12
          substr. W3110]
 gi|91213154|ref|YP_543140.1| 50S ribosomal protein L28 [Escherichia coli UTI89]
 gi|110643878|ref|YP_671608.1| 50S ribosomal protein L28 [Escherichia coli 536]
 gi|152972483|ref|YP_001337629.1| 50S ribosomal protein L28 [Klebsiella pneumoniae subsp.
          pneumoniae MGH 78578]
 gi|157155847|ref|YP_001465117.1| 50S ribosomal protein L28 [Escherichia coli E24377A]
 gi|157163118|ref|YP_001460436.1| 50S ribosomal protein L28 [Escherichia coli HS]
 gi|168748715|ref|ZP_02773737.1| ribosomal protein L28 [Escherichia coli O157:H7 str. EC4113]
 gi|168753461|ref|ZP_02778468.1| ribosomal protein L28 [Escherichia coli O157:H7 str. EC4401]
 gi|168759734|ref|ZP_02784741.1| ribosomal protein L28 [Escherichia coli O157:H7 str. EC4501]
 gi|168766057|ref|ZP_02791064.1| ribosomal protein L28 [Escherichia coli O157:H7 str. EC4486]
 gi|168772397|ref|ZP_02797404.1| ribosomal protein L28 [Escherichia coli O157:H7 str. EC4196]
 gi|168779792|ref|ZP_02804799.1| ribosomal protein L28 [Escherichia coli O157:H7 str. EC4076]
 gi|168785513|ref|ZP_02810520.1| ribosomal protein L28 [Escherichia coli O157:H7 str. EC869]
 gi|168798582|ref|ZP_02823589.1| ribosomal protein L28 [Escherichia coli O157:H7 str. EC508]
 gi|170018133|ref|YP_001723087.1| 50S ribosomal protein L28 [Escherichia coli ATCC 8739]
 gi|170083145|ref|YP_001732465.1| 50S ribosomal subunit protein L28 [Escherichia coli str. K-12
          substr. DH10B]
 gi|170680615|ref|YP_001745937.1| 50S ribosomal protein L28 [Escherichia coli SMS-3-5]
 gi|187732138|ref|YP_001882334.1| 50S ribosomal protein L28 [Shigella boydii CDC 3083-94]
 gi|188496045|ref|ZP_03003315.1| ribosomal protein L28 [Escherichia coli 53638]
 gi|191167810|ref|ZP_03029616.1| ribosomal protein L28 [Escherichia coli B7A]
 gi|191170547|ref|ZP_03032100.1| ribosomal protein L28 [Escherichia coli F11]
 gi|193063777|ref|ZP_03044864.1| ribosomal protein L28 [Escherichia coli E22]
 gi|193070349|ref|ZP_03051291.1| ribosomal protein L28 [Escherichia coli E110019]
 gi|194431236|ref|ZP_03063529.1| ribosomal protein L28 [Shigella dysenteriae 1012]
 gi|194435684|ref|ZP_03067787.1| ribosomal protein L28 [Escherichia coli 101-1]
 gi|195936198|ref|ZP_03081580.1| 50S ribosomal protein L28 [Escherichia coli O157:H7 str. EC4024]
 gi|208812807|ref|ZP_03254136.1| ribosomal protein L28 [Escherichia coli O157:H7 str. EC4045]
 gi|208818638|ref|ZP_03258958.1| ribosomal protein L28 [Escherichia coli O157:H7 str. EC4042]
 gi|209397282|ref|YP_002273115.1| ribosomal protein L28 [Escherichia coli O157:H7 str. EC4115]
 gi|209921108|ref|YP_002295192.1| 50S ribosomal protein L28 [Escherichia coli SE11]
 gi|215488916|ref|YP_002331347.1| 50S ribosomal protein L28 [Escherichia coli O127:H6 str.
          E2348/69]
 gi|217324332|ref|ZP_03440416.1| ribosomal protein L28 [Escherichia coli O157:H7 str. TW14588]
 gi|218551165|ref|YP_002384956.1| 50S ribosomal protein L28 [Escherichia fergusonii ATCC 35469]
 gi|218556199|ref|YP_002389112.1| 50S ribosomal protein L28 [Escherichia coli IAI1]
 gi|218560709|ref|YP_002393622.1| 50S ribosomal protein L28 [Escherichia coli S88]
 gi|218691921|ref|YP_002400133.1| 50S ribosomal protein L28 [Escherichia coli ED1a]
 gi|218697358|ref|YP_002405025.1| 50S ribosomal protein L28 [Escherichia coli 55989]
 gi|218702403|ref|YP_002410032.1| 50S ribosomal protein L28 [Escherichia coli IAI39]
 gi|218707271|ref|YP_002414790.1| 50S ribosomal protein L28 [Escherichia coli UMN026]
 gi|237703408|ref|ZP_04533889.1| 50S ribosomal subunit protein L28 [Escherichia sp. 3_2_53FAA]
 gi|238897078|ref|YP_002921824.1| 50S ribosomal protein L28 [Klebsiella pneumoniae NTUH-K2044]
 gi|238902728|ref|YP_002928524.1| 50S ribosomal subunit protein L28 [Escherichia coli BW2952]
 gi|253771522|ref|YP_003034353.1| 50S ribosomal protein L28 [Escherichia coli 'BL21-Gold(DE3)pLysS
          AG']
 gi|254038836|ref|ZP_04872888.1| ribosomal protein L28 [Escherichia sp. 1_1_43]
 gi|254163565|ref|YP_003046673.1| 50S ribosomal protein L28 [Escherichia coli B str. REL606]
 gi|254795592|ref|YP_003080429.1| 50S ribosomal protein L28 [Escherichia coli O157:H7 str. TW14359]
 gi|256021359|ref|ZP_05435224.1| 50S ribosomal protein L28 [Shigella sp. D9]
 gi|256025633|ref|ZP_05439498.1| 50S ribosomal protein L28 [Escherichia sp. 4_1_40B]
 gi|260846598|ref|YP_003224376.1| 50S ribosomal subunit protein L28 [Escherichia coli O103:H2 str.
          12009]
 gi|260857968|ref|YP_003231859.1| 50S ribosomal subunit protein L28 [Escherichia coli O26:H11 str.
          11368]
 gi|260870367|ref|YP_003236769.1| 50S ribosomal subunit protein L28 [Escherichia coli O111:H- str.
          11128]
 gi|261224180|ref|ZP_05938461.1| 50S ribosomal subunit protein L28 [Escherichia coli O157:H7 str.
          FRIK2000]
 gi|261254791|ref|ZP_05947324.1| 50S ribosomal subunit protein L28 [Escherichia coli O157:H7 str.
          FRIK966]
 gi|291285008|ref|YP_003501826.1| 50S ribosomal protein L28 [Escherichia coli O55:H7 str. CB9615]
 gi|293407260|ref|ZP_06651184.1| LSU ribosomal protein L28p [Escherichia coli FVEC1412]
 gi|293413071|ref|ZP_06655739.1| conserved hypothetical protein [Escherichia coli B354]
 gi|293417098|ref|ZP_06659725.1| large subunit ribosomal protein L28 [Escherichia coli B185]
 gi|293463961|ref|ZP_06664375.1| 50S ribosomal protein L28 [Escherichia coli B088]
 gi|297521447|ref|ZP_06939833.1| 50S ribosomal protein L28 [Escherichia coli OP50]
 gi|298383006|ref|ZP_06992601.1| 50S ribosomal protein L28 [Escherichia coli FVEC1302]
 gi|306816015|ref|ZP_07450153.1| 50S ribosomal protein L28 [Escherichia coli NC101]
 gi|307140335|ref|ZP_07499691.1| 50S ribosomal protein L28 [Escherichia coli H736]
 gi|307314278|ref|ZP_07593886.1| ribosomal protein L28 [Escherichia coli W]
 gi|331644355|ref|ZP_08345484.1| ribosomal protein L28 [Escherichia coli H736]
 gi|331649452|ref|ZP_08350538.1| ribosomal protein L28 [Escherichia coli M605]
 gi|331655269|ref|ZP_08356268.1| ribosomal protein L28 [Escherichia coli M718]
 gi|331659957|ref|ZP_08360895.1| ribosomal protein L28 [Escherichia coli TA206]
 gi|331665262|ref|ZP_08366163.1| ribosomal protein L28 [Escherichia coli TA143]
 gi|331670477|ref|ZP_08371316.1| ribosomal protein L28 [Escherichia coli TA271]
 gi|331675117|ref|ZP_08375874.1| ribosomal protein L28 [Escherichia coli TA280]
 gi|331679728|ref|ZP_08380398.1| ribosomal protein L28 [Escherichia coli H591]
 gi|331685300|ref|ZP_08385886.1| ribosomal protein L28 [Escherichia coli H299]
 gi|332282593|ref|ZP_08395006.1| 50S ribosomal subunit protein L28 [Shigella sp. D9]
 gi|67472014|sp|P0A7M2|RL28_ECOLI RecName: Full=50S ribosomal protein L28
 gi|67472015|sp|P0A7M3|RL28_ECOL6 RecName: Full=50S ribosomal protein L28
 gi|67472016|sp|P0A7M4|RL28_ECO57 RecName: Full=50S ribosomal protein L28
 gi|67472017|sp|P0A7M5|RL28_SHIFL RecName: Full=50S ribosomal protein L28
 gi|122421887|sp|Q1R4V5|RL28_ECOUT RecName: Full=50S ribosomal protein L28
 gi|123343463|sp|Q0TBH2|RL28_ECOL5 RecName: Full=50S ribosomal protein L28
 gi|123561125|sp|Q329M0|RL28_SHIDS RecName: Full=50S ribosomal protein L28
 gi|123615831|sp|Q3YVZ9|RL28_SHISS RecName: Full=50S ribosomal protein L28
 gi|166226582|sp|A6TFM8|RL28_KLEP7 RecName: Full=50S ribosomal protein L28
 gi|166987910|sp|A7ZTI8|RL28_ECO24 RecName: Full=50S ribosomal protein L28
 gi|166987911|sp|A8A699|RL28_ECOHS RecName: Full=50S ribosomal protein L28
 gi|189029439|sp|B1IZF6|RL28_ECOLC RecName: Full=50S ribosomal protein L28
 gi|226694559|sp|B7NPZ8|RL28_ECO7I RecName: Full=50S ribosomal protein L28
 gi|226694669|sp|B7M4C1|RL28_ECO8A RecName: Full=50S ribosomal protein L28
 gi|226694688|sp|B1X971|RL28_ECODH RecName: Full=50S ribosomal protein L28
 gi|226694704|sp|B7NEU1|RL28_ECOLU RecName: Full=50S ribosomal protein L28
 gi|226694756|sp|B6I3L4|RL28_ECOSE RecName: Full=50S ribosomal protein L28
 gi|226694761|sp|B1LK74|RL28_ECOSM RecName: Full=50S ribosomal protein L28
 gi|226694789|sp|B7LVJ8|RL28_ESCF3 RecName: Full=50S ribosomal protein L28
 gi|226699166|sp|B2TTV1|RL28_SHIB3 RecName: Full=50S ribosomal protein L28
 gi|226732829|sp|B7MFJ8|RL28_ECO45 RecName: Full=50S ribosomal protein L28
 gi|226732830|sp|B5YWD5|RL28_ECO5E RecName: Full=50S ribosomal protein L28
 gi|254801358|sp|B7ULJ2|RL28_ECO27 RecName: Full=50S ribosomal protein L28
 gi|254801359|sp|B7L760|RL28_ECO55 RecName: Full=50S ribosomal protein L28
 gi|254801360|sp|B7N277|RL28_ECO81 RecName: Full=50S ribosomal protein L28
 gi|259646735|sp|C4ZXM9|RL28_ECOBW RecName: Full=50S ribosomal protein L28
 gi|157836074|pdb|2QOV|Z Chain Z, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli In Complex With Spectinomycin. This
          File Contains The 50s Subunit Of The First 70s
          Ribosome. The Entire Crystal Structure Contains Two 70s
          Ribosomes.
 gi|157836126|pdb|2QOX|Z Chain Z, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli In Complex With Spectinomycin. This
          File Contains The 50s Subunit Of The Second 70s
          Ribosome. The Entire Crystal Structure Contains Two 70s
          Ribosomes.
 gi|157836178|pdb|2QOZ|Z Chain Z, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli In Complex With Spectinomycin And
          Neomycin. This File Contains The 50s Subunit Of The
          First 70s Ribosome, With Neomycin Bound. The Entire
          Crystal Structure Contains Two 70s Ribosomes.
 gi|157836230|pdb|2QP1|Z Chain Z, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli In Complex With Spectinomycin And
          Neomycin. This File Contains The 50s Subunit Of The
          Second 70s Ribosome, With Neomycin Bound. The Entire
          Crystal Structure Contains Two 70s Ribosomes.
 gi|158429749|pdb|2QAM|Z Chain Z, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli In Complex With Neomycin. This File
          Contains The 50s Subunit Of The First 70s Ribosome,
          With Neomycin Bound. The Entire Crystal Structure
          Contains Two 70s Ribosomes And Is Described In Remark
          400.
 gi|158429801|pdb|2QAO|Z Chain Z, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli In Complex With Neomycin. This File
          Contains The 50s Subunit Of The Second 70s Ribosome,
          With Neomycin Bound. The Entire Crystal Structure
          Contains Two 70s Ribosomes And Is Described In Remark
          400.
 gi|158429859|pdb|2QBA|Z Chain Z, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli In Complex With Gentamicin. This File
          Contains The 50s Subunit Of The First 70s Ribosome,
          With Gentamicin Bound. The Entire Crystal Structure
          Contains Two 70s Ribosomes And Is Described In Remark
          400.
 gi|158429911|pdb|2QBC|Z Chain Z, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli In Complex With Gentamicin. This File
          Contains The 50s Subunit Of The Second 70s Ribosome,
          With Gentamicin Bound. The Entire Crystal Structure
          Contains Two 70s Ribosomes And Is Described In Remark
          400.
 gi|158429963|pdb|2QBE|Z Chain Z, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli In Complex With Ribosome Recycling
          Factor (Rrf). This File Contains The 50s Subunit Of The
          First 70s Ribosome, With Rrf Bound. The Entire Crystal
          Structure Contains Two 70s Ribosomes And Is Described
          In Remark 400.
 gi|158430016|pdb|2QBG|Z Chain Z, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli In Complex With Ribosome Recycling
          Factor (Rrf). This File Contains The 50s Subunit Of The
          Second 70s Ribosome, With Rrf Bound. The Entire Crystal
          Structure Contains Two 70s Ribosomes And Is Described
          In Remark 400.
 gi|158430069|pdb|2QBI|Z Chain Z, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli In Complex With Gentamicin And
          Ribosome Recycling Factor (Rrf). This File Contains The
          50s Subunit Of The First 70s Ribosome, With Gentamicin
          And Rrf Bound. The Entire Crystal Structure Contains
          Two 70s Ribosomes And Is Described In Remark 400.
 gi|158430122|pdb|2QBK|Z Chain Z, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli In Complex With Gentamicin And
          Ribosome Recycling Factor (Rrf). This File Contains The
          50s Subunit Of The Second 70s Ribosome, With Gentamicin
          And Rrf Bound. The Entire Crystal Structure Contains
          Two 70s Ribosomes And Is Described In Remark 400.
 gi|158431422|pdb|2Z4L|Z Chain Z, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli In Complex With Paromomycin And
          Ribosome Recycling Factor (Rrf). This File Contains The
          50s Subunit Of The First 70s Ribosome, With Paromomycin
          And Rrf Bound. The Entire Crystal Structure Contains
          Two 70s Ribosomes And Is Described In Remark 400.
 gi|158431475|pdb|2Z4N|Z Chain Z, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli In Complex With Paromomycin And
          Ribosome Recycling Factor (Rrf). This File Contains The
          50s Subunit Of The Second 70s Ribosome, With
          Paromomycin And Rrf Bound. The Entire Crystal Structure
          Contains Two 70s Ribosomes And Is Described In Remark
          400.
 gi|197107324|pdb|3DF2|Z Chain Z, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli In Complex With Hygromycin B. This
          File Contains The 50s Subunit Of The First 70s
          Ribosome. The Entire Crystal Structure Contains Two 70s
          Ribosomes.
 gi|197107376|pdb|3DF4|Z Chain Z, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli In Complex With Hygromycin B. This
          File Contains The 50s Subunit Of The Second 70s
          Ribosome. The Entire Crystal Structure Contains Two 70s
          Ribosomes.
 gi|257097365|pdb|3I1N|X Chain X, Crystal Structure Of The E. Coli 70s Ribosome In An
          Intermediate State Of Ratcheting
 gi|257097417|pdb|3I1P|X Chain X, Crystal Structure Of The E. Coli 70s Ribosome In An
          Intermediate State Of Ratcheting
 gi|257097471|pdb|3I1R|X Chain X, Crystal Structure Of The E. Coli 70s Ribosome In An
          Intermediate State Of Ratcheting
 gi|257097525|pdb|3I1T|X Chain X, Crystal Structure Of The E. Coli 70s Ribosome In An
          Intermediate State Of Ratcheting
 gi|257097580|pdb|3I20|X Chain X, Crystal Structure Of The E. Coli 70s Ribosome In An
          Intermediate State Of Ratcheting
 gi|257097635|pdb|3I22|X Chain X, Crystal Structure Of The E. Coli 70s Ribosome In An
          Intermediate State Of Ratcheting
 gi|290560355|pdb|3KCR|X Chain X, Ribosome-Secy Complex. This Entry 3kcr Contains 50s
          Ribosomal Subnit. The 30s Ribosomal Subunit Can Be
          Found In Pdb Entry 3kc4
 gi|308198378|pdb|1VT2|X Chain X, Crystal Structure Of The E. Coli Ribosome Bound To
          Cem-101. This File Contains The 50s Subunit Of The
          Second 70s Ribosome.
 gi|308198752|pdb|3ORB|X Chain X, Crystal Structure Of The E. Coli Ribosome Bound To
          Cem-101. This File Contains The 50s Subunit Of The
          First 70s Ribosome Bound To Cem-101.
 gi|326634233|pdb|3IZT|Y Chain Y, Structural Insights Into Cognate Vs. Near-Cognate
          Discrimination During Decoding. This Entry Contains The
          Large Subunit Of A Ribosome Programmed With A
          Near-Cognate Codon.
 gi|326634266|pdb|3IZU|Y Chain Y, Structural Insights Into Cognate Vs. Near-Cognate
          Discrimination During Decoding. This Entry Contains The
          Large Subunit Of A Ribosome Programmed With A Cognate
          Codon
 gi|12518393|gb|AAG58781.1|AE005591_5 50S ribosomal subunit protein L28 [Escherichia coli O157:H7 str.
          EDL933]
 gi|26110713|gb|AAN82897.1|AE016769_12 50S ribosomal protein L28 [Escherichia coli CFT073]
 gi|147708|gb|AAA74099.1| ribosomal protein L28 [Escherichia coli]
 gi|290487|gb|AAA61990.1| 50S ribosomal subunit protein L28 [Escherichia coli]
 gi|1790068|gb|AAC76661.1| 50S ribosomal subunit protein L28 [Escherichia coli str. K-12
          substr. MG1655]
 gi|13363987|dbj|BAB37935.1| 50S ribosomal subunit protein L28 [Escherichia coli O157:H7 str.
          Sakai]
 gi|24054148|gb|AAN45123.1| 50S ribosomal subunit protein L28 [Shigella flexneri 2a str. 301]
 gi|30043348|gb|AAP19069.1| 50S ribosomal subunit protein L28 [Shigella flexneri 2a str.
          2457T]
 gi|73857606|gb|AAZ90313.1| 50S ribosomal subunit protein L28 [Shigella sonnei Ss046]
 gi|81243275|gb|ABB63985.1| 50S ribosomal subunit protein L28 [Shigella dysenteriae Sd197]
 gi|85676405|dbj|BAE77655.1| 50S ribosomal subunit protein L28 [Escherichia coli str. K12
          substr. W3110]
 gi|91074728|gb|ABE09609.1| 50S ribosomal subunit protein L28 [Escherichia coli UTI89]
 gi|110345470|gb|ABG71707.1| 50S ribosomal protein L28 [Escherichia coli 536]
 gi|150957332|gb|ABR79362.1| 50S ribosomal protein L28 [Klebsiella pneumoniae subsp.
          pneumoniae MGH 78578]
 gi|157068798|gb|ABV08053.1| ribosomal protein L28 [Escherichia coli HS]
 gi|157077877|gb|ABV17585.1| ribosomal protein L28 [Escherichia coli E24377A]
 gi|169753061|gb|ACA75760.1| ribosomal protein L28 [Escherichia coli ATCC 8739]
 gi|169890980|gb|ACB04687.1| 50S ribosomal subunit protein L28 [Escherichia coli str. K-12
          substr. DH10B]
 gi|170518333|gb|ACB16511.1| ribosomal protein L28 [Escherichia coli SMS-3-5]
 gi|187429130|gb|ACD08404.1| ribosomal protein L28 [Shigella boydii CDC 3083-94]
 gi|187771406|gb|EDU35250.1| ribosomal protein L28 [Escherichia coli O157:H7 str. EC4196]
 gi|188016990|gb|EDU55112.1| ribosomal protein L28 [Escherichia coli O157:H7 str. EC4113]
 gi|188491244|gb|EDU66347.1| ribosomal protein L28 [Escherichia coli 53638]
 gi|189002221|gb|EDU71207.1| ribosomal protein L28 [Escherichia coli O157:H7 str. EC4076]
 gi|189359118|gb|EDU77537.1| ribosomal protein L28 [Escherichia coli O157:H7 str. EC4401]
 gi|189364784|gb|EDU83203.1| ribosomal protein L28 [Escherichia coli O157:H7 str. EC4486]
 gi|189369658|gb|EDU88074.1| ribosomal protein L28 [Escherichia coli O157:H7 str. EC4501]
 gi|189374402|gb|EDU92818.1| ribosomal protein L28 [Escherichia coli O157:H7 str. EC869]
 gi|189378795|gb|EDU97211.1| ribosomal protein L28 [Escherichia coli O157:H7 str. EC508]
 gi|190902153|gb|EDV61896.1| ribosomal protein L28 [Escherichia coli B7A]
 gi|190909355|gb|EDV68941.1| ribosomal protein L28 [Escherichia coli F11]
 gi|192930492|gb|EDV83099.1| ribosomal protein L28 [Escherichia coli E22]
 gi|192956288|gb|EDV86749.1| ribosomal protein L28 [Escherichia coli E110019]
 gi|194420691|gb|EDX36767.1| ribosomal protein L28 [Shigella dysenteriae 1012]
 gi|194425227|gb|EDX41211.1| ribosomal protein L28 [Escherichia coli 101-1]
 gi|208734084|gb|EDZ82771.1| ribosomal protein L28 [Escherichia coli O157:H7 str. EC4045]
 gi|208738761|gb|EDZ86443.1| ribosomal protein L28 [Escherichia coli O157:H7 str. EC4042]
 gi|209158682|gb|ACI36115.1| ribosomal protein L28 [Escherichia coli O157:H7 str. EC4115]
 gi|209754648|gb|ACI75636.1| 50S ribosomal subunit protein L28 [Escherichia coli]
 gi|209754650|gb|ACI75637.1| 50S ribosomal subunit protein L28 [Escherichia coli]
 gi|209754652|gb|ACI75638.1| 50S ribosomal subunit protein L28 [Escherichia coli]
 gi|209754654|gb|ACI75639.1| 50S ribosomal subunit protein L28 [Escherichia coli]
 gi|209754656|gb|ACI75640.1| 50S ribosomal subunit protein L28 [Escherichia coli]
 gi|209914367|dbj|BAG79441.1| 50S ribosomal protein L28 [Escherichia coli SE11]
 gi|215266988|emb|CAS11433.1| 50S ribosomal subunit protein L28 [Escherichia coli O127:H6 str.
          E2348/69]
 gi|217320553|gb|EEC28977.1| ribosomal protein L28 [Escherichia coli O157:H7 str. TW14588]
 gi|218354090|emb|CAV00641.1| 50S ribosomal subunit protein L28 [Escherichia coli 55989]
 gi|218358706|emb|CAQ91362.1| 50S ribosomal subunit protein L28 [Escherichia fergusonii ATCC
          35469]
 gi|218362967|emb|CAR00604.1| 50S ribosomal subunit protein L28 [Escherichia coli IAI1]
 gi|218367478|emb|CAR05260.1| 50S ribosomal subunit protein L28 [Escherichia coli S88]
 gi|218372389|emb|CAR20263.1| 50S ribosomal subunit protein L28 [Escherichia coli IAI39]
 gi|218429485|emb|CAR10448.2| 50S ribosomal subunit protein L28 [Escherichia coli ED1a]
 gi|218434368|emb|CAR15292.1| 50S ribosomal subunit protein L28 [Escherichia coli UMN026]
 gi|222035345|emb|CAP78090.1| 50S ribosomal protein L28 [Escherichia coli LF82]
 gi|226838801|gb|EEH70828.1| ribosomal protein L28 [Escherichia sp. 1_1_43]
 gi|226902672|gb|EEH88931.1| 50S ribosomal subunit protein L28 [Escherichia sp. 3_2_53FAA]
 gi|238549406|dbj|BAH65757.1| 50S ribosomal protein L28 [Klebsiella pneumoniae subsp.
          pneumoniae NTUH-K2044]
 gi|238859866|gb|ACR61864.1| 50S ribosomal subunit protein L28 [Escherichia coli BW2952]
 gi|242379161|emb|CAQ33963.1| 50S ribosomal subunit protein L28, subunit of 50S ribosomal
          subunit and ribosome [Escherichia coli BL21(DE3)]
 gi|253322566|gb|ACT27168.1| ribosomal protein L28 [Escherichia coli 'BL21-Gold(DE3)pLysS AG']
 gi|253975466|gb|ACT41137.1| 50S ribosomal protein L28 [Escherichia coli B str. REL606]
 gi|253979622|gb|ACT45292.1| 50S ribosomal protein L28 [Escherichia coli BL21(DE3)]
 gi|254594992|gb|ACT74353.1| 50S ribosomal subunit protein L28 [Escherichia coli O157:H7 str.
          TW14359]
 gi|257756617|dbj|BAI28119.1| 50S ribosomal subunit protein L28 [Escherichia coli O26:H11 str.
          11368]
 gi|257761745|dbj|BAI33242.1| 50S ribosomal subunit protein L28 [Escherichia coli O103:H2 str.
          12009]
 gi|257766723|dbj|BAI38218.1| 50S ribosomal subunit protein L28 [Escherichia coli O111:H- str.
          11128]
 gi|260447344|gb|ACX37766.1| ribosomal protein L28 [Escherichia coli DH1]
 gi|281180683|dbj|BAI57013.1| 50S ribosomal protein L28 [Escherichia coli SE15]
 gi|281603000|gb|ADA75984.1| 50S ribosomal protein L28 [Shigella flexneri 2002017]
 gi|284923670|emb|CBG36767.1| 50S ribosomal subunit protein L28 [Escherichia coli 042]
 gi|290764881|gb|ADD58842.1| 50S ribosomal protein L28 [Escherichia coli O55:H7 str. CB9615]
 gi|291321593|gb|EFE61029.1| 50S ribosomal protein L28 [Escherichia coli B088]
 gi|291426071|gb|EFE99105.1| LSU ribosomal protein L28p [Escherichia coli FVEC1412]
 gi|291431129|gb|EFF04122.1| large subunit ribosomal protein L28 [Escherichia coli B185]
 gi|291468718|gb|EFF11211.1| conserved hypothetical protein [Escherichia coli B354]
 gi|294490585|gb|ADE89341.1| ribosomal protein L28 [Escherichia coli IHE3034]
 gi|298276842|gb|EFI18360.1| 50S ribosomal protein L28 [Escherichia coli FVEC1302]
 gi|305850411|gb|EFM50868.1| 50S ribosomal protein L28 [Escherichia coli NC101]
 gi|306906101|gb|EFN36620.1| ribosomal protein L28 [Escherichia coli W]
 gi|307555736|gb|ADN48511.1| 50S ribosomal subunit protein L28 [Escherichia coli ABU 83972]
 gi|307628710|gb|ADN73014.1| 50S ribosomal protein L28 [Escherichia coli UM146]
 gi|309704039|emb|CBJ03385.1| 50S ribosomal subunit protein L28 [Escherichia coli ETEC H10407]
 gi|312948198|gb|ADR29025.1| 50S ribosomal protein L28 [Escherichia coli O83:H1 str. NRG 857C]
 gi|313647489|gb|EFS11939.1| ribosomal protein L28 [Shigella flexneri 2a str. 2457T]
 gi|315062925|gb|ADT77252.1| 50S ribosomal subunit protein L28 [Escherichia coli W]
 gi|315138219|dbj|BAJ45378.1| 50S ribosomal protein L28 [Escherichia coli DH1]
 gi|315618660|gb|EFU99246.1| ribosomal protein L28 [Escherichia coli 3431]
 gi|320644983|gb|EFX14013.1| 50S ribosomal protein L28 [Escherichia coli O157:H- str. 493-89]
 gi|320650250|gb|EFX18739.1| 50S ribosomal protein L28 [Escherichia coli O157:H- str. H 2687]
 gi|320655602|gb|EFX23530.1| 50S ribosomal protein L28 [Escherichia coli O55:H7 str. 3256-97
          TW 07815]
 gi|320661336|gb|EFX28760.1| 50S ribosomal protein L28 [Escherichia coli O55:H7 str. USDA
          5905]
 gi|320666350|gb|EFX33349.1| 50S ribosomal protein L28 [Escherichia coli O157:H7 str. LSU-61]
 gi|323173230|gb|EFZ58859.1| ribosomal protein L28 [Escherichia coli LT-68]
 gi|323376482|gb|ADX48750.1| ribosomal protein L28 [Escherichia coli KO11]
 gi|323934818|gb|EGB31200.1| ribosomal L28 family protein [Escherichia coli E1520]
 gi|323939604|gb|EGB35810.1| ribosomal L28 family protein [Escherichia coli E482]
 gi|323944090|gb|EGB40170.1| ribosomal L28 family protein [Escherichia coli H120]
 gi|323949876|gb|EGB45760.1| ribosomal L28 family protein [Escherichia coli H252]
 gi|323954823|gb|EGB50603.1| ribosomal L28 family protein [Escherichia coli H263]
 gi|323959885|gb|EGB55533.1| ribosomal L28 family protein [Escherichia coli H489]
 gi|323965903|gb|EGB61351.1| ribosomal L28 family protein [Escherichia coli M863]
 gi|323971279|gb|EGB66524.1| ribosomal L28 family protein [Escherichia coli TA007]
 gi|323975143|gb|EGB70248.1| ribosomal L28 family protein [Escherichia coli TW10509]
 gi|324111531|gb|EGC05512.1| ribosomal L28 family protein [Escherichia fergusonii B253]
 gi|324116024|gb|EGC09950.1| ribosomal L28 family protein [Escherichia coli E1167]
 gi|331036649|gb|EGI08875.1| ribosomal protein L28 [Escherichia coli H736]
 gi|331041950|gb|EGI14094.1| ribosomal protein L28 [Escherichia coli M605]
 gi|331047284|gb|EGI19362.1| ribosomal protein L28 [Escherichia coli M718]
 gi|331053172|gb|EGI25205.1| ribosomal protein L28 [Escherichia coli TA206]
 gi|331057772|gb|EGI29758.1| ribosomal protein L28 [Escherichia coli TA143]
 gi|331062539|gb|EGI34459.1| ribosomal protein L28 [Escherichia coli TA271]
 gi|331068026|gb|EGI39424.1| ribosomal protein L28 [Escherichia coli TA280]
 gi|331072900|gb|EGI44225.1| ribosomal protein L28 [Escherichia coli H591]
 gi|331077671|gb|EGI48883.1| ribosomal protein L28 [Escherichia coli H299]
 gi|332084501|gb|EGI89696.1| ribosomal protein L28 [Shigella dysenteriae 155-74]
 gi|332104945|gb|EGJ08291.1| 50S ribosomal subunit protein L28 [Shigella sp. D9]
 gi|332749908|gb|EGJ80320.1| ribosomal protein L28 [Shigella flexneri K-671]
 gi|332750594|gb|EGJ81002.1| ribosomal protein L28 [Shigella flexneri 4343-70]
          Length = 78

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 44/70 (62%), Gaps = 1/70 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  ++GN  SHA N T+RRFLPNL       +  ++   LR+S   +R ++
Sbjct: 1  MSRVCQVTGKRPVTGNNRSHALNATKRRFLPNLHSHRFWVESEKRFVTLRVSAKGMRVID 60

Query: 61 RQGGLDRFLS 70
          ++ G+D  L+
Sbjct: 61 KK-GIDTVLA 69


>gi|291619456|ref|YP_003522198.1| RpmB [Pantoea ananatis LMG 20103]
 gi|304399016|ref|ZP_07380885.1| ribosomal protein L28 [Pantoea sp. aB]
 gi|291154486|gb|ADD79070.1| RpmB [Pantoea ananatis LMG 20103]
 gi|304353476|gb|EFM17854.1| ribosomal protein L28 [Pantoea sp. aB]
 gi|327395779|dbj|BAK13201.1| 50S ribosomal subunit protein L28 RpmB [Pantoea ananatis AJ13355]
          Length = 78

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 45/71 (63%), Gaps = 1/71 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  ++GN  SHA N T+RRFLPNL       +  ++   LR+S   +R ++
Sbjct: 1  MSRVCQVTGKRPVTGNNRSHAMNATKRRFLPNLHSHRFWVESEKRFVTLRVSVKGMRIID 60

Query: 61 RQGGLDRFLSN 71
          ++ G+D  L++
Sbjct: 61 KK-GIDTVLAD 70


>gi|332139462|ref|YP_004425200.1| ribosomal protein L28 [Alteromonas macleodii str. 'Deep ecotype']
 gi|226738024|sp|B4S2C3|RL28_ALTMD RecName: Full=50S ribosomal protein L28
 gi|327549484|gb|AEA96202.1| ribosomal protein L28 [Alteromonas macleodii str. 'Deep ecotype']
          Length = 78

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K    GN  SHA N TRRRFLPNL       +   +  +LR+S   +R ++
Sbjct: 1  MSRVCQVTGKRPTVGNNRSHARNATRRRFLPNLQTHRFWVESESRFVKLRLSAKGMRIID 60

Query: 61 RQGGLDRFLSN 71
          ++ G+D  L++
Sbjct: 61 KK-GIDSVLTD 70


>gi|227115113|ref|ZP_03828769.1| 50S ribosomal protein L28 [Pectobacterium carotovorum subsp.
          brasiliensis PBR1692]
 gi|227328062|ref|ZP_03832086.1| 50S ribosomal protein L28 [Pectobacterium carotovorum subsp.
          carotovorum WPP14]
 gi|253690460|ref|YP_003019650.1| ribosomal protein L28 [Pectobacterium carotovorum subsp.
          carotovorum PC1]
 gi|261823582|ref|YP_003261688.1| 50S ribosomal protein L28 [Pectobacterium wasabiae WPP163]
 gi|259646746|sp|C6DIC0|RL28_PECCP RecName: Full=50S ribosomal protein L28
 gi|251757038|gb|ACT15114.1| ribosomal protein L28 [Pectobacterium carotovorum subsp.
          carotovorum PC1]
 gi|261607595|gb|ACX90081.1| ribosomal protein L28 [Pectobacterium wasabiae WPP163]
          Length = 78

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 40/63 (63%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  ++GN  SHA N T+RRFLPNL       +  ++   LR+S   +R ++
Sbjct: 1  MSRVCQVTGKRPVAGNNRSHALNATKRRFLPNLHSHRFWVEGEKRFVTLRVSAKGMRVID 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|82546000|ref|YP_409947.1| 50S ribosomal protein L28 [Shigella boydii Sb227]
 gi|123558301|sp|Q31UY9|RL28_SHIBS RecName: Full=50S ribosomal protein L28
 gi|81247411|gb|ABB68119.1| 50S ribosomal subunit protein L28 [Shigella boydii Sb227]
 gi|332089447|gb|EGI94551.1| ribosomal protein L28 [Shigella boydii 3594-74]
          Length = 78

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 44/70 (62%), Gaps = 1/70 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  ++GN  SHA N T+RRFLPNL       +  ++   LR+S   +R ++
Sbjct: 1  MSRVCQVTGKRPVTGNNRSHALNATKRRFLPNLHSHRFWVESEKRFVTLRVSAKGMRVID 60

Query: 61 RQGGLDRFLS 70
          ++ G+D  L+
Sbjct: 61 KK-GIDTVLA 69


>gi|50119107|ref|YP_048274.1| 50S ribosomal protein L28 [Pectobacterium atrosepticum SCRI1043]
 gi|67461395|sp|Q6DAV6|RL28_ERWCT RecName: Full=50S ribosomal protein L28
 gi|49609633|emb|CAG73066.1| 50S ribosomal protein L28 [Pectobacterium atrosepticum SCRI1043]
          Length = 78

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 40/63 (63%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  ++GN  SHA N T+RRFLPNL       +  ++   LR+S   +R ++
Sbjct: 1  MSRVCQVTGKRPVAGNNRSHALNATKRRFLPNLHSHRFWVEGEKRFVTLRVSAKGMRVID 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|239996972|ref|ZP_04717496.1| ribosomal protein L28 [Alteromonas macleodii ATCC 27126]
          Length = 78

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K    GN  SHA N TRRRFLPNL       +   +  +LR+S   +R ++
Sbjct: 1  MSRVCQVTGKRPTVGNNRSHARNATRRRFLPNLQTHRFWVESENRFVKLRLSAKGMRIID 60

Query: 61 RQGGLDRFLSN 71
          ++ G+D  L++
Sbjct: 61 KK-GIDSVLTD 70


>gi|170766820|ref|ZP_02901273.1| ribosomal protein L28 [Escherichia albertii TW07627]
 gi|170124258|gb|EDS93189.1| ribosomal protein L28 [Escherichia albertii TW07627]
          Length = 78

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 44/70 (62%), Gaps = 1/70 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  ++GN  SHA N T+RRFLPNL       +  ++   LR+S   +R ++
Sbjct: 1  MSRVCQVTGKRPVTGNNRSHALNATKRRFLPNLHSHRFWVESEKRFVTLRVSAKGMRVID 60

Query: 61 RQGGLDRFLS 70
          ++ G+D  L+
Sbjct: 61 KK-GIDTVLA 69


>gi|67461390|sp|Q6AML3|RL28_DESPS RecName: Full=50S ribosomal protein L28
          Length = 64

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 21/40 (52%), Positives = 33/40 (82%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLIS 40
          M++VCE+  K  ++GN VSHA+NKTRRR+LPNL ++ +++
Sbjct: 1  MAKVCEICGKGPITGNNVSHAHNKTRRRWLPNLKKVRMVT 40


>gi|312130145|ref|YP_003997485.1| lsu ribosomal protein l28p [Leadbetterella byssophila DSM 17132]
 gi|311906691|gb|ADQ17132.1| LSU ribosomal protein L28P [Leadbetterella byssophila DSM 17132]
          Length = 79

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 44/78 (56%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS+VC+++ K   +GN VSHANNK +R+F PNL       +      +L+++   +R++ 
Sbjct: 1  MSKVCQISGKRTRTGNHVSHANNKVKRKFYPNLKTKKFFLESEGVWVELKVATSVIRTIN 60

Query: 61 RQGGLDRFLSNSKKENLS 78
          + G     L  ++K  LS
Sbjct: 61 KNGLEKTILKAARKGTLS 78


>gi|238918037|ref|YP_002931551.1| 50S ribosomal protein L28 [Edwardsiella ictaluri 93-146]
 gi|259646736|sp|C5B9D6|RL28_EDWI9 RecName: Full=50S ribosomal protein L28
 gi|238867605|gb|ACR67316.1| ribosomal protein L28, putative [Edwardsiella ictaluri 93-146]
          Length = 78

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 40/63 (63%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  ++GN  SHA N T+RRFLPNL       +  ++   LR+S   +R ++
Sbjct: 1  MSRVCQVTGKRPVTGNNRSHALNATKRRFLPNLHSHRFWVEGEKRFVTLRVSAKGMRVID 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|208806801|ref|ZP_03249138.1| ribosomal protein L28 [Escherichia coli O157:H7 str. EC4206]
 gi|208726602|gb|EDZ76203.1| ribosomal protein L28 [Escherichia coli O157:H7 str. EC4206]
          Length = 85

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 40/63 (63%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  ++GN  SHA N T+RRFLPNL       +  ++   LR+S   +R ++
Sbjct: 8  MSRVCQVTGKRPVTGNNRSHALNATKRRFLPNLHSHRFWVESEKRFVTLRVSAKGMRVID 67

Query: 61 RQG 63
          ++G
Sbjct: 68 KKG 70


>gi|237728934|ref|ZP_04559415.1| 50S ribosomal protein L28 [Citrobacter sp. 30_2]
 gi|283787729|ref|YP_003367594.1| 50S ribosomal subunit protein L28 [Citrobacter rodentium ICC168]
 gi|226909556|gb|EEH95474.1| 50S ribosomal protein L28 [Citrobacter sp. 30_2]
 gi|282951183|emb|CBG90876.1| 50S ribosomal subunit protein L28 [Citrobacter rodentium ICC168]
          Length = 78

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 40/63 (63%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  ++GN  SHA N T+RRFLPNL       +  ++   LR+S   +R ++
Sbjct: 1  MSRVCQVTGKRPVTGNNRSHALNATKRRFLPNLHSHRFWVESEKRFVTLRVSAKGMRVID 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|152990068|ref|YP_001355790.1| 50S ribosomal protein L28 [Nitratiruptor sp. SB155-2]
 gi|166226590|sp|A6Q1S4|RL28_NITSB RecName: Full=50S ribosomal protein L28
 gi|151421929|dbj|BAF69433.1| 50S ribosomal protein L28 [Nitratiruptor sp. SB155-2]
          Length = 67

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 44/64 (68%), Gaps = 5/64 (7%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNL--CRITLISDIMEQKYQLRISKCALRS 58
          MS+ C++T K  ++G+ VSHANNKT+RRFLPN+   R+TL       K ++++S   LR 
Sbjct: 1  MSKKCQVTGKKPITGHNVSHANNKTKRRFLPNIRTVRVTLPDG---TKKKIKVSAKGLRI 57

Query: 59 VERQ 62
          ++++
Sbjct: 58 LKKK 61


>gi|332995182|gb|AEF05237.1| ribosomal protein L28 [Alteromonas sp. SN2]
          Length = 78

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 42/71 (59%), Gaps = 1/71 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K    GN  SHA N TRRRFLPNL       +   +  +LR+S   +R ++
Sbjct: 1  MSRVCQVTGKRPTVGNNRSHARNATRRRFLPNLHSHRFWVESENRFVKLRLSAKGMRIID 60

Query: 61 RQGGLDRFLSN 71
          +  G+D  L++
Sbjct: 61 KN-GIDSVLTD 70


>gi|329911396|ref|ZP_08275500.1| LSU ribosomal protein L28p [Oxalobacteraceae bacterium IMCC9480]
 gi|327545921|gb|EGF31021.1| LSU ribosomal protein L28p [Oxalobacteraceae bacterium IMCC9480]
          Length = 66

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 33/51 (64%)

Query: 13 MSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQG 63
          M GN VSHANNKT+RRFLPNL R  +  +   +   LR+S   LR +++ G
Sbjct: 1  MVGNNVSHANNKTKRRFLPNLQRRRIFVESENRWVSLRLSNAGLRVIDKLG 51


>gi|157738019|ref|YP_001490703.1| 50S ribosomal protein L28 [Arcobacter butzleri RM4018]
 gi|315636360|ref|ZP_07891609.1| 50S ribosomal protein L28 [Arcobacter butzleri JV22]
 gi|166987908|sp|A8EVR0|RL28_ARCB4 RecName: Full=50S ribosomal protein L28
 gi|157699873|gb|ABV68033.1| 50S ribosomal protein L28 [Arcobacter butzleri RM4018]
 gi|315479339|gb|EFU70023.1| 50S ribosomal protein L28 [Arcobacter butzleri JV22]
          Length = 62

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 30/64 (46%), Positives = 40/64 (62%), Gaps = 5/64 (7%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNL--CRITLISDIMEQKYQLRISKCALRS 58
          MSR C ++ K  M GN VSHA N+TRRRFLPN+   R+TL         +LRIS   LR+
Sbjct: 1  MSRKCAISGKGPMVGNNVSHAKNRTRRRFLPNIRTVRVTLEDGTTT---KLRISAKELRT 57

Query: 59 VERQ 62
          +++ 
Sbjct: 58 LKKH 61


>gi|151945896|gb|EDN64128.1| YmL14 [Saccharomyces cerevisiae YJM789]
 gi|190408418|gb|EDV11683.1| 60S ribosomal protein L24, mitochondrial precursor [Saccharomyces
           cerevisiae RM11-1a]
 gi|256271573|gb|EEU06615.1| Mrpl24p [Saccharomyces cerevisiae JAY291]
 gi|259148778|emb|CAY82023.1| Mrpl24p [Saccharomyces cerevisiae EC1118]
 gi|323336086|gb|EGA77359.1| Mrpl24p [Saccharomyces cerevisiae Vin13]
 gi|323347014|gb|EGA81290.1| Mrpl24p [Saccharomyces cerevisiae Lalvin QA23]
          Length = 258

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 54/90 (60%), Gaps = 11/90 (12%)

Query: 12  VMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFLSN 71
           V  GN +S +  KTR+++LPN+ +  L S+ + +K  ++++   L+++ ++GG+D +L+ 
Sbjct: 79  VQFGNNISESKAKTRKKWLPNVVKKGLWSETLNRKISIKMTAKVLKTISKEGGIDNYLTK 138

Query: 72  SKKENLSARMRT-------LRSQILKKMSE 94
            K    SAR++        LR ++LK+  E
Sbjct: 139 EK----SARIKELGPTGWKLRYRVLKRKDE 164


>gi|290477299|ref|YP_003470220.1| 50S ribosomal subunit protein L28 [Xenorhabdus bovienii SS-2004]
 gi|289176653|emb|CBJ83462.1| 50S ribosomal subunit protein L28 [Xenorhabdus bovienii SS-2004]
          Length = 78

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 40/63 (63%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  +SGN  SHA N T+RRFLPNL       +  ++   LR++   +R ++
Sbjct: 1  MSRVCQVTGKRPVSGNNRSHALNATKRRFLPNLHSHRFWVESEKRFVTLRVTAKGMRVID 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|6323847|ref|NP_013918.1| Mrpl24p [Saccharomyces cerevisiae S288c]
 gi|1350795|sp|P36525|RM24_YEAST RecName: Full=54S ribosomal protein L24, mitochondrial; AltName:
           Full=YmL14/YmL24; Flags: Precursor
 gi|642285|emb|CAA87814.1| ribosomal protein [Saccharomyces cerevisiae]
 gi|45269854|gb|AAS56308.1| YMR193W [Saccharomyces cerevisiae]
 gi|285814196|tpg|DAA10091.1| TPA: Mrpl24p [Saccharomyces cerevisiae S288c]
          Length = 258

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 54/90 (60%), Gaps = 11/90 (12%)

Query: 12  VMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFLSN 71
           V  GN +S +  KTR+++LPN+ +  L S+ + +K  ++++   L+++ ++GG+D +L+ 
Sbjct: 79  VQFGNNISESKAKTRKKWLPNVVKKGLWSETLNRKISIKMTAKVLKTISKEGGIDNYLTK 138

Query: 72  SKKENLSARMRT-------LRSQILKKMSE 94
            K    SAR++        LR ++LK+  E
Sbjct: 139 EK----SARIKELGPTGWKLRYRVLKRKDE 164


>gi|110637068|ref|YP_677275.1| 50S ribosomal protein L28P [Cytophaga hutchinsonii ATCC 33406]
 gi|123354785|sp|Q11XD1|RL28_CYTH3 RecName: Full=50S ribosomal protein L28
 gi|110279749|gb|ABG57935.1| LSU ribosomal protein L28P [Cytophaga hutchinsonii ATCC 33406]
          Length = 80

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 39/63 (61%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVC++T K   +GN VSHANNKT+R F PN+ +         +   L++S  A++++ 
Sbjct: 1  MARVCQITGKKTRTGNNVSHANNKTKRTFAPNIQKKRFFLSEENRWVTLKLSTKAIKTIS 60

Query: 61 RQG 63
           +G
Sbjct: 61 SKG 63


>gi|207342192|gb|EDZ70031.1| YMR193Wp-like protein [Saccharomyces cerevisiae AWRI1631]
          Length = 175

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 51/86 (59%), Gaps = 3/86 (3%)

Query: 12  VMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFLSN 71
           V  GN +S +  KTR+++LPN+ +  L S+ + +K  ++++   L+++ ++GG+D +L+ 
Sbjct: 79  VQFGNNISESKAKTRKKWLPNVVKKGLWSETLNRKISIKMTAKVLKTISKEGGIDNYLTK 138

Query: 72  SKK---ENLSARMRTLRSQILKKMSE 94
            K    + L      LR ++LK+  E
Sbjct: 139 EKSARIKELGPTGWKLRYRVLKRKDE 164


>gi|261867144|ref|YP_003255066.1| 50S ribosomal protein L28 [Aggregatibacter actinomycetemcomitans
          D11S-1]
 gi|261412476|gb|ACX81847.1| 50S ribosomal protein L28 [Aggregatibacter actinomycetemcomitans
          D11S-1]
          Length = 78

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 41/70 (58%), Gaps = 1/70 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K    GN  SHA N TRRRFLPNL       D   +   LR++   +R ++
Sbjct: 1  MSRVCQVTGKRPAVGNNRSHAMNATRRRFLPNLHTHRFWVDSENRFVTLRLTAKGMRIID 60

Query: 61 RQGGLDRFLS 70
          ++ G+D  L+
Sbjct: 61 KK-GIDAVLA 69


>gi|297180599|gb|ADI16810.1| hypothetical protein [uncultured gamma proteobacterium
          HF0010_11K06]
          Length = 78

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/63 (39%), Positives = 40/63 (63%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS+ C++T KT M+GN VS A NKT+R+F+PNL R     +   +   L +S   +R ++
Sbjct: 1  MSKECQVTGKTPMAGNNVSKAVNKTKRKFMPNLHRHKFWVESENKYVTLTLSAKGMRIID 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|294637896|ref|ZP_06716165.1| ribosomal protein L28 [Edwardsiella tarda ATCC 23685]
 gi|291088922|gb|EFE21483.1| ribosomal protein L28 [Edwardsiella tarda ATCC 23685]
          Length = 78

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 40/63 (63%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  ++GN  SHA N T+RRFLPNL       +  ++   LR+S   +R ++
Sbjct: 1  MSRVCQVTGKRPVTGNNRSHALNATKRRFLPNLHSHRFWVEGEKRFVTLRVSAKGMRIID 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|94499875|ref|ZP_01306411.1| ribosomal protein L28 [Oceanobacter sp. RED65]
 gi|94428076|gb|EAT13050.1| ribosomal protein L28 [Oceanobacter sp. RED65]
          Length = 78

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 27/70 (38%), Positives = 45/70 (64%), Gaps = 1/70 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M++VC++T K  ++GN VSH+N KT+RRFLPNL       +   +  +LR S   +R ++
Sbjct: 1  MAKVCQVTGKRPVTGNNVSHSNIKTKRRFLPNLQTHRFWVESENRFVKLRTSTKGMRIID 60

Query: 61 RQGGLDRFLS 70
          ++ G+D  L+
Sbjct: 61 KK-GIDTVLA 69


>gi|16762581|ref|NP_458198.1| 50S ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Typhi str. CT18]
 gi|16767013|ref|NP_462628.1| 50S ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Typhimurium str. LT2]
 gi|29144070|ref|NP_807412.1| 50S ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Typhi str. Ty2]
 gi|56415618|ref|YP_152693.1| 50S ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Paratyphi A str. ATCC 9150]
 gi|62182221|ref|YP_218638.1| 50S ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Choleraesuis str. SC-B67]
 gi|167549024|ref|ZP_02342783.1| ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Saintpaul str. SARA29]
 gi|167994349|ref|ZP_02575441.1| ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar 4,[5],12:i:- str. CVM23701]
 gi|168235333|ref|ZP_02660391.1| ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Schwarzengrund str. SL480]
 gi|168241907|ref|ZP_02666839.1| ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Heidelberg str. SL486]
 gi|168260518|ref|ZP_02682491.1| ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Hadar str. RI_05P066]
 gi|168464964|ref|ZP_02698856.1| ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Newport str. SL317]
 gi|168818442|ref|ZP_02830442.1| ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Weltevreden str. HI_N05-537]
 gi|194443533|ref|YP_002042978.1| 50S ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Newport str. SL254]
 gi|194451754|ref|YP_002047760.1| 50S ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Heidelberg str. SL476]
 gi|194471286|ref|ZP_03077270.1| ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Kentucky str. CVM29188]
 gi|194736234|ref|YP_002116663.1| 50S ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Schwarzengrund str. CVM19633]
 gi|197250195|ref|YP_002148660.1| 50S ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Agona str. SL483]
 gi|197264661|ref|ZP_03164735.1| ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Saintpaul str. SARA23]
 gi|197364545|ref|YP_002144182.1| 50S ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Paratyphi A str. AKU_12601]
 gi|198242068|ref|YP_002217689.1| 50S ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Dublin str. CT_02021853]
 gi|200387542|ref|ZP_03214154.1| ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Virchow str. SL491]
 gi|204928593|ref|ZP_03219792.1| ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Javiana str. GA_MM04042433]
 gi|205354670|ref|YP_002228471.1| 50S ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Gallinarum str. 287/91]
 gi|207858965|ref|YP_002245616.1| 50S ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Enteritidis str. P125109]
 gi|213029141|ref|ZP_03343588.1| 50S ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Typhi str. 404ty]
 gi|213161282|ref|ZP_03346992.1| 50S ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Typhi str. E00-7866]
 gi|213418640|ref|ZP_03351706.1| 50S ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Typhi str. E01-6750]
 gi|213425230|ref|ZP_03357980.1| 50S ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Typhi str. E02-1180]
 gi|213581868|ref|ZP_03363694.1| 50S ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Typhi str. E98-0664]
 gi|213615653|ref|ZP_03371479.1| 50S ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Typhi str. E98-2068]
 gi|213647925|ref|ZP_03377978.1| 50S ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Typhi str. J185]
 gi|213855128|ref|ZP_03383368.1| 50S ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Typhi str. M223]
 gi|224585528|ref|YP_002639327.1| 50S ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Paratyphi C strain RKS4594]
 gi|238910237|ref|ZP_04654074.1| 50S ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Tennessee str. CDC07-0191]
 gi|289810524|ref|ZP_06541153.1| 50S ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Typhi str. AG3]
 gi|289824122|ref|ZP_06543719.1| 50S ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Typhi str. E98-3139]
 gi|61230438|sp|P0A2A5|RL28_SALTY RecName: Full=50S ribosomal protein L28
 gi|61230442|sp|P0A2A6|RL28_SALTI RecName: Full=50S ribosomal protein L28
 gi|67461312|sp|Q5PC31|RL28_SALPA RecName: Full=50S ribosomal protein L28
 gi|75479872|sp|Q57IA5|RL28_SALCH RecName: Full=50S ribosomal protein L28
 gi|226699156|sp|B5EXE2|RL28_SALA4 RecName: Full=50S ribosomal protein L28
 gi|226699157|sp|B5FM61|RL28_SALDC RecName: Full=50S ribosomal protein L28
 gi|226699158|sp|B5R5G1|RL28_SALEP RecName: Full=50S ribosomal protein L28
 gi|226699159|sp|B5RGF0|RL28_SALG2 RecName: Full=50S ribosomal protein L28
 gi|226699160|sp|B4T9C2|RL28_SALHS RecName: Full=50S ribosomal protein L28
 gi|226699161|sp|B4SXD9|RL28_SALNS RecName: Full=50S ribosomal protein L28
 gi|226699162|sp|B5BI11|RL28_SALPK RecName: Full=50S ribosomal protein L28
 gi|226699163|sp|B4TZX9|RL28_SALSV RecName: Full=50S ribosomal protein L28
 gi|254801374|sp|C0Q1X0|RL28_SALPC RecName: Full=50S ribosomal protein L28
 gi|25295489|pir||AE0971 50S ribosomal chain protein L28 [imported] - Salmonella enterica
          subsp. enterica serovar Typhi (strain CT18)
 gi|2842791|gb|AAC01771.1| L28 [Salmonella enterica subsp. enterica serovar Typhimurium]
 gi|16422296|gb|AAL22587.1| 50S ribosomal subunit protein L28 [Salmonella enterica subsp.
          enterica serovar Typhimurium str. LT2]
 gi|16504886|emb|CAD03265.1| 50S ribosomal subunit protein L28 [Salmonella enterica subsp.
          enterica serovar Typhi]
 gi|29139707|gb|AAO71272.1| 50S ribosomal subunit protein L28 [Salmonella enterica subsp.
          enterica serovar Typhi str. Ty2]
 gi|56129875|gb|AAV79381.1| 50S ribosomal subunit protein L28 [Salmonella enterica subsp.
          enterica serovar Paratyphi A str. ATCC 9150]
 gi|62129854|gb|AAX67557.1| 50S ribosomal subunit protein L28 [Salmonella enterica subsp.
          enterica serovar Choleraesuis str. SC-B67]
 gi|194402196|gb|ACF62418.1| ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Newport str. SL254]
 gi|194410058|gb|ACF70277.1| ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Heidelberg str. SL476]
 gi|194457650|gb|EDX46489.1| ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Kentucky str. CVM29188]
 gi|194711736|gb|ACF90957.1| ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Schwarzengrund str. CVM19633]
 gi|195632365|gb|EDX50849.1| ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Newport str. SL317]
 gi|197096022|emb|CAR61609.1| 50S ribosomal subunit protein L28 [Salmonella enterica subsp.
          enterica serovar Paratyphi A str. AKU_12601]
 gi|197213898|gb|ACH51295.1| ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Agona str. SL483]
 gi|197242916|gb|EDY25536.1| ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Saintpaul str. SARA23]
 gi|197291293|gb|EDY30645.1| ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Schwarzengrund str. SL480]
 gi|197936584|gb|ACH73917.1| ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Dublin str. CT_02021853]
 gi|199604640|gb|EDZ03185.1| ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Virchow str. SL491]
 gi|204322026|gb|EDZ07224.1| ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Javiana str. GA_MM04042433]
 gi|205274451|emb|CAR39483.1| 50S ribosomal subunit protein L28 [Salmonella enterica subsp.
          enterica serovar Gallinarum str. 287/91]
 gi|205325763|gb|EDZ13602.1| ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Saintpaul str. SARA29]
 gi|205327770|gb|EDZ14534.1| ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar 4,[5],12:i:- str. CVM23701]
 gi|205338807|gb|EDZ25571.1| ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Heidelberg str. SL486]
 gi|205344302|gb|EDZ31066.1| ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Weltevreden str. HI_N05-537]
 gi|205350254|gb|EDZ36885.1| ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Hadar str. RI_05P066]
 gi|206710768|emb|CAR35129.1| 50S ribosomal subunit protein L28 [Salmonella enterica subsp.
          enterica serovar Enteritidis str. P125109]
 gi|224470056|gb|ACN47886.1| 50S ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Paratyphi C strain RKS4594]
 gi|261248876|emb|CBG26730.1| 50S ribosomal subunit protein L28 [Salmonella enterica subsp.
          enterica serovar Typhimurium str. D23580]
 gi|267995989|gb|ACY90874.1| 50S ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Typhimurium str. 14028S]
 gi|301160265|emb|CBW19788.1| 50S ribosomal subunit protein L28 [Salmonella enterica subsp.
          enterica serovar Typhimurium str. SL1344]
 gi|312914754|dbj|BAJ38728.1| 50S ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Typhimurium str. T000240]
 gi|320088148|emb|CBY97910.1| 50S ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Weltevreden str. 2007-60-3289-1]
 gi|322612894|gb|EFY09846.1| 50S ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Montevideo str. 315996572]
 gi|322618959|gb|EFY15846.1| 50S ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Montevideo str. 495297-1]
 gi|322625264|gb|EFY22091.1| 50S ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Montevideo str. 495297-3]
 gi|322630069|gb|EFY26842.1| 50S ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Montevideo str. 495297-4]
 gi|322634260|gb|EFY30995.1| 50S ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Montevideo str. 515920-1]
 gi|322635839|gb|EFY32548.1| 50S ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Montevideo str. 515920-2]
 gi|322643023|gb|EFY39600.1| 50S ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Montevideo str. 531954]
 gi|322645049|gb|EFY41580.1| 50S ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Montevideo str. NC_MB110209-0054]
 gi|322649851|gb|EFY46274.1| 50S ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Montevideo str. OH_2009072675]
 gi|322653058|gb|EFY49393.1| 50S ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Montevideo str. CASC_09SCPH15965]
 gi|322661123|gb|EFY57351.1| 50S ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Montevideo str. 19N]
 gi|322662388|gb|EFY58601.1| 50S ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Montevideo str. 81038-01]
 gi|322667266|gb|EFY63432.1| 50S ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Montevideo str. MD_MDA09249507]
 gi|322674357|gb|EFY70450.1| 50S ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Montevideo str. 414877]
 gi|322678435|gb|EFY74496.1| 50S ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Montevideo str. 366867]
 gi|322687123|gb|EFY83096.1| 50S ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Montevideo str. 446600]
 gi|322716709|gb|EFZ08280.1| 50S ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Choleraesuis str. A50]
 gi|323132088|gb|ADX19518.1| 50S ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Typhimurium str. 4/74]
 gi|323195847|gb|EFZ81019.1| 50S ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Montevideo str. 609458-1]
 gi|323198236|gb|EFZ83342.1| 50S ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Montevideo str. 556150-1]
 gi|323200854|gb|EFZ85924.1| 50S ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Montevideo str. 609460]
 gi|323206608|gb|EFZ91566.1| 50S ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Montevideo str. 507440-20]
 gi|323216233|gb|EGA00961.1| 50S ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Montevideo str. MB101509-0077]
 gi|323220456|gb|EGA04910.1| 50S ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Montevideo str. MB102109-0047]
 gi|323225319|gb|EGA09553.1| 50S ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Montevideo str. MB110209-0055]
 gi|323228433|gb|EGA12564.1| 50S ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Montevideo str. MB111609-0052]
 gi|323234254|gb|EGA18342.1| 50S ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Montevideo str. 2009083312]
 gi|323237239|gb|EGA21306.1| 50S ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Montevideo str. 2009085258]
 gi|323244758|gb|EGA28762.1| 50S ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Montevideo str. 315731156]
 gi|323245867|gb|EGA29857.1| 50S ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Montevideo str. IA_2009159199]
 gi|323250950|gb|EGA34826.1| 50S ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Montevideo str. IA_2010008282]
 gi|323262226|gb|EGA45787.1| 50S ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Montevideo str. IA_2010008284]
 gi|323264563|gb|EGA48067.1| 50S ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Montevideo str. IA_2010008285]
 gi|323268853|gb|EGA52311.1| 50S ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Montevideo str. IA_2010008287]
 gi|326625473|gb|EGE31818.1| 50S ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Dublin str. 3246]
 gi|326629809|gb|EGE36152.1| 50S ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Gallinarum str. 9]
 gi|332990577|gb|AEF09560.1| 50S ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Typhimurium str. UK-1]
          Length = 78

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 40/63 (63%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  ++GN  SHA N T+RRFLPNL       +  ++   LR+S   +R ++
Sbjct: 1  MSRVCQVTGKRPVTGNNRSHALNATKRRFLPNLHSHRFWVESEKRFVTLRVSAKGMRIID 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|297170291|gb|ADI21327.1| hypothetical protein [uncultured gamma proteobacterium
          HF0010_10D20]
          Length = 78

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 44/71 (61%), Gaps = 1/71 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS++C++T K  M+GN VS A N+T+RRFLPNL +     +   +   L +S   +R ++
Sbjct: 1  MSKICQVTGKKPMAGNNVSKALNRTKRRFLPNLNQHKFWVESENKYVSLTVSAKGMRIID 60

Query: 61 RQGGLDRFLSN 71
          ++ G+D  L +
Sbjct: 61 KK-GIDEVLKD 70


>gi|51245535|ref|YP_065419.1| 50S ribosomal protein L28 [Desulfotalea psychrophila LSv54]
 gi|50876572|emb|CAG36412.1| probable 50S ribosomal protein L28 [Desulfotalea psychrophila
          LSv54]
          Length = 77

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 21/40 (52%), Positives = 33/40 (82%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLIS 40
          M++VCE+  K  ++GN VSHA+NKTRRR+LPNL ++ +++
Sbjct: 14 MAKVCEICGKGPITGNNVSHAHNKTRRRWLPNLKKVRMVT 53


>gi|260774467|ref|ZP_05883381.1| LSU ribosomal protein L28p [Vibrio metschnikovii CIP 69.14]
 gi|260610594|gb|EEX35799.1| LSU ribosomal protein L28p [Vibrio metschnikovii CIP 69.14]
          Length = 78

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 29/79 (36%), Positives = 50/79 (63%), Gaps = 3/79 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  ++GN  SHA N T+RRFLPNL       +  ++  +LR++   +R ++
Sbjct: 1  MSRVCQVTGKRPITGNNRSHARNATKRRFLPNLQTHRFWVESEKRFVKLRLTAKGMRIID 60

Query: 61 RQGGLDRFLSN--SKKENL 77
          ++ G+D  L +  ++ EN+
Sbjct: 61 KK-GIDAVLVDIRARGENV 78


>gi|85710818|ref|ZP_01041879.1| Ribosomal protein L28 [Idiomarina baltica OS145]
 gi|85695222|gb|EAQ33159.1| Ribosomal protein L28 [Idiomarina baltica OS145]
          Length = 78

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 44/71 (61%), Gaps = 1/71 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS+VC++T K  + GN  SHA N T+RRFLPNL       +  ++  +LRIS   +R ++
Sbjct: 1  MSQVCQVTGKRPVVGNNRSHARNATKRRFLPNLQTHRFWVESEKRWVKLRISTKGMRIID 60

Query: 61 RQGGLDRFLSN 71
          +  G+D  L++
Sbjct: 61 KN-GIDSVLAD 70


>gi|323143807|ref|ZP_08078474.1| ribosomal protein L28 [Succinatimonas hippei YIT 12066]
 gi|322416399|gb|EFY07066.1| ribosomal protein L28 [Succinatimonas hippei YIT 12066]
          Length = 78

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 44/71 (61%), Gaps = 1/71 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K    GN  SHA N  +RRFLPNL       +   +  +LR++  A+R+++
Sbjct: 1  MSRVCQVTGKRPAVGNHRSHAKNAAKRRFLPNLKYHRFWVESEGRFVRLRVTTKAMRTID 60

Query: 61 RQGGLDRFLSN 71
          ++ G+D  L++
Sbjct: 61 KK-GIDSVLAD 70


>gi|262040686|ref|ZP_06013924.1| 50S ribosomal protein L28 [Klebsiella pneumoniae subsp.
          rhinoscleromatis ATCC 13884]
 gi|259042050|gb|EEW43083.1| 50S ribosomal protein L28 [Klebsiella pneumoniae subsp.
          rhinoscleromatis ATCC 13884]
          Length = 78

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 27/70 (38%), Positives = 44/70 (62%), Gaps = 1/70 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS+VC++T K  ++GN  SHA N T+RRFLPNL       +  ++   LR+S   +R ++
Sbjct: 1  MSQVCQVTGKRPVTGNNPSHALNATKRRFLPNLHSHRFWVESEKRFVTLRVSAKGMRVID 60

Query: 61 RQGGLDRFLS 70
          ++ G+D  L+
Sbjct: 61 KK-GIDTVLA 69


>gi|84386868|ref|ZP_00989892.1| ribosomal protein L28 [Vibrio splendidus 12B01]
 gi|86147285|ref|ZP_01065600.1| ribosomal protein L28 [Vibrio sp. MED222]
 gi|218708246|ref|YP_002415867.1| 50S ribosomal protein L28 [Vibrio splendidus LGP32]
 gi|260770728|ref|ZP_05879658.1| LSU ribosomal protein L28p [Vibrio furnissii CIP 102972]
 gi|254801387|sp|B7VHK3|RL28_VIBSL RecName: Full=50S ribosomal protein L28
 gi|84378158|gb|EAP95017.1| ribosomal protein L28 [Vibrio splendidus 12B01]
 gi|85835000|gb|EAQ53143.1| ribosomal protein L28 [Vibrio sp. MED222]
 gi|218321265|emb|CAV17215.1| Ribosomal protein L28 [Vibrio splendidus LGP32]
 gi|260614309|gb|EEX39498.1| LSU ribosomal protein L28p [Vibrio furnissii CIP 102972]
 gi|315178476|gb|ADT85390.1| ribosomal protein L28 [Vibrio furnissii NCTC 11218]
          Length = 78

 Score = 51.6 bits (122), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 29/79 (36%), Positives = 50/79 (63%), Gaps = 3/79 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  ++GN  SHA N T+RRFLPNL       +  ++  +LR++   +R ++
Sbjct: 1  MSRVCQVTGKRPVTGNNRSHARNATKRRFLPNLQTHRFWVESEKRFVKLRLTAKGMRIID 60

Query: 61 RQGGLDRFLSN--SKKENL 77
          ++ G+D  L +  ++ EN+
Sbjct: 61 KK-GIDAVLVDIRARGENV 78


>gi|91215245|ref|ZP_01252217.1| 50S ribosomal protein L28 [Psychroflexus torquis ATCC 700755]
 gi|91186850|gb|EAS73221.1| 50S ribosomal protein L28 [Psychroflexus torquis ATCC 700755]
          Length = 79

 Score = 51.6 bits (122), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 27/63 (42%), Positives = 39/63 (61%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVCELT K  MSGN VS A N+TRR+F  NL +        ++   L++S   L+++ 
Sbjct: 1  MSRVCELTGKRAMSGNNVSKALNRTRRKFSVNLVKKRFYIPGEDKWITLKVSTSILKTIN 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|207721440|ref|YP_002251881.1| 50s ribosomal protein l28 [Ralstonia solanacearum MolK2]
 gi|207742579|ref|YP_002258971.1| 50s ribosomal protein l28 [Ralstonia solanacearum IPO1609]
 gi|206586600|emb|CAQ17187.1| 50s ribosomal protein l28 [Ralstonia solanacearum MolK2]
 gi|206593973|emb|CAQ60900.1| 50s ribosomal protein l28 [Ralstonia solanacearum IPO1609]
          Length = 65

 Score = 51.6 bits (122), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 37/59 (62%), Gaps = 1/59 (1%)

Query: 13 MSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFLSN 71
          M GN VSHANNKT+RRFLPNL       +   +   LR+S   LR ++++ G+D  L++
Sbjct: 1  MVGNNVSHANNKTKRRFLPNLQNRRFWVESENRWVSLRVSNAGLRLIDKK-GIDEVLAD 58


>gi|146302710|ref|YP_001197301.1| ribosomal protein L28 [Flavobacterium johnsoniae UW101]
 gi|189029440|sp|A5F9Z1|RL28_FLAJO RecName: Full=50S ribosomal protein L28
 gi|146157128|gb|ABQ07982.1| LSU ribosomal protein L28P [Flavobacterium johnsoniae UW101]
          Length = 78

 Score = 51.6 bits (122), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 25/63 (39%), Positives = 38/63 (60%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC+LT K  M GN VSHA NKT+R+F  NL +        ++   LR++   ++++ 
Sbjct: 1  MSRVCDLTGKRAMVGNNVSHAMNKTKRKFSVNLVKKRFYLPEEDRWITLRVAASTIKTIN 60

Query: 61 RQG 63
          + G
Sbjct: 61 KNG 63


>gi|293606876|ref|ZP_06689224.1| 50S ribosomal protein L28 [Achromobacter piechaudii ATCC 43553]
 gi|292814728|gb|EFF73861.1| 50S ribosomal protein L28 [Achromobacter piechaudii ATCC 43553]
          Length = 66

 Score = 51.6 bits (122), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 26/58 (44%), Positives = 38/58 (65%), Gaps = 1/58 (1%)

Query: 13 MSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFLS 70
          M GN VSHANNKT+RRFLPNL       +   +  +LR+S  A+R++++  G+D  L+
Sbjct: 1  MVGNNVSHANNKTKRRFLPNLQSRRFWVESENRWVRLRVSAKAIRTIDKN-GIDAVLA 57


>gi|67461422|sp|Q6LVN3|RL28_PHOPR RecName: Full=50S ribosomal protein L28
          Length = 78

 Score = 51.6 bits (122), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 25/63 (39%), Positives = 41/63 (65%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  ++GN  SHA N T+RRFLPNL       +  ++  +LR++   +R ++
Sbjct: 1  MSRVCQVTGKRPVTGNNRSHARNATKRRFLPNLQTHRFWVESEKRFVKLRLTAKGMRIID 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|54307424|ref|YP_128444.1| putative ribosomal protein L28 [Photobacterium profundum SS9]
 gi|46911844|emb|CAG18642.1| putative ribosomal protein L28 [Photobacterium profundum SS9]
          Length = 83

 Score = 51.6 bits (122), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 25/63 (39%), Positives = 41/63 (65%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  ++GN  SHA N T+RRFLPNL       +  ++  +LR++   +R ++
Sbjct: 6  MSRVCQVTGKRPVTGNNRSHARNATKRRFLPNLQTHRFWVESEKRFVKLRLTAKGMRIID 65

Query: 61 RQG 63
          ++G
Sbjct: 66 KKG 68


>gi|227539205|ref|ZP_03969254.1| ribosomal protein L28 [Sphingobacterium spiritivorum ATCC 33300]
 gi|300770679|ref|ZP_07080558.1| 50S ribosomal protein L28 [Sphingobacterium spiritivorum ATCC
          33861]
 gi|227240887|gb|EEI90902.1| ribosomal protein L28 [Sphingobacterium spiritivorum ATCC 33300]
 gi|300763155|gb|EFK59972.1| 50S ribosomal protein L28 [Sphingobacterium spiritivorum ATCC
          33861]
          Length = 77

 Score = 51.2 bits (121), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 40/63 (63%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR+C+LT KT ++G +VS++N KT+R+F PNL           +   L++S  A++++ 
Sbjct: 1  MSRICDLTGKTALNGYRVSNSNAKTKRKFYPNLQTKRFFIPEENRWITLKVSTSAIKTIN 60

Query: 61 RQG 63
          + G
Sbjct: 61 KNG 63


>gi|320584009|gb|EFW98221.1| 54S ribosomal protein L24, mitochondrial [Pichia angusta DL-1]
          Length = 260

 Score = 51.2 bits (121), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 47/82 (57%), Gaps = 3/82 (3%)

Query: 12  VMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFLSN 71
           ++ GNKVS   N+ RR +LPN+    L S+ + +   L+++   LR++ ++GGLD +L+ 
Sbjct: 83  IVFGNKVSEHKNRARRTWLPNVVNKKLWSESLNKMVPLKLTARVLRTITKEGGLDNYLTK 142

Query: 72  SKK---ENLSARMRTLRSQILK 90
            K+   + L      LR  +LK
Sbjct: 143 DKRARIKELGPFGWRLRYDVLK 164


>gi|319953947|ref|YP_004165214.1| lsu ribosomal protein l28p [Cellulophaga algicola DSM 14237]
 gi|319422607|gb|ADV49716.1| LSU ribosomal protein L28P [Cellulophaga algicola DSM 14237]
          Length = 78

 Score = 51.2 bits (121), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 27/63 (42%), Positives = 40/63 (63%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS+VCE+T K  M GN VS + NKTRRRF  NL +     +  ++   L++S  AL+S+ 
Sbjct: 1  MSKVCEITGKRAMFGNNVSFSINKTRRRFNVNLSKKRFYIEEEDRWVTLKVSARALKSIN 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|192361901|ref|YP_001983968.1| 50S ribosomal protein L28 [Cellvibrio japonicus Ueda107]
 gi|226738047|sp|B3PG61|RL28_CELJU RecName: Full=50S ribosomal protein L28
 gi|190688066|gb|ACE85744.1| ribosomal protein L28-related protein [Cellvibrio japonicus
          Ueda107]
          Length = 78

 Score = 51.2 bits (121), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 40/63 (63%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS+VC++T K  ++G+ VSHA N T+RRFLPNL       +  ++   LR++   +R ++
Sbjct: 1  MSKVCQVTGKRPITGHNVSHAKNHTKRRFLPNLQTHRFWVEAEKRFVTLRLTPKGMRIID 60

Query: 61 RQG 63
          + G
Sbjct: 61 KLG 63


>gi|67523027|ref|XP_659574.1| hypothetical protein AN1970.2 [Aspergillus nidulans FGSC A4]
 gi|40745979|gb|EAA65135.1| hypothetical protein AN1970.2 [Aspergillus nidulans FGSC A4]
 gi|259487329|tpe|CBF85918.1| TPA: 50S ribosomal protein L24 (AFU_orthologue; AFUA_4G10740)
           [Aspergillus nidulans FGSC A4]
          Length = 203

 Score = 51.2 bits (121), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 28/85 (32%), Positives = 51/85 (60%), Gaps = 5/85 (5%)

Query: 11  TVMSGNKVSHANN--KTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRF 68
           T+  GNK+S   N  KTRR + PN+ R  L S+ ++Q   +++++ ALR++ + GGLD++
Sbjct: 62  TIQFGNKISQGRNEGKTRRFWKPNVRRKKLWSEALQQFLFIKVTRKALRTIRKAGGLDQY 121

Query: 69  LSNSKK---ENLSARMRTLRSQILK 90
           L + +    + L      LR Q+++
Sbjct: 122 LLDDRPARIKELGVFGWKLRWQVMQ 146


>gi|307107886|gb|EFN56127.1| hypothetical protein CHLNCDRAFT_144754 [Chlorella variabilis]
          Length = 146

 Score = 51.2 bits (121), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 41/67 (61%), Gaps = 1/67 (1%)

Query: 12 VMSGNKVSH-ANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFLS 70
          V+SGN++S    NKTRR + PN     L S I+ +   LR++  ALR +++ GG+D ++ 
Sbjct: 26 VLSGNQISEDGGNKTRRTWKPNSHNKRLYSHILARMVPLRVTAAALRDIDKVGGIDAYIL 85

Query: 71 NSKKENL 77
          N+  + L
Sbjct: 86 NTPDKQL 92


>gi|262197734|ref|YP_003268943.1| ribosomal protein L28 [Haliangium ochraceum DSM 14365]
 gi|262081081|gb|ACY17050.1| ribosomal protein L28 [Haliangium ochraceum DSM 14365]
          Length = 78

 Score = 51.2 bits (121), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 25/63 (39%), Positives = 41/63 (65%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  + GNKVSH+N+KT+RRF  NL       +   +  +LR+S   ++ ++
Sbjct: 1  MSRVCQVTGKKALVGNKVSHSNHKTKRRFEVNLHDKRFWLEEENRWVKLRVSARGMKIID 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KRG 63


>gi|332289487|ref|YP_004420339.1| 50S ribosomal protein L28 [Gallibacterium anatis UMN179]
 gi|330432383|gb|AEC17442.1| 50S ribosomal protein L28 [Gallibacterium anatis UMN179]
          Length = 78

 Score = 50.8 bits (120), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 42/71 (59%), Gaps = 1/71 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K    GN  SHA N TRRRFLPNL       +   +   LR++   +R ++
Sbjct: 1  MSRVCQVTGKRPAVGNNRSHAMNATRRRFLPNLHTHRFWVESENRFVTLRLTAKGMRIID 60

Query: 61 RQGGLDRFLSN 71
          ++ G+D  L++
Sbjct: 61 KK-GIDAVLAD 70


>gi|209693806|ref|YP_002261734.1| 50S ribosomal protein L28 [Aliivibrio salmonicida LFI1238]
 gi|226738023|sp|B6EPP2|RL28_ALISL RecName: Full=50S ribosomal protein L28
 gi|208007757|emb|CAQ77876.1| 50S ribosomal protein L28 [Aliivibrio salmonicida LFI1238]
          Length = 78

 Score = 50.8 bits (120), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 30/79 (37%), Positives = 48/79 (60%), Gaps = 3/79 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K    GN  SHA N T+RRFLPNL       +  ++  +LR++   +R ++
Sbjct: 1  MSRVCQVTGKRPAVGNNRSHAKNATKRRFLPNLQTHRFWVESEKRFVKLRLTAKGMRIID 60

Query: 61 RQGGLDRFLSN--SKKENL 77
          ++ G+D  LS   ++ EN+
Sbjct: 61 KK-GIDVVLSEMRARGENV 78


>gi|150025492|ref|YP_001296318.1| 50S ribosomal protein L28 [Flavobacterium psychrophilum JIP02/86]
 gi|166226571|sp|A6GZI6|RL28_FLAPJ RecName: Full=50S ribosomal protein L28
 gi|149772033|emb|CAL43509.1| 50S ribosomal protein L28 [Flavobacterium psychrophilum JIP02/86]
          Length = 78

 Score = 50.8 bits (120), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 38/63 (60%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR+C+LT K  M GN VSHA NKT+R+F  NL +        ++   LR++   ++++ 
Sbjct: 1  MSRICDLTGKRAMVGNNVSHAMNKTKRKFSVNLIKKRFYLPEEDRWITLRVAASTIKTIN 60

Query: 61 RQG 63
          + G
Sbjct: 61 KNG 63


>gi|330812586|ref|YP_004357048.1| 50S ribosomal protein L28 [Pseudomonas brassicacearum subsp.
          brassicacearum NFM421]
 gi|327380694|gb|AEA72044.1| 50S ribosomal protein L28 [Pseudomonas brassicacearum subsp.
          brassicacearum NFM421]
          Length = 65

 Score = 50.8 bits (120), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 35/51 (68%)

Query: 13 MSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQG 63
          M+GN +SHANNKTRRRFLPNL       +  ++  +LR+S   +R ++++G
Sbjct: 1  MTGNNISHANNKTRRRFLPNLQHHRFWVEEEKRFVRLRVSAKGMRIIDKRG 51


>gi|301382570|ref|ZP_07230988.1| 50S ribosomal protein L28 [Pseudomonas syringae pv. tomato Max13]
 gi|302063063|ref|ZP_07254604.1| 50S ribosomal protein L28 [Pseudomonas syringae pv. tomato K40]
 gi|302133589|ref|ZP_07259579.1| 50S ribosomal protein L28 [Pseudomonas syringae pv. tomato NCPPB
          1108]
 gi|302184916|ref|ZP_07261589.1| 50S ribosomal protein L28 [Pseudomonas syringae pv. syringae 642]
 gi|320322244|gb|EFW78340.1| 50S ribosomal protein L28 [Pseudomonas syringae pv. glycinea str.
          B076]
 gi|320331893|gb|EFW87831.1| 50S ribosomal protein L28 [Pseudomonas syringae pv. glycinea str.
          race 4]
 gi|331018551|gb|EGH98607.1| 50S ribosomal protein L28 [Pseudomonas syringae pv. lachrymans
          str. M302278PT]
          Length = 65

 Score = 50.8 bits (120), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 35/51 (68%)

Query: 13 MSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQG 63
          M+GN +SHANNKTRRRFLPNL       +  ++  +LR+S   +R ++++G
Sbjct: 1  MTGNNISHANNKTRRRFLPNLQHHRFWVEGEKRFVRLRVSAKGMRIIDKRG 51


>gi|53803464|ref|YP_114755.1| 50S ribosomal protein L28 [Methylococcus capsulatus str. Bath]
 gi|67461354|sp|Q605E5|RL28_METCA RecName: Full=50S ribosomal protein L28
 gi|53757225|gb|AAU91516.1| ribosomal protein L28 [Methylococcus capsulatus str. Bath]
          Length = 78

 Score = 50.8 bits (120), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 28/74 (37%), Positives = 46/74 (62%), Gaps = 1/74 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS+VC++T K  + G+ VSHANNKT+R F PNL       +   +  +L++S   LR ++
Sbjct: 1  MSKVCQVTGKRRIVGHNVSHANNKTKRLFNPNLHERRFWVESENRWVRLKVSNHGLRVID 60

Query: 61 RQGGLDRFLSNSKK 74
           + G+D  L++ +K
Sbjct: 61 -KCGIDAVLADIRK 73


>gi|37678470|ref|NP_933079.1| 50S ribosomal protein L28 [Vibrio vulnificus YJ016]
 gi|320157666|ref|YP_004190045.1| 50S ribosomal protein L28p [Vibrio vulnificus MO6-24/O]
 gi|326423774|ref|NP_759801.2| 50S ribosomal protein L28 [Vibrio vulnificus CMCP6]
 gi|61216002|sp|Q7MPS6|RL28_VIBVY RecName: Full=50S ribosomal protein L28
 gi|37197210|dbj|BAC93050.1| ribosomal protein L28 [Vibrio vulnificus YJ016]
 gi|319932978|gb|ADV87842.1| LSU ribosomal protein L28p [Vibrio vulnificus MO6-24/O]
 gi|319999136|gb|AAO09328.2| ribosomal protein L28 [Vibrio vulnificus CMCP6]
          Length = 78

 Score = 50.8 bits (120), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 29/79 (36%), Positives = 49/79 (62%), Gaps = 3/79 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K    GN  SHA N T+RRFLPNL       +  ++  +LR++   +R ++
Sbjct: 1  MSRVCQVTGKRPAVGNNRSHARNATKRRFLPNLQTHRFWVESEKRFVKLRLTAKGMRIID 60

Query: 61 RQGGLDRFLSN--SKKENL 77
          ++ G+D  L++  ++ EN+
Sbjct: 61 KK-GIDVVLADMRARGENV 78


>gi|29653643|ref|NP_819335.1| 50S ribosomal protein L28 [Coxiella burnetii RSA 493]
 gi|153208650|ref|ZP_01946902.1| ribosomal protein L28 [Coxiella burnetii 'MSU Goat Q177']
 gi|154707613|ref|YP_001425122.1| 50S ribosomal protein L28 [Coxiella burnetii Dugway 5J108-111]
 gi|161830851|ref|YP_001596241.1| 50S ribosomal protein L28 [Coxiella burnetii RSA 331]
 gi|165919768|ref|ZP_02219511.1| ribosomal protein L28 [Coxiella burnetii RSA 334]
 gi|212213200|ref|YP_002304136.1| 50S ribosomal protein L28 [Coxiella burnetii CbuG_Q212]
 gi|212218126|ref|YP_002304913.1| 50S ribosomal protein L28 [Coxiella burnetii CbuK_Q154]
 gi|67461514|sp|Q83EM4|RL28_COXBU RecName: Full=50S ribosomal protein L28
 gi|189042431|sp|A9KGS7|RL28_COXBN RecName: Full=50S ribosomal protein L28
 gi|189042432|sp|A9NB26|RL28_COXBR RecName: Full=50S ribosomal protein L28
 gi|226738060|sp|B6J5S6|RL28_COXB1 RecName: Full=50S ribosomal protein L28
 gi|226738061|sp|B6J213|RL28_COXB2 RecName: Full=50S ribosomal protein L28
 gi|29540905|gb|AAO89849.1| LSU ribosomal protein L28P [Coxiella burnetii RSA 493]
 gi|120575836|gb|EAX32460.1| ribosomal protein L28 [Coxiella burnetii 'MSU Goat Q177']
 gi|154356899|gb|ABS78361.1| LSU ribosomal protein L28P [Coxiella burnetii Dugway 5J108-111]
 gi|161762718|gb|ABX78360.1| ribosomal protein L28 [Coxiella burnetii RSA 331]
 gi|165916851|gb|EDR35455.1| ribosomal protein L28 [Coxiella burnetii RSA 334]
 gi|212011610|gb|ACJ18991.1| LSU ribosomal protein L28P [Coxiella burnetii CbuG_Q212]
 gi|212012388|gb|ACJ19768.1| LSU ribosomal protein L28P [Coxiella burnetii CbuK_Q154]
          Length = 79

 Score = 50.8 bits (120), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 38/63 (60%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M++VC++T K   SGN VSHAN KT RRFLPNL +        ++   L +S   +R ++
Sbjct: 1  MAKVCQVTGKRPQSGNNVSHANKKTNRRFLPNLKKRRFWLPDEKRFITLTVSTHGMRIID 60

Query: 61 RQG 63
          + G
Sbjct: 61 KLG 63


>gi|328849475|gb|EGF98654.1| hypothetical protein MELLADRAFT_50935 [Melampsora larici-populina
           98AG31]
          Length = 244

 Score = 50.8 bits (120), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 22/84 (26%), Positives = 50/84 (59%)

Query: 12  VMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFLSN 71
           V +G+ +  + ++T+R + PN+ + +L S+++ Q  QL+++  AL+++++ GGLDR++  
Sbjct: 75  VKAGDNIPKSKHRTKRVWNPNVQKSSLWSEVLNQSLQLKLTTAALKTIDKVGGLDRYVLQ 134

Query: 72  SKKENLSARMRTLRSQILKKMSEK 95
              + L      +R  ++  M  K
Sbjct: 135 MSDQRLGGTGIRIRELVISAMKAK 158


>gi|256827890|ref|YP_003156618.1| 50S riboosomal protein L28 [Desulfomicrobium baculatum DSM 4028]
 gi|256577066|gb|ACU88202.1| ribosomal protein L28 [Desulfomicrobium baculatum DSM 4028]
          Length = 66

 Score = 50.8 bits (120), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 21/33 (63%), Positives = 26/33 (78%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNL 33
          MS+VC++  K    GN VSHANNKT+RRF+PNL
Sbjct: 1  MSKVCDICGKGPQVGNNVSHANNKTKRRFMPNL 33


>gi|113460291|ref|YP_718350.1| 50S ribosomal protein L28 [Haemophilus somnus 129PT]
 gi|170717208|ref|YP_001783365.1| 50S ribosomal protein L28 [Haemophilus somnus 2336]
 gi|122945106|sp|Q0I0X8|RL28_HAES1 RecName: Full=50S ribosomal protein L28
 gi|189029444|sp|B0UUW8|RL28_HAES2 RecName: Full=50S ribosomal protein L28
 gi|112822334|gb|ABI24423.1| LSU ribosomal protein L28P [Haemophilus somnus 129PT]
 gi|168825337|gb|ACA30708.1| ribosomal protein L28 [Haemophilus somnus 2336]
          Length = 78

 Score = 50.4 bits (119), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K    GN  SHA N TRRRFLPNL       +  ++   LR++   +R ++
Sbjct: 1  MSRVCQVTGKRPAVGNNRSHAMNATRRRFLPNLHTHRFWVESEKRFVTLRLTAKGMRIID 60

Query: 61 RQGGLDRFLS 70
          ++ G+D  L+
Sbjct: 61 KK-GIDAVLA 69


>gi|242219285|ref|XP_002475424.1| mitochondrial 50S ribosomal protein L28-like protein [Postia
           placenta Mad-698-R]
 gi|220725395|gb|EED79384.1| mitochondrial 50S ribosomal protein L28-like protein [Postia
           placenta Mad-698-R]
          Length = 124

 Score = 50.4 bits (119), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 47/81 (58%)

Query: 15  GNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFLSNSKK 74
           GN V  +  KTRR +LPN+      SD +++  Q+++S  AL+++ + GG+D +L  +K 
Sbjct: 32  GNNVPFSMQKTRRTWLPNIQNKRFFSDALQEFVQVKVSTRALKTINKYGGIDTYLLKTKS 91

Query: 75  ENLSARMRTLRSQILKKMSEK 95
           + L      LR  + +++S +
Sbjct: 92  DLLGWEGMRLRIMVRERISSR 112


>gi|297183767|gb|ADI19891.1| hypothetical protein [uncultured alpha proteobacterium
          EB000_46D07]
          Length = 88

 Score = 50.4 bits (119), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 21/30 (70%), Positives = 27/30 (90%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFL 30
          M++ C+++ KTVMSGN VSHANN+TRRRFL
Sbjct: 50 MAKRCQISGKTVMSGNNVSHANNRTRRRFL 79


>gi|298715840|emb|CBJ28305.1| conserved unknown protein [Ectocarpus siliculosus]
          Length = 154

 Score = 50.4 bits (119), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 46/78 (58%)

Query: 2   SRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVER 61
           S++     K +  GN +S ++ K RR + PN+ +  L S+ +++  +  ++  ALR V+R
Sbjct: 31  SQIGLYAGKDIGFGNTISFSHKKNRRTWKPNVQKKALYSETLDEWIKFSLTTHALRCVDR 90

Query: 62  QGGLDRFLSNSKKENLSA 79
            GG+DR+L  +  E L++
Sbjct: 91  AGGIDRYLLKTPDEWLNS 108


>gi|256422104|ref|YP_003122757.1| ribosomal protein L28 [Chitinophaga pinensis DSM 2588]
 gi|256037012|gb|ACU60556.1| ribosomal protein L28 [Chitinophaga pinensis DSM 2588]
          Length = 78

 Score = 50.4 bits (119), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 40/63 (63%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVC++T K  ++G+ VS +N KT+RRFLPNL +        ++   L++S   LR++ 
Sbjct: 1  MARVCQVTGKKPITGHHVSFSNIKTKRRFLPNLQKKRFFLAEEDRWISLKVSADGLRTIN 60

Query: 61 RQG 63
          + G
Sbjct: 61 KNG 63


>gi|312888453|ref|ZP_07748027.1| LSU ribosomal protein L28P [Mucilaginibacter paludis DSM 18603]
 gi|311299081|gb|EFQ76176.1| LSU ribosomal protein L28P [Mucilaginibacter paludis DSM 18603]
          Length = 77

 Score = 50.4 bits (119), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 39/63 (61%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR+C+LT K  M+G  VS++N KT+RRF PNL          ++   L++S  A++++ 
Sbjct: 1  MSRICDLTGKGSMNGFNVSNSNVKTKRRFYPNLQTKKFYIPEEDKWITLKVSTAAIKTIS 60

Query: 61 RQG 63
          + G
Sbjct: 61 KNG 63


>gi|305667749|ref|YP_003864036.1| 50S ribosomal protein L28 [Maribacter sp. HTCC2170]
 gi|88707586|gb|EAQ99828.1| 50S ribosomal protein L28 [Maribacter sp. HTCC2170]
          Length = 78

 Score = 50.4 bits (119), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 27/63 (42%), Positives = 39/63 (61%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS+VCE+T K  M GN VS + NKTRRRF  NL +        ++   L++S  AL+S+ 
Sbjct: 1  MSKVCEITGKRAMFGNNVSFSINKTRRRFNVNLSKKRFYIPEEDRWVTLKVSAKALKSIN 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|189499571|ref|YP_001959041.1| 50S ribosomal protein L28 [Chlorobium phaeobacteroides BS1]
 gi|226738050|sp|B3EMT2|RL28_CHLPB RecName: Full=50S ribosomal protein L28
 gi|189495012|gb|ACE03560.1| ribosomal protein L28 [Chlorobium phaeobacteroides BS1]
          Length = 72

 Score = 50.4 bits (119), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 40/63 (63%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS+VC LT K    GN VSHANN+TR+RF PNL    +  +  ++  ++R+S  A++ + 
Sbjct: 1  MSKVCILTGKRPTYGNNVSHANNRTRKRFEPNLHTKRIWVEEEKRWVKVRVSAKAMKIMS 60

Query: 61 RQG 63
          + G
Sbjct: 61 KTG 63


>gi|325285397|ref|YP_004261187.1| 50S ribosomal protein L28 [Cellulophaga lytica DSM 7489]
 gi|324320851|gb|ADY28316.1| 50S ribosomal protein L28 [Cellulophaga lytica DSM 7489]
          Length = 78

 Score = 50.4 bits (119), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 27/63 (42%), Positives = 39/63 (61%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS+VCE+T K  M GN VS + NKTRRRF  NL +        ++   L++S  AL+S+ 
Sbjct: 1  MSKVCEITGKKAMFGNNVSFSINKTRRRFDVNLSKKRFYIPEEDRWITLKVSTRALKSIN 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|118138114|pdb|2I2T|X Chain X, Crystal Structure Of Ribosome With Messenger Rna And The
          Anticodon Stem-Loop Of P-Site Trna. This File Contains
          The 50s Subunit Of One 70s Ribosome. The Entire Crystal
          Structure Contains Two 70s Ribosomes And Is Described
          In Remark 400.
 gi|118138168|pdb|2I2V|X Chain X, Crystal Structure Of Ribosome With Messenger Rna And The
          Anticodon Stem-Loop Of P-Site Trna. This File Contains
          The 50s Subunit Of One 70s Ribosome. The Entire Crystal
          Structure Contains Two 70s Ribosomes And Is Described
          In Remark 400.
 gi|224510753|pdb|3FIK|X Chain X, Ternary Complex-Bound E.Coli 70s Ribosome. This Entry
          Consists Of The 50s Subunit.
 gi|294662241|pdb|2WWQ|0 Chain 0, E.Coli 70s Ribosome Stalled During Translation Of Tnac
          Leader Peptide. This File Contains The 50s, The P-Site
          Trna And The Tnac Leader Peptide (Part 2 Of 2).
 gi|308388030|pdb|3OFQ|X Chain X, Crystal Structure Of The E. Coli Ribosome Bound To
          Erythromycin. This File Contains The 50s Subunit Of The
          Second 70s Ribosome.
 gi|308388061|pdb|3OFR|X Chain X, Crystal Structure Of The E. Coli Ribosome Bound To
          Erythromycin. This File Contains The 50s Subunit Of The
          First 70s Ribosome With Erthromycin Bound.
 gi|309320088|pdb|3OFC|X Chain X, Crystal Structure Of The E. Coli Ribosome Bound To
          Chloramphenicol. This File Contains The 50s Subunit Of
          The First 70s Ribosome With Chloramphenicol Bound.
 gi|309320119|pdb|3OFD|X Chain X, Crystal Structure Of The E. Coli Ribosome Bound To
          Chloramphenicol. This File Contains The 50s Subunit Of
          The Second 70s Ribosome.
 gi|309320192|pdb|3OFZ|X Chain X, Crystal Structure Of The E. Coli Ribosome Bound To
          Clindamycin. This File Contains The 50s Subunit Of The
          First 70s Ribosome Bound To Clindamycin.
 gi|309320223|pdb|3OG0|X Chain X, Crystal Structure Of The E. Coli Ribosome Bound To
          Clindamycin. This File Contains The 50s Subunit Of The
          Second 70s Ribosome.
 gi|315113677|pdb|3OAS|X Chain X, Crystal Structure Of The E. Coli Ribosome Bound To
          Telithromycin. This File Contains The 50s Subunit Of
          The Second 70s Ribosome.
 gi|315113708|pdb|3OAT|X Chain X, Crystal Structure Of The E. Coli Ribosome Bound To
          Telithromycin. This File Contains The 50s Subunit Of
          The First 70s Ribosome With Telithromycin Bound.
 gi|329666039|pdb|3J01|X Chain X, Structure Of The Ribosome-Secye Complex In The Membrane
          Environment
          Length = 77

 Score = 50.4 bits (119), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 43/69 (62%), Gaps = 1/69 (1%)

Query: 2  SRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVER 61
          SRVC++T K  ++GN  SHA N T+RRFLPNL       +  ++   LR+S   +R +++
Sbjct: 1  SRVCQVTGKRPVTGNNRSHALNATKRRFLPNLHSHRFWVESEKRFVTLRVSAKGMRVIDK 60

Query: 62 QGGLDRFLS 70
          + G+D  L+
Sbjct: 61 K-GIDTVLA 68


>gi|88802661|ref|ZP_01118188.1| ribosomal protein L28 [Polaribacter irgensii 23-P]
 gi|88781519|gb|EAR12697.1| ribosomal protein L28 [Polaribacter irgensii 23-P]
          Length = 79

 Score = 50.4 bits (119), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 38/63 (60%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVCELT K  M GN VS A N+T+R+F  NL          ++   L++S  AL+++ 
Sbjct: 1  MSRVCELTGKKAMVGNNVSKALNRTKRKFDANLMTKRFFIPEEDKWITLKVSASALKNIN 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|16272889|ref|NP_439112.1| 50S ribosomal protein L28 [Haemophilus influenzae Rd KW20]
 gi|68249539|ref|YP_248651.1| 50S ribosomal protein L28 [Haemophilus influenzae 86-028NP]
 gi|145628113|ref|ZP_01783914.1| DNA repair protein RadC [Haemophilus influenzae 22.1-21]
 gi|145630046|ref|ZP_01785828.1| 50S ribosomal protein L33 [Haemophilus influenzae R3021]
 gi|145632337|ref|ZP_01788072.1| 50S ribosomal protein L33 [Haemophilus influenzae 3655]
 gi|145634127|ref|ZP_01789838.1| 50S ribosomal protein L33 [Haemophilus influenzae PittAA]
 gi|145637256|ref|ZP_01792917.1| 50S ribosomal protein L33 [Haemophilus influenzae PittHH]
 gi|145638226|ref|ZP_01793836.1| DNA repair protein RadC [Haemophilus influenzae PittII]
 gi|145640619|ref|ZP_01796202.1| 50S ribosomal protein L33 [Haemophilus influenzae R3021]
 gi|148826398|ref|YP_001291151.1| 50S ribosomal protein L28 [Haemophilus influenzae PittEE]
 gi|148828129|ref|YP_001292882.1| 50S ribosomal protein L28 [Haemophilus influenzae PittGG]
 gi|229843988|ref|ZP_04464129.1| 50S ribosomal protein L28 [Haemophilus influenzae 6P18H1]
 gi|229846011|ref|ZP_04466123.1| 50S ribosomal protein L28 [Haemophilus influenzae 7P49H1]
 gi|251793908|ref|YP_003008640.1| 50S ribosomal protein L28 [Aggregatibacter aphrophilus NJ8700]
 gi|260580041|ref|ZP_05847871.1| ribosomal protein L28 [Haemophilus influenzae RdAW]
 gi|260581786|ref|ZP_05849583.1| ribosomal protein L28 [Haemophilus influenzae NT127]
 gi|270616371|ref|ZP_06221735.1| ribosomal protein-related protein [Haemophilus influenzae HK1212]
 gi|315633558|ref|ZP_07888848.1| 50S ribosomal protein L28 [Aggregatibacter segnis ATCC 33393]
 gi|319897559|ref|YP_004135756.1| 50S ribosomal subunit protein l28 [Haemophilus influenzae F3031]
 gi|1173011|sp|P44364|RL28_HAEIN RecName: Full=50S ribosomal protein L28
 gi|81336034|sp|Q4QLV6|RL28_HAEI8 RecName: Full=50S ribosomal protein L28
 gi|166226578|sp|A5UDB7|RL28_HAEIE RecName: Full=50S ribosomal protein L28
 gi|166226579|sp|A5UI93|RL28_HAEIG RecName: Full=50S ribosomal protein L28
 gi|1573976|gb|AAC22612.1| ribosomal protein L28 (rpL28) [Haemophilus influenzae Rd KW20]
 gi|68057738|gb|AAX87991.1| 50S ribosomal protein L28 [Haemophilus influenzae 86-028NP]
 gi|144979888|gb|EDJ89547.1| DNA repair protein RadC [Haemophilus influenzae 22.1-21]
 gi|144984327|gb|EDJ91750.1| 50S ribosomal protein L33 [Haemophilus influenzae R3021]
 gi|144987244|gb|EDJ93774.1| 50S ribosomal protein L33 [Haemophilus influenzae 3655]
 gi|145268571|gb|EDK08564.1| 50S ribosomal protein L33 [Haemophilus influenzae PittAA]
 gi|145269508|gb|EDK09450.1| 50S ribosomal protein L33 [Haemophilus influenzae PittHH]
 gi|145272555|gb|EDK12462.1| DNA repair protein RadC [Haemophilus influenzae PittII]
 gi|145274545|gb|EDK14408.1| 50S ribosomal protein L33 [Haemophilus influenzae 22.4-21]
 gi|148716558|gb|ABQ98768.1| 50S ribosomal protein L28 [Haemophilus influenzae PittEE]
 gi|148719371|gb|ABR00499.1| 50S ribosomal protein L28 [Haemophilus influenzae PittGG]
 gi|229811015|gb|EEP46732.1| 50S ribosomal protein L28 [Haemophilus influenzae 7P49H1]
 gi|229812982|gb|EEP48670.1| 50S ribosomal protein L28 [Haemophilus influenzae 6P18H1]
 gi|247535307|gb|ACS98553.1| ribosomal protein L28 [Aggregatibacter aphrophilus NJ8700]
 gi|260093325|gb|EEW77258.1| ribosomal protein L28 [Haemophilus influenzae RdAW]
 gi|260095379|gb|EEW79270.1| ribosomal protein L28 [Haemophilus influenzae NT127]
 gi|270317975|gb|EFA29270.1| ribosomal protein-related protein [Haemophilus influenzae HK1212]
 gi|301169676|emb|CBW29277.1| 50S ribosomal subunit protein L28 [Haemophilus influenzae 10810]
 gi|309751381|gb|ADO81365.1| 50S ribosomal protein L28 [Haemophilus influenzae R2866]
 gi|309973546|gb|ADO96747.1| 50S ribosomal protein L28 [Haemophilus influenzae R2846]
 gi|315477600|gb|EFU68342.1| 50S ribosomal protein L28 [Aggregatibacter segnis ATCC 33393]
 gi|317433065|emb|CBY81439.1| 50S ribosomal subunit protein L28 [Haemophilus influenzae F3031]
          Length = 78

 Score = 50.4 bits (119), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 41/70 (58%), Gaps = 1/70 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K    GN  SHA N TRRRFLPNL       +   +   LR++   +R ++
Sbjct: 1  MSRVCQVTGKRPAVGNNRSHAMNATRRRFLPNLHTHRFWVESENRFVTLRLTAKGMRIID 60

Query: 61 RQGGLDRFLS 70
          ++ G+D  L+
Sbjct: 61 KK-GIDAVLA 69


>gi|52308049|gb|AAU38549.1| RpmB protein [Mannheimia succiniciproducens MBEL55E]
          Length = 82

 Score = 50.1 bits (118), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 42/71 (59%), Gaps = 1/71 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K    GN  SHA N TRRRFLPNL       +   +   LR++   +R ++
Sbjct: 5  MSRVCQVTGKRPAVGNNRSHALNATRRRFLPNLHTHRFWVESENRFVTLRLTAKGMRIID 64

Query: 61 RQGGLDRFLSN 71
          ++ G+D  L++
Sbjct: 65 KK-GIDAVLAD 74


>gi|152977702|ref|YP_001343331.1| 50S ribosomal protein L28 [Actinobacillus succinogenes 130Z]
 gi|161510960|ref|YP_089134.2| 50S ribosomal protein L28 [Mannheimia succiniciproducens MBEL55E]
 gi|67461371|sp|Q65R61|RL28_MANSM RecName: Full=50S ribosomal protein L28
 gi|171472903|sp|A6VK99|RL28_ACTSZ RecName: Full=50S ribosomal protein L28
 gi|150839425|gb|ABR73396.1| ribosomal protein L28 [Actinobacillus succinogenes 130Z]
          Length = 78

 Score = 50.1 bits (118), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 42/71 (59%), Gaps = 1/71 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K    GN  SHA N TRRRFLPNL       +   +   LR++   +R ++
Sbjct: 1  MSRVCQVTGKRPAVGNNRSHALNATRRRFLPNLHTHRFWVESENRFVTLRLTAKGMRIID 60

Query: 61 RQGGLDRFLSN 71
          ++ G+D  L++
Sbjct: 61 KK-GIDAVLAD 70


>gi|255573228|ref|XP_002527543.1| 60S ribosomal protein L24, mitochondrial precursor, putative
           [Ricinus communis]
 gi|223533093|gb|EEF34852.1| 60S ribosomal protein L24, mitochondrial precursor, putative
           [Ricinus communis]
          Length = 211

 Score = 50.1 bits (118), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 25/89 (28%), Positives = 48/89 (53%), Gaps = 1/89 (1%)

Query: 7   LTKKTVMSGNKVSH-ANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGL 65
              + +  GN+VS    NKTRR + PN+    L S I+++  Q++++  ALR +++ GG+
Sbjct: 48  FAGRHIQFGNRVSEDGGNKTRRTWKPNVQEKRLFSYILDRHIQVKVTTHALRCIDKAGGI 107

Query: 66  DRFLSNSKKENLSARMRTLRSQILKKMSE 94
           D +L  +  + +   M       ++K+ E
Sbjct: 108 DEYLLKTPYQKMDTDMGLFWKAKIEKLYE 136


>gi|59710734|ref|YP_203510.1| 50S ribosomal protein L28 [Vibrio fischeri ES114]
 gi|197333949|ref|YP_002154895.1| ribosomal protein L28 [Vibrio fischeri MJ11]
 gi|67461221|sp|Q5E8M4|RL28_VIBF1 RecName: Full=50S ribosomal protein L28
 gi|226699183|sp|B5FFF7|RL28_VIBFM RecName: Full=50S ribosomal protein L28
 gi|59478835|gb|AAW84622.1| 50S ribosomal subunit protein L28 [Vibrio fischeri ES114]
 gi|197315439|gb|ACH64886.1| ribosomal protein L28 [Vibrio fischeri MJ11]
          Length = 78

 Score = 50.1 bits (118), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 25/63 (39%), Positives = 39/63 (61%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K    GN  SHA N T+RRFLPNL       +  ++  +LR++   +R ++
Sbjct: 1  MSRVCQVTGKRPAVGNNRSHAKNATKRRFLPNLQTHRFWVESEKRFVKLRLTAKGMRIID 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|320167558|gb|EFW44457.1| hypothetical protein CAOG_02482 [Capsaspora owczarzaki ATCC 30864]
          Length = 640

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 27/78 (34%), Positives = 50/78 (64%), Gaps = 1/78 (1%)

Query: 15  GNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFLSNSKK 74
           GN++SH++ KTRRR+LPN+   T    ++++  +L  +  A R+++  GG++R+L N   
Sbjct: 30  GNQISHSHRKTRRRWLPNVHLRTPYLSLLDKHVRLNTTSKATRTIDLAGGIERYLLNLNP 89

Query: 75  ENL-SARMRTLRSQILKK 91
           E + S R   LR+Q+ ++
Sbjct: 90  ERVASKRGDELRAQLRQR 107


>gi|313159483|gb|EFR58846.1| ribosomal protein L28 [Alistipes sp. HGB5]
          Length = 77

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 39/61 (63%)

Query: 3  RVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQ 62
          +VCE+T K  + GN VSH+++KT+R+F PNL      S+   +   L++S   ++++ ++
Sbjct: 2  KVCEITGKVAIVGNNVSHSHHKTKRKFSPNLKTKRFWSEQEGRWITLKVSAAGMKTINKK 61

Query: 63 G 63
          G
Sbjct: 62 G 62


>gi|27904585|ref|NP_777711.1| 50S ribosomal protein L28 [Buchnera aphidicola str. Bp (Baizongia
          pistaciae)]
 gi|31076932|sp|Q89AY8|RL28_BUCBP RecName: Full=50S ribosomal protein L28
 gi|27903982|gb|AAO26816.1| 50S ribosomal protein L28 [Buchnera aphidicola str. Bp (Baizongia
          pistaciae)]
          Length = 74

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 39/63 (61%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS++C++T K  ++GN  SHA N T+RRF PNL      +   ++   LR+S   +R+++
Sbjct: 1  MSKICQITGKKPITGNNRSHAMNATKRRFFPNLHFHKFWNPKTKRFIILRVSAKGMRNID 60

Query: 61 RQG 63
          + G
Sbjct: 61 KLG 63


>gi|15640248|ref|NP_229875.1| 50S ribosomal protein L28 [Vibrio cholerae O1 biovar El Tor str.
          N16961]
 gi|121729458|ref|ZP_01682087.1| ribosomal protein L28 [Vibrio cholerae V52]
 gi|147673253|ref|YP_001218478.1| 50S ribosomal protein L28 [Vibrio cholerae O395]
 gi|153214734|ref|ZP_01949579.1| ribosomal protein L28 [Vibrio cholerae 1587]
 gi|153800811|ref|ZP_01955397.1| ribosomal protein L28 [Vibrio cholerae MZO-3]
 gi|153820024|ref|ZP_01972691.1| ribosomal protein L28 [Vibrio cholerae NCTC 8457]
 gi|153826353|ref|ZP_01979020.1| ribosomal protein L28 [Vibrio cholerae MZO-2]
 gi|227080438|ref|YP_002808989.1| ribosomal protein L28 [Vibrio cholerae M66-2]
 gi|229506981|ref|ZP_04396489.1| LSU ribosomal protein L28p [Vibrio cholerae BX 330286]
 gi|229509351|ref|ZP_04398834.1| LSU ribosomal protein L28p [Vibrio cholerae B33]
 gi|229512789|ref|ZP_04402257.1| LSU ribosomal protein L28p [Vibrio cholerae TMA 21]
 gi|229516298|ref|ZP_04405746.1| LSU ribosomal protein L28p [Vibrio cholerae RC9]
 gi|229524830|ref|ZP_04414235.1| LSU ribosomal protein L28p [Vibrio cholerae bv. albensis VL426]
 gi|229527279|ref|ZP_04416672.1| LSU ribosomal protein L28p [Vibrio cholerae 12129(1)]
 gi|229606489|ref|YP_002877137.1| 50S ribosomal protein L28 [Vibrio cholerae MJ-1236]
 gi|254225708|ref|ZP_04919315.1| ribosomal protein L28 [Vibrio cholerae V51]
 gi|254851348|ref|ZP_05240698.1| 50S ribosomal protein L28 [Vibrio cholerae MO10]
 gi|255744030|ref|ZP_05417984.1| LSU ribosomal protein L28p [Vibrio cholera CIRS 101]
 gi|258620578|ref|ZP_05715615.1| ribosomal protein L28 [Vibrio mimicus VM573]
 gi|258625888|ref|ZP_05720763.1| ribosomal protein L28 [Vibrio mimicus VM603]
 gi|261210489|ref|ZP_05924783.1| LSU ribosomal protein L28p [Vibrio sp. RC341]
 gi|262161921|ref|ZP_06030938.1| LSU ribosomal protein L28p [Vibrio cholerae INDRE 91/1]
 gi|262163758|ref|ZP_06031498.1| LSU ribosomal protein L28p [Vibrio mimicus VM223]
 gi|262168069|ref|ZP_06035768.1| LSU ribosomal protein L28p [Vibrio cholerae RC27]
 gi|262172689|ref|ZP_06040367.1| LSU ribosomal protein L28p [Vibrio mimicus MB-451]
 gi|262404955|ref|ZP_06081507.1| LSU ribosomal protein L28p [Vibrio sp. RC586]
 gi|297581671|ref|ZP_06943593.1| ribosomal protein L28 [Vibrio cholerae RC385]
 gi|298500860|ref|ZP_07010662.1| ribosomal protein L28 [Vibrio cholerae MAK 757]
 gi|14195136|sp|Q9KVC8|RL28_VIBCH RecName: Full=50S ribosomal protein L28
 gi|172047482|sp|A5F404|RL28_VIBC3 RecName: Full=50S ribosomal protein L28
 gi|254801386|sp|C3LQI0|RL28_VIBCM RecName: Full=50S ribosomal protein L28
 gi|9654626|gb|AAF93394.1| ribosomal protein L28 [Vibrio cholerae O1 biovar El Tor str.
          N16961]
 gi|121628633|gb|EAX61108.1| ribosomal protein L28 [Vibrio cholerae V52]
 gi|124115170|gb|EAY33990.1| ribosomal protein L28 [Vibrio cholerae 1587]
 gi|124123642|gb|EAY42385.1| ribosomal protein L28 [Vibrio cholerae MZO-3]
 gi|125621828|gb|EAZ50155.1| ribosomal protein L28 [Vibrio cholerae V51]
 gi|126509428|gb|EAZ72022.1| ribosomal protein L28 [Vibrio cholerae NCTC 8457]
 gi|146315136|gb|ABQ19675.1| ribosomal protein L28 [Vibrio cholerae O395]
 gi|149739922|gb|EDM54109.1| ribosomal protein L28 [Vibrio cholerae MZO-2]
 gi|227008326|gb|ACP04538.1| ribosomal protein L28 [Vibrio cholerae M66-2]
 gi|227012065|gb|ACP08275.1| ribosomal protein L28 [Vibrio cholerae O395]
 gi|229335287|gb|EEO00771.1| LSU ribosomal protein L28p [Vibrio cholerae 12129(1)]
 gi|229338411|gb|EEO03428.1| LSU ribosomal protein L28p [Vibrio cholerae bv. albensis VL426]
 gi|229346724|gb|EEO11694.1| LSU ribosomal protein L28p [Vibrio cholerae RC9]
 gi|229350299|gb|EEO15251.1| LSU ribosomal protein L28p [Vibrio cholerae TMA 21]
 gi|229353666|gb|EEO18603.1| LSU ribosomal protein L28p [Vibrio cholerae B33]
 gi|229356086|gb|EEO21005.1| LSU ribosomal protein L28p [Vibrio cholerae BX 330286]
 gi|229369144|gb|ACQ59567.1| LSU ribosomal protein L28p [Vibrio cholerae MJ-1236]
 gi|254847053|gb|EET25467.1| 50S ribosomal protein L28 [Vibrio cholerae MO10]
 gi|255738295|gb|EET93686.1| LSU ribosomal protein L28p [Vibrio cholera CIRS 101]
 gi|258581852|gb|EEW06726.1| ribosomal protein L28 [Vibrio mimicus VM603]
 gi|258587093|gb|EEW11805.1| ribosomal protein L28 [Vibrio mimicus VM573]
 gi|260840547|gb|EEX67113.1| LSU ribosomal protein L28p [Vibrio sp. RC341]
 gi|261893765|gb|EEY39751.1| LSU ribosomal protein L28p [Vibrio mimicus MB-451]
 gi|262023602|gb|EEY42304.1| LSU ribosomal protein L28p [Vibrio cholerae RC27]
 gi|262027738|gb|EEY46403.1| LSU ribosomal protein L28p [Vibrio mimicus VM223]
 gi|262028299|gb|EEY46955.1| LSU ribosomal protein L28p [Vibrio cholerae INDRE 91/1]
 gi|262348794|gb|EEY97935.1| LSU ribosomal protein L28p [Vibrio sp. RC586]
 gi|297534078|gb|EFH72917.1| ribosomal protein L28 [Vibrio cholerae RC385]
 gi|297540364|gb|EFH76423.1| ribosomal protein L28 [Vibrio cholerae MAK 757]
          Length = 78

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/63 (39%), Positives = 39/63 (61%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K    GN  SHA N T+RRFLPNL       +  ++  +LR++   +R ++
Sbjct: 1  MSRVCQVTGKRPAVGNNRSHAKNATKRRFLPNLQTHRFWVESEKRFVKLRLTAKGMRIID 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|15603016|ref|NP_246088.1| 50S ribosomal protein L28 [Pasteurella multocida subsp. multocida
          str. Pm70]
 gi|260912779|ref|ZP_05919265.1| 50S ribosomal protein L28 [Pasteurella dagmatis ATCC 43325]
 gi|14195119|sp|Q9CLR1|RL28_PASMU RecName: Full=50S ribosomal protein L28
 gi|12721499|gb|AAK03235.1| RpL28 [Pasteurella multocida subsp. multocida str. Pm70]
 gi|260633157|gb|EEX51322.1| 50S ribosomal protein L28 [Pasteurella dagmatis ATCC 43325]
          Length = 78

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K    GN  SHA N T+RRFLPNL       +  ++   LR++   +R ++
Sbjct: 1  MSRVCQVTGKRPAVGNNRSHAMNATKRRFLPNLHTHRFWVESEKRFVTLRLTAKGMRIID 60

Query: 61 RQGGLDRFLSN 71
          ++ G+D  L++
Sbjct: 61 KK-GIDAVLAD 70


>gi|242278141|ref|YP_002990270.1| ribosomal protein L28 [Desulfovibrio salexigens DSM 2638]
 gi|259646732|sp|C6BYE0|RL28_DESAD RecName: Full=50S ribosomal protein L28
 gi|242121035|gb|ACS78731.1| ribosomal protein L28 [Desulfovibrio salexigens DSM 2638]
          Length = 70

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/33 (60%), Positives = 27/33 (81%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNL 33
          MS+VC++  K   +GN VSHA+NKT+RRF+PNL
Sbjct: 1  MSQVCDICGKGPQTGNNVSHAHNKTKRRFMPNL 33


>gi|167753007|ref|ZP_02425134.1| hypothetical protein ALIPUT_01271 [Alistipes putredinis DSM
          17216]
 gi|167659321|gb|EDS03451.1| hypothetical protein ALIPUT_01271 [Alistipes putredinis DSM
          17216]
          Length = 77

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 39/61 (63%)

Query: 3  RVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQ 62
          +VCE+T K  + GN VSH+++KT+R+F PNL      S+   +   L++S   ++++ ++
Sbjct: 2  KVCEITGKVAVIGNNVSHSHHKTKRKFSPNLKNKRFWSEEEGRWITLKVSAAGIKTINKK 61

Query: 63 G 63
          G
Sbjct: 62 G 62


>gi|33151901|ref|NP_873254.1| 50S ribosomal protein L28 [Haemophilus ducreyi 35000HP]
 gi|67461505|sp|Q7VN52|RL28_HAEDU RecName: Full=50S ribosomal protein L28
 gi|33148122|gb|AAP95643.1| 50S ribosomal protein L28 [Haemophilus ducreyi 35000HP]
          Length = 78

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 41/70 (58%), Gaps = 1/70 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K    GN  SHA N TRRRFLPNL       +   +   LR++   +R ++
Sbjct: 1  MSRVCQVTSKRPAVGNNRSHALNATRRRFLPNLHTHRFWVESENRFVTLRLTAKGMRIID 60

Query: 61 RQGGLDRFLS 70
          ++ G+D  L+
Sbjct: 61 KK-GIDAVLA 69


>gi|194333387|ref|YP_002015247.1| 50S ribosomal protein L28 [Prosthecochloris aestuarii DSM 271]
 gi|226699146|sp|B4S5K3|RL28_PROA2 RecName: Full=50S ribosomal protein L28
 gi|194311205|gb|ACF45600.1| ribosomal protein L28 [Prosthecochloris aestuarii DSM 271]
          Length = 72

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/63 (42%), Positives = 39/63 (61%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS+VC LT K    GN VSHANN  R+RF PNL    +  +  ++  ++++S  AL+ + 
Sbjct: 1  MSKVCVLTGKRPKYGNTVSHANNHRRKRFEPNLHTKRVWLEEEKRWVKVKVSAKALKIMS 60

Query: 61 RQG 63
          RQG
Sbjct: 61 RQG 63


>gi|71006194|ref|XP_757763.1| hypothetical protein UM01616.1 [Ustilago maydis 521]
 gi|46097136|gb|EAK82369.1| hypothetical protein UM01616.1 [Ustilago maydis 521]
          Length = 157

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 26/79 (32%), Positives = 45/79 (56%)

Query: 10  KTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFL 69
           K + SG+ V  +  KT R + PN+    L S+ +++  + ++S  ALRS+++ GGLD +L
Sbjct: 61  KMIQSGHNVPKSRQKTARTWSPNIQSKKLWSNTLDRFVRAKVSTSALRSMDKMGGLDIYL 120

Query: 70  SNSKKENLSARMRTLRSQI 88
           + +  E L    R LR  +
Sbjct: 121 AKTSSEKLGEWGRNLRDTL 139


>gi|32034053|ref|ZP_00134297.1| COG0227: Ribosomal protein L28 [Actinobacillus pleuropneumoniae
          serovar 1 str. 4074]
 gi|126209425|ref|YP_001054650.1| 50S ribosomal protein L28 [Actinobacillus pleuropneumoniae L20]
 gi|165977414|ref|YP_001653007.1| 50S ribosomal protein L28 [Actinobacillus pleuropneumoniae
          serovar 3 str. JL03]
 gi|190151328|ref|YP_001969853.1| 50S ribosomal protein L28 [Actinobacillus pleuropneumoniae
          serovar 7 str. AP76]
 gi|240950186|ref|ZP_04754473.1| 50S ribosomal protein L28 [Actinobacillus minor NM305]
 gi|257465203|ref|ZP_05629574.1| 50S ribosomal protein L28 [Actinobacillus minor 202]
 gi|303250353|ref|ZP_07336552.1| 50S ribosomal protein L28 [Actinobacillus pleuropneumoniae
          serovar 6 str. Femo]
 gi|303251746|ref|ZP_07337917.1| 50S ribosomal protein L28 [Actinobacillus pleuropneumoniae
          serovar 2 str. 4226]
 gi|307246910|ref|ZP_07528975.1| 50S ribosomal protein L28 [Actinobacillus pleuropneumoniae
          serovar 1 str. 4074]
 gi|307249046|ref|ZP_07531054.1| 50S ribosomal protein L28 [Actinobacillus pleuropneumoniae
          serovar 2 str. S1536]
 gi|307251245|ref|ZP_07533166.1| 50S ribosomal protein L28 [Actinobacillus pleuropneumoniae
          serovar 4 str. M62]
 gi|307253662|ref|ZP_07535529.1| 50S ribosomal protein L28 [Actinobacillus pleuropneumoniae
          serovar 6 str. Femo]
 gi|307255892|ref|ZP_07537693.1| 50S ribosomal protein L28 [Actinobacillus pleuropneumoniae
          serovar 9 str. CVJ13261]
 gi|307258077|ref|ZP_07539829.1| 50S ribosomal protein L28 [Actinobacillus pleuropneumoniae
          serovar 10 str. D13039]
 gi|307260345|ref|ZP_07542052.1| 50S ribosomal protein L28 [Actinobacillus pleuropneumoniae
          serovar 11 str. 56153]
 gi|307262475|ref|ZP_07544120.1| 50S ribosomal protein L28 [Actinobacillus pleuropneumoniae
          serovar 12 str. 1096]
 gi|307264683|ref|ZP_07546263.1| 50S ribosomal protein L28 [Actinobacillus pleuropneumoniae
          serovar 13 str. N273]
 gi|322515257|ref|ZP_08068255.1| 50S ribosomal protein L28 [Actinobacillus ureae ATCC 25976]
 gi|325577759|ref|ZP_08148034.1| 50S ribosomal protein L28 [Haemophilus parainfluenzae ATCC 33392]
 gi|166226534|sp|A3N3Q9|RL28_ACTP2 RecName: Full=50S ribosomal protein L28
 gi|226738020|sp|B3H341|RL28_ACTP7 RecName: Full=50S ribosomal protein L28
 gi|226738021|sp|B0BTZ6|RL28_ACTPJ RecName: Full=50S ribosomal protein L28
 gi|126098217|gb|ABN75045.1| 50S ribosomal protein L28 [Actinobacillus pleuropneumoniae
          serovar 5b str. L20]
 gi|165877515|gb|ABY70563.1| 50S ribosomal protein L28 [Actinobacillus pleuropneumoniae
          serovar 3 str. JL03]
 gi|189916459|gb|ACE62711.1| 50S ribosomal protein L28 [Actinobacillus pleuropneumoniae
          serovar 7 str. AP76]
 gi|240295273|gb|EER46059.1| 50S ribosomal protein L28 [Actinobacillus minor NM305]
 gi|257450863|gb|EEV24906.1| 50S ribosomal protein L28 [Actinobacillus minor 202]
 gi|301154719|emb|CBW14182.1| 50S ribosomal subunit protein L28 [Haemophilus parainfluenzae
          T3T1]
 gi|302649176|gb|EFL79361.1| 50S ribosomal protein L28 [Actinobacillus pleuropneumoniae
          serovar 2 str. 4226]
 gi|302650823|gb|EFL80980.1| 50S ribosomal protein L28 [Actinobacillus pleuropneumoniae
          serovar 6 str. Femo]
 gi|306852195|gb|EFM84435.1| 50S ribosomal protein L28 [Actinobacillus pleuropneumoniae
          serovar 1 str. 4074]
 gi|306854504|gb|EFM86699.1| 50S ribosomal protein L28 [Actinobacillus pleuropneumoniae
          serovar 2 str. S1536]
 gi|306856761|gb|EFM88896.1| 50S ribosomal protein L28 [Actinobacillus pleuropneumoniae
          serovar 4 str. M62]
 gi|306858898|gb|EFM90944.1| 50S ribosomal protein L28 [Actinobacillus pleuropneumoniae
          serovar 6 str. Femo]
 gi|306861160|gb|EFM93153.1| 50S ribosomal protein L28 [Actinobacillus pleuropneumoniae
          serovar 9 str. CVJ13261]
 gi|306863440|gb|EFM95371.1| 50S ribosomal protein L28 [Actinobacillus pleuropneumoniae
          serovar 10 str. D13039]
 gi|306865596|gb|EFM97477.1| 50S ribosomal protein L28 [Actinobacillus pleuropneumoniae
          serovar 11 str. 56153]
 gi|306867852|gb|EFM99683.1| 50S ribosomal protein L28 [Actinobacillus pleuropneumoniae
          serovar 12 str. 1096]
 gi|306869995|gb|EFN01759.1| 50S ribosomal protein L28 [Actinobacillus pleuropneumoniae
          serovar 13 str. N273]
 gi|322118762|gb|EFX90968.1| 50S ribosomal protein L28 [Actinobacillus ureae ATCC 25976]
 gi|325160504|gb|EGC72630.1| 50S ribosomal protein L28 [Haemophilus parainfluenzae ATCC 33392]
          Length = 78

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 41/70 (58%), Gaps = 1/70 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K    GN  SHA N TRRRFLPNL       +   +   LR++   +R ++
Sbjct: 1  MSRVCQVTGKRPAVGNNRSHALNATRRRFLPNLHTHRFWVESENRFVTLRLTAKGMRIID 60

Query: 61 RQGGLDRFLS 70
          ++ G+D  L+
Sbjct: 61 KK-GIDAVLA 69


>gi|315930013|gb|EFV09156.1| ribosomal protein L28 [Campylobacter jejuni subsp. jejuni 305]
          Length = 52

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 28/52 (53%), Positives = 37/52 (71%), Gaps = 5/52 (9%)

Query: 13 MSGNKVSHANNKTRRRFLPNL--CRITLISDIMEQKYQLRISKCALRSVERQ 62
          M GN VSHANNKT+RRFLPNL   R+TL  D   +K  +RI+   LR++++Q
Sbjct: 1  MVGNNVSHANNKTKRRFLPNLRTVRVTL-EDGTTRK--MRIAASTLRTLKKQ 49


>gi|78189699|ref|YP_380037.1| 50S ribosomal protein L28 [Chlorobium chlorochromatii CaD3]
 gi|123579318|sp|Q3APT1|RL28_CHLCH RecName: Full=50S ribosomal protein L28
 gi|78171898|gb|ABB28994.1| LSU ribosomal protein L28P [Chlorobium chlorochromatii CaD3]
          Length = 72

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 38/63 (60%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS+VC LT K    GN VSHANN TR RF PNL    +  +  +Q  ++++S  A++ + 
Sbjct: 1  MSKVCLLTGKKPKYGNSVSHANNHTRTRFEPNLHTKKIWIEEEKQFVKVKLSAKAMKIIA 60

Query: 61 RQG 63
          + G
Sbjct: 61 KTG 63


>gi|225457937|ref|XP_002273919.1| PREDICTED: hypothetical protein [Vitis vinifera]
 gi|302142683|emb|CBI19886.3| unnamed protein product [Vitis vinifera]
          Length = 216

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 47/85 (55%), Gaps = 1/85 (1%)

Query: 12  VMSGNKVSH-ANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFLS 70
           +  GN+VS    NKTRR + PN+    L S I+++  +++++  ALR +++ GG+D +L 
Sbjct: 49  IQFGNRVSEDGGNKTRRSWKPNVQEKRLFSYILDRHIRVKVTTHALRCIDKAGGIDEYLL 108

Query: 71  NSKKENLSARMRTLRSQILKKMSEK 95
            +    +   M       ++KM E+
Sbjct: 109 KTPYHKMDTEMGLFWKAKIEKMYEE 133


>gi|237806958|ref|YP_002891398.1| 50S ribosomal protein L28 [Tolumonas auensis DSM 9187]
 gi|259646752|sp|C4L813|RL28_TOLAT RecName: Full=50S ribosomal protein L28
 gi|237499219|gb|ACQ91812.1| ribosomal protein L28 [Tolumonas auensis DSM 9187]
          Length = 78

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 37/63 (58%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K    GN  SHA N TRRRFLPNL       +  ++   LR++   +R ++
Sbjct: 1  MSRVCQVTGKRPTVGNNRSHAKNATRRRFLPNLQSHRFWVEGEKRFVTLRLTPKGMRIID 60

Query: 61 RQG 63
          + G
Sbjct: 61 KLG 63


>gi|326802522|ref|YP_004320341.1| 50S ribosomal protein L28 [Sphingobacterium sp. 21]
 gi|326553286|gb|ADZ81671.1| 50S ribosomal protein L28 [Sphingobacterium sp. 21]
          Length = 77

 Score = 49.7 bits (117), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 38/63 (60%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR+C+LT K  M+G  VS++N KT+R+F PNL           +   L++S  A++++ 
Sbjct: 1  MSRICDLTGKAAMNGYNVSNSNVKTKRKFYPNLQTKRFFIPEENRWITLKVSTSAIKTIN 60

Query: 61 RQG 63
          + G
Sbjct: 61 KNG 63


>gi|167855901|ref|ZP_02478651.1| 50S ribosomal protein L28 [Haemophilus parasuis 29755]
 gi|219872083|ref|YP_002476458.1| 50S ribosomal protein L28 [Haemophilus parasuis SH0165]
 gi|254801363|sp|B8F858|RL28_HAEPS RecName: Full=50S ribosomal protein L28
 gi|167852989|gb|EDS24253.1| 50S ribosomal protein L28 [Haemophilus parasuis 29755]
 gi|219692287|gb|ACL33510.1| 50S ribosomal protein L28 [Haemophilus parasuis SH0165]
          Length = 78

 Score = 49.7 bits (117), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 27/70 (38%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  + GN  SHA N T+RRFLPNL       +   +   LR++   +R ++
Sbjct: 1  MSRVCQVTGKRPVVGNNRSHAMNATKRRFLPNLHTHRFWVESENRFVTLRLTAKGMRIID 60

Query: 61 RQGGLDRFLS 70
          ++ G+D  L+
Sbjct: 61 KK-GIDAVLA 69


>gi|332880090|ref|ZP_08447774.1| ribosomal protein L28 [Capnocytophaga sp. oral taxon 329 str.
          F0087]
 gi|332682086|gb|EGJ54999.1| ribosomal protein L28 [Capnocytophaga sp. oral taxon 329 str.
          F0087]
          Length = 78

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 39/63 (61%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVC+LT K  + GN VSHA NKT+R+F  NL           +   L++S  A+++++
Sbjct: 1  MARVCDLTGKKALVGNNVSHAMNKTKRKFNVNLRTKRFFIPEENRWITLKVSAAAIKTID 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|147865450|emb|CAN79404.1| hypothetical protein VITISV_028074 [Vitis vinifera]
          Length = 1084

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 47/85 (55%), Gaps = 1/85 (1%)

Query: 12  VMSGNKVSH-ANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFLS 70
           +  GN+VS    NKTRR + PN+    L S I+++  +++++  ALR +++ GG+D +L 
Sbjct: 49  IQFGNRVSEDGGNKTRRSWKPNVQEKRLFSYILDRHIRVKVTTHALRCIDKAGGIDEYLL 108

Query: 71  NSKKENLSARMRTLRSQILKKMSEK 95
            +    +   M       ++KM E+
Sbjct: 109 KTPYHKMDTEMGLFWKAKIEKMYEE 133


>gi|213963580|ref|ZP_03391832.1| ribosomal protein L28 [Capnocytophaga sputigena Capno]
 gi|213953708|gb|EEB65038.1| ribosomal protein L28 [Capnocytophaga sputigena Capno]
          Length = 78

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 39/63 (61%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVC+LT K  + GN VSHA NKT+R+F  NL           +   L++S  A+++++
Sbjct: 1  MARVCDLTGKKALVGNNVSHAMNKTKRKFNVNLRTKRFFIPEENRWITLKVSAAAIKTID 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|291300851|ref|YP_003512129.1| 50S ribosomal protein L28 [Stackebrandtia nassauensis DSM 44728]
 gi|290570071|gb|ADD43036.1| ribosomal protein L28 [Stackebrandtia nassauensis DSM 44728]
          Length = 78

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 39/63 (61%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+R C++T      GN VSH+ ++TRRR+ PNL R        ++  +LR+S  A+R+++
Sbjct: 1  MTRRCDVTGAGPGFGNSVSHSAHRTRRRWNPNLQRRRYWLPSQQRWIRLRVSAKAIRTID 60

Query: 61 RQG 63
          R G
Sbjct: 61 RDG 63


>gi|109896379|ref|YP_659634.1| ribosomal protein L28 [Pseudoalteromonas atlantica T6c]
 gi|332304439|ref|YP_004432290.1| ribosomal protein L28 [Glaciecola agarilytica 4H-3-7+YE-5]
 gi|123171929|sp|Q15ZV8|RL28_PSEA6 RecName: Full=50S ribosomal protein L28
 gi|109698660|gb|ABG38580.1| LSU ribosomal protein L28P [Pseudoalteromonas atlantica T6c]
 gi|332171768|gb|AEE21022.1| ribosomal protein L28 [Glaciecola agarilytica 4H-3-7+YE-5]
          Length = 78

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 42/71 (59%), Gaps = 1/71 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS+VC +T K    GN  SHA N TRRRFLPNL       +   +  +LR+S   +R ++
Sbjct: 1  MSKVCIVTGKRPAVGNNRSHAKNSTRRRFLPNLQTHRFWVESENRFVKLRLSAKGMRIID 60

Query: 61 RQGGLDRFLSN 71
          ++ G+D  L++
Sbjct: 61 KK-GIDSVLTD 70


>gi|50292515|ref|XP_448690.1| hypothetical protein [Candida glabrata CBS 138]
 gi|49528002|emb|CAG61653.1| unnamed protein product [Candida glabrata]
          Length = 267

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 46/73 (63%), Gaps = 4/73 (5%)

Query: 12  VMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFLSN 71
           V  GNK+S + +KTRR + PN+ + +L S+ + +   ++++   LR++ ++GG+D +L  
Sbjct: 88  VKYGNKISESKHKTRRTWHPNVIKKSLWSETLNRSINIKMTAKVLRTIIKEGGIDNYLIK 147

Query: 72  SKKENLSARMRTL 84
            K    SAR++ L
Sbjct: 148 DK----SARIKEL 156


>gi|255646903|gb|ACU23921.1| unknown [Glycine max]
          Length = 235

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 49/90 (54%), Gaps = 1/90 (1%)

Query: 7   LTKKTVMSGNKVSH-ANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGL 65
              K +  GN+VS    NK+RR + PN+    L S I+++  +++++  ALR +++ GG+
Sbjct: 48  FAGKHIQFGNRVSEDGGNKSRRTWKPNVQEKRLFSYILDRHVRVKVTTHALRCIDKAGGI 107

Query: 66  DRFLSNSKKENLSARMRTLRSQILKKMSEK 95
           D +L  +    +   M  L    ++K+ E+
Sbjct: 108 DEYLLKTPYHKMDTEMGILWKAKIEKLYEE 137


>gi|50307287|ref|XP_453622.1| hypothetical protein [Kluyveromyces lactis NRRL Y-1140]
 gi|49642756|emb|CAH00718.1| KLLA0D12562p [Kluyveromyces lactis]
          Length = 255

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 45/73 (61%), Gaps = 4/73 (5%)

Query: 12  VMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFLSN 71
           +  GN ++ +  KTRR + PN+ R  L S+ + +K  ++++   LR++ ++GG+D +L+ 
Sbjct: 76  IQFGNNIAESKTKTRRSWSPNVIRKGLWSETLNRKISIKMTAKVLRTITKEGGIDNYLTK 135

Query: 72  SKKENLSARMRTL 84
            K    +AR++ L
Sbjct: 136 EK----AARIKEL 144


>gi|119194203|ref|XP_001247705.1| hypothetical protein CIMG_01476 [Coccidioides immitis RS]
          Length = 224

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 42/65 (64%), Gaps = 2/65 (3%)

Query: 11  TVMSGNKVSHANN--KTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRF 68
           T+  GNK+S   N  KTRR + PN+ +  L S+ +E+   L++    LR+++++GGLD++
Sbjct: 69  TIQFGNKISKGRNEGKTRRIWKPNIRKEKLYSEALEKWLDLKVQHRVLRTIKKEGGLDQY 128

Query: 69  LSNSK 73
           L + K
Sbjct: 129 LLSDK 133


>gi|161833678|ref|YP_001597874.1| 50S ribosomal subunit protein L28 [Candidatus Sulcia muelleri
          GWSS]
 gi|293977789|ref|YP_003543219.1| 50S ribosomal protein L28P [Candidatus Sulcia muelleri DMIN]
 gi|189029460|sp|A8Z5S7|RL28_SULMW RecName: Full=50S ribosomal protein L28
 gi|152206168|gb|ABS30478.1| 50S ribosomal subunit protein L28 [Candidatus Sulcia muelleri
          GWSS]
 gi|292667720|gb|ADE35355.1| LSU ribosomal protein L28P [Candidatus Sulcia muelleri DMIN]
          Length = 77

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/63 (39%), Positives = 40/63 (63%), Gaps = 2/63 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS++C++T K  M GNKVSHANNKT+R F  NL +      I ++   L++S   ++++ 
Sbjct: 1  MSKLCQITGKKPMMGNKVSHANNKTKRIFNLNLSKKRFF--IKKKWILLKVSSAGIKTIN 58

Query: 61 RQG 63
          + G
Sbjct: 59 KFG 61


>gi|303311457|ref|XP_003065740.1| ribosomal L28 family protein [Coccidioides posadasii C735 delta
           SOWgp]
 gi|240105402|gb|EER23595.1| ribosomal L28 family protein [Coccidioides posadasii C735 delta
           SOWgp]
 gi|320039613|gb|EFW21547.1| 50S ribosomal protein L24 [Coccidioides posadasii str. Silveira]
          Length = 224

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 42/65 (64%), Gaps = 2/65 (3%)

Query: 11  TVMSGNKVSHANN--KTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRF 68
           T+  GNK+S   N  KTRR + PN+ +  L S+ +E+   L++    LR+++++GGLD++
Sbjct: 69  TIQFGNKISKGRNEGKTRRIWKPNIRKEKLYSEALEKWLDLKVQHRVLRTIKKEGGLDQY 128

Query: 69  LSNSK 73
           L + K
Sbjct: 129 LLSDK 133


>gi|328953946|ref|YP_004371280.1| 50S ribosomal protein L28 [Desulfobacca acetoxidans DSM 11109]
 gi|328454270|gb|AEB10099.1| 50S ribosomal protein L28 [Desulfobacca acetoxidans DSM 11109]
          Length = 63

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 27/58 (46%), Positives = 38/58 (65%), Gaps = 2/58 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS 58
          M++ CE+  K    GN VSHANNKT+RR+LPNL R+  + +  + KY    ++C LRS
Sbjct: 1  MAKFCEICGKGPQVGNNVSHANNKTKRRWLPNLRRVRALQN-GQVKYIQVCTRC-LRS 56


>gi|221135335|ref|ZP_03561638.1| ribosomal protein L28 [Glaciecola sp. HTCC2999]
          Length = 78

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M++VC++T K    GN  SHA N TRRRFLPNL       +   +  +LR++   +R ++
Sbjct: 1  MAKVCQVTGKRPAVGNNRSHARNATRRRFLPNLQTHRFWVESENRFVKLRLTPKGMRIID 60

Query: 61 RQGGLDRFLS 70
          ++ G+D  L+
Sbjct: 61 KK-GIDSVLT 69


>gi|256820965|ref|YP_003142244.1| 50S ribosomal protein L28 [Capnocytophaga ochracea DSM 7271]
 gi|315224164|ref|ZP_07866004.1| 50S ribosomal protein L28 [Capnocytophaga ochracea F0287]
 gi|256582548|gb|ACU93683.1| ribosomal protein L28 [Capnocytophaga ochracea DSM 7271]
 gi|314945897|gb|EFS97906.1| 50S ribosomal protein L28 [Capnocytophaga ochracea F0287]
          Length = 78

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 39/63 (61%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVC+LT K  + GN VSHA NKT+R+F  NL           +   L++S  A+++++
Sbjct: 1  MARVCDLTGKKALVGNNVSHAMNKTKRKFNVNLRTKRFFIPEENRWITLKVSATAIKTID 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|261494188|ref|ZP_05990690.1| RpmB protein [Mannheimia haemolytica serotype A2 str. BOVINE]
 gi|261495584|ref|ZP_05992030.1| RpmB protein [Mannheimia haemolytica serotype A2 str. OVINE]
 gi|261308691|gb|EEY09948.1| RpmB protein [Mannheimia haemolytica serotype A2 str. OVINE]
 gi|261310169|gb|EEY11370.1| RpmB protein [Mannheimia haemolytica serotype A2 str. BOVINE]
          Length = 78

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 27/70 (38%), Positives = 41/70 (58%), Gaps = 1/70 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K    GN  SHA N T+RRFLPNL       +   +   LR++   +R ++
Sbjct: 1  MSRVCQVTGKRPAVGNNRSHAMNATKRRFLPNLHTHRFWVESENRFVTLRLTAKGMRIID 60

Query: 61 RQGGLDRFLS 70
          ++ G+D  L+
Sbjct: 61 KK-GIDAVLA 69


>gi|260063513|ref|YP_003196593.1| 50S ribosomal protein L28 [Robiginitalea biformata HTCC2501]
 gi|88782957|gb|EAR14131.1| 50S ribosomal protein L28 [Robiginitalea biformata HTCC2501]
          Length = 78

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 27/63 (42%), Positives = 38/63 (60%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS+VCELT K    GN VS + NKTRRRF  NL +        ++   L++S  AL+++ 
Sbjct: 1  MSKVCELTGKRAQFGNNVSFSINKTRRRFDVNLSKKRFYIPEEDRWITLKVSARALKAIN 60

Query: 61 RQG 63
          R+G
Sbjct: 61 RKG 63


>gi|291515234|emb|CBK64444.1| LSU ribosomal protein L28P [Alistipes shahii WAL 8301]
          Length = 77

 Score = 48.9 bits (115), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 39/61 (63%)

Query: 3  RVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQ 62
          +VCE+T K  + GN VSH++++T+R+F PNL      S+   +   L++S   ++++ ++
Sbjct: 2  KVCEITGKVAIVGNNVSHSHHRTKRKFSPNLKTKRFWSEQEGRWITLKVSAAGMKTINKK 61

Query: 63 G 63
          G
Sbjct: 62 G 62


>gi|193212242|ref|YP_001998195.1| 50S ribosomal protein L28 [Chlorobaculum parvum NCIB 8327]
 gi|226738049|sp|B3QM42|RL28_CHLP8 RecName: Full=50S ribosomal protein L28
 gi|193085719|gb|ACF10995.1| ribosomal protein L28 [Chlorobaculum parvum NCIB 8327]
          Length = 72

 Score = 48.9 bits (115), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 38/63 (60%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS+VC LT K    GN VSHANN TR RF PNL    +  +  ++  ++R+S  A++ + 
Sbjct: 1  MSKVCVLTGKKPKYGNNVSHANNHTRTRFEPNLHTKRIWIEEEKRWVKVRVSAKAMKIMS 60

Query: 61 RQG 63
          + G
Sbjct: 61 KTG 63


>gi|297183384|gb|ADI19518.1| hypothetical protein [uncultured Chloroflexi bacterium
          HF0770_09E03]
          Length = 63

 Score = 48.9 bits (115), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 29/36 (80%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRI 36
          M+RVCE+  K  ++GN VSHA+NK+RRR+ PNL R+
Sbjct: 1  MARVCEMCGKKPVAGNSVSHAHNKSRRRWNPNLQRV 36


>gi|332884209|gb|EGK04477.1| 50S ribosomal protein L28 [Dysgonomonas mossii DSM 22836]
          Length = 79

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 42/77 (54%), Gaps = 1/77 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS++C++T K  M GN VSH+N KT+R+F  NL R        +    L +S   LR++ 
Sbjct: 1  MSKICQITGKKAMVGNNVSHSNRKTKRKFNVNLFRKKFYWVEEDCWISLNVSAAGLRTIN 60

Query: 61 RQGGLDRFLSNSKKENL 77
          +  GLD  L  + ++  
Sbjct: 61 KI-GLDAALKRAAEDGF 76


>gi|71892377|ref|YP_278111.1| 50S ribosomal protein L28 [Candidatus Blochmannia pennsylvanicus
          str. BPEN]
 gi|123640780|sp|Q491X0|RL28_BLOPB RecName: Full=50S ribosomal protein L28
 gi|71796483|gb|AAZ41234.1| 50S ribosomal subunit protein L28 [Candidatus Blochmannia
          pennsylvanicus str. BPEN]
          Length = 75

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 41/70 (58%), Gaps = 1/70 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVC++T K  MSGNK SHA N T+R F PN+          ++   LR+S   +R ++
Sbjct: 1  MARVCQVTGKRPMSGNKRSHAMNATKRWFAPNIHSHRFWVASKKRFVALRLSTKGIRLID 60

Query: 61 RQGGLDRFLS 70
          +  G++ F +
Sbjct: 61 KF-GIEYFFT 69


>gi|86133834|ref|ZP_01052416.1| 50S ribosomal protein L28 [Polaribacter sp. MED152]
 gi|85820697|gb|EAQ41844.1| 50S ribosomal protein L28 [Polaribacter sp. MED152]
          Length = 79

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 37/63 (58%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVCELT K  M GN VS A N+T+R F  NL          ++   L++S  AL+++ 
Sbjct: 1  MSRVCELTGKKAMVGNNVSKALNRTKRTFDANLMTKRFYIPEEDKWVTLKVSASALKNIN 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|319775113|ref|YP_004137601.1| 50S ribosomal subunit protein L28 [Haemophilus influenzae F3047]
 gi|329122973|ref|ZP_08251544.1| 50S ribosomal protein L28 [Haemophilus aegyptius ATCC 11116]
 gi|317449704|emb|CBY85911.1| 50S ribosomal subunit protein L28 [Haemophilus influenzae F3047]
 gi|327471904|gb|EGF17344.1| 50S ribosomal protein L28 [Haemophilus aegyptius ATCC 11116]
          Length = 78

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 27/70 (38%), Positives = 40/70 (57%), Gaps = 1/70 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K    GN  SHA N  RRRFLPNL       +   +   LR++   +R ++
Sbjct: 1  MSRVCQVTGKRPAVGNNRSHAMNAARRRFLPNLHTHRFWVESENRFVTLRLTAKGMRIID 60

Query: 61 RQGGLDRFLS 70
          ++ G+D  L+
Sbjct: 61 KK-GIDAVLA 69


>gi|298529759|ref|ZP_07017162.1| ribosomal protein L28 [Desulfonatronospira thiodismutans ASO3-1]
 gi|298511195|gb|EFI35098.1| ribosomal protein L28 [Desulfonatronospira thiodismutans ASO3-1]
          Length = 68

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 27/36 (75%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRI 36
          M++ CE+  K   +GN VSHANN TRRRF+PNL R+
Sbjct: 1  MTKQCEVCGKKPATGNNVSHANNHTRRRFMPNLRRV 36


>gi|119470591|ref|ZP_01613294.1| 50S ribosomal subunit protein L28 [Alteromonadales bacterium
          TW-7]
 gi|119446292|gb|EAW27569.1| 50S ribosomal subunit protein L28 [Alteromonadales bacterium
          TW-7]
          Length = 78

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 27/70 (38%), Positives = 41/70 (58%), Gaps = 1/70 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS+VC++T K    GN  SHA N TRRRFLPNL       +  ++   LR +   +R ++
Sbjct: 1  MSKVCQVTGKRPAVGNHRSHARNATRRRFLPNLQTHRFWVESEKRFVTLRTTTKGMRIID 60

Query: 61 RQGGLDRFLS 70
          ++ G+D  L+
Sbjct: 61 KK-GIDAVLT 69


>gi|283851281|ref|ZP_06368563.1| ribosomal protein L28 [Desulfovibrio sp. FW1012B]
 gi|283573231|gb|EFC21209.1| ribosomal protein L28 [Desulfovibrio sp. FW1012B]
          Length = 68

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/33 (63%), Positives = 25/33 (75%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNL 33
          M+++CE   K   SGN VSHANNKT+RRF PNL
Sbjct: 1  MAKICEHCGKKPQSGNNVSHANNKTKRRFEPNL 33


>gi|254458326|ref|ZP_05071752.1| ribosomal protein L28 [Campylobacterales bacterium GD 1]
 gi|207085162|gb|EDZ62448.1| ribosomal protein L28 [Campylobacterales bacterium GD 1]
          Length = 62

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 42/63 (66%), Gaps = 5/63 (7%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNL--CRITLISDIMEQKYQLRISKCALRS 58
          M+R C ++ K  MSGN VSHA N+T+RRFL NL   RITL  D   QK  ++IS   LR+
Sbjct: 1  MARKCAISGKGPMSGNNVSHAKNRTKRRFLLNLRTVRITL-EDGTTQK--IKISARELRT 57

Query: 59 VER 61
          +++
Sbjct: 58 LKK 60


>gi|332534469|ref|ZP_08410308.1| 50S ribosomal protein L28 [Pseudoalteromonas haloplanktis
          ANT/505]
 gi|332036122|gb|EGI72598.1| 50S ribosomal protein L28 [Pseudoalteromonas haloplanktis
          ANT/505]
          Length = 78

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 27/70 (38%), Positives = 41/70 (58%), Gaps = 1/70 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS+VC++T K    GN  SHA N TRRRFLPNL       +  ++   LR +   +R ++
Sbjct: 1  MSKVCQVTGKRPAVGNHRSHARNATRRRFLPNLQTHRFWVESEKRFVTLRTTTKGMRIID 60

Query: 61 RQGGLDRFLS 70
          ++ G+D  L+
Sbjct: 61 KK-GIDTVLT 69


>gi|160872438|ref|ZP_02062570.1| conserved domain protein [Rickettsiella grylli]
 gi|159121237|gb|EDP46575.1| conserved domain protein [Rickettsiella grylli]
          Length = 82

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 46/71 (64%), Gaps = 3/71 (4%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKY-QLRISKCALRSV 59
          M+RVC++T K  M G+ VSH+N KT+RRF  NL  I  +    E+++ +LRI+   LR +
Sbjct: 5  MARVCQVTGKKPMVGHNVSHSNRKTKRRFQINL-HIRRLWVASEKRFVKLRITSQGLRII 63

Query: 60 ERQGGLDRFLS 70
          E+  G+D  L+
Sbjct: 64 EKL-GIDNVLA 73


>gi|328774136|gb|EGF84173.1| hypothetical protein BATDEDRAFT_21979 [Batrachochytrium
           dendrobatidis JAM81]
          Length = 185

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 28/89 (31%), Positives = 48/89 (53%), Gaps = 2/89 (2%)

Query: 7   LTKKTVMSGNKVSHAN-NKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGL 65
           L  K +  G +VS A  N++RR + PN+  I+L S  ++     RIS  ALR ++ +GG 
Sbjct: 46  LHDKKITFGEQVSEAGKNRSRRVWYPNVQYISLYSRALDMNIWTRISTAALREIDHKGGF 105

Query: 66  DRFLSNSKKENLSARM-RTLRSQILKKMS 93
           D ++ +   + L   + +  R +ILK+  
Sbjct: 106 DEYIISVADKLLPCEIAKMYRDRILKQYD 134


>gi|94265179|ref|ZP_01288941.1| Ribosomal protein L28 [delta proteobacterium MLMS-1]
 gi|93454320|gb|EAT04627.1| Ribosomal protein L28 [delta proteobacterium MLMS-1]
          Length = 64

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 20/33 (60%), Positives = 26/33 (78%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNL 33
          MS++CE+  K    GN +SHA+NKTRRR+LPNL
Sbjct: 1  MSKICEVCGKKPEVGNNISHAHNKTRRRWLPNL 33


>gi|32423706|gb|AAP81249.1| ribosomal protein L28 [Candidatus Portiera aleyrodidarum]
          Length = 71

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 39/63 (61%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M++ C++T K  M GN VSH++ KTRRRF+PNL +        ++  ++ I+   +R ++
Sbjct: 1  MTKRCQITYKKPMQGNNVSHSHRKTRRRFMPNLQKHRFWIKKEKRYIKMHITTKGMRIID 60

Query: 61 RQG 63
          + G
Sbjct: 61 KYG 63


>gi|94676711|ref|YP_588640.1| ribosomal protein L28 [Baumannia cicadellinicola str. Hc
          (Homalodisca coagulata)]
 gi|166226545|sp|Q1LTS4|RL28_BAUCH RecName: Full=50S ribosomal protein L28
 gi|94219861|gb|ABF14020.1| ribosomal protein L28 [Baumannia cicadellinicola str. Hc
          (Homalodisca coagulata)]
          Length = 75

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 40/63 (63%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR C++T K  +SGN  S+A N T+RRFLPNL       +  ++  ++R+S   +R ++
Sbjct: 1  MSRFCQVTGKRSVSGNNRSYAMNATKRRFLPNLHFHRFWIEAEKRFIKIRVSAKGMRVID 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|254281533|ref|ZP_04956501.1| ribosomal protein L28 [gamma proteobacterium NOR51-B]
 gi|219677736|gb|EED34085.1| ribosomal protein L28 [gamma proteobacterium NOR51-B]
          Length = 72

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 35/57 (61%)

Query: 7  LTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQG 63
          +T K  ++GN VSHA N+TRRRFLPNL       +   +   LR+S   +R ++++G
Sbjct: 1  MTGKRPITGNNVSHAKNRTRRRFLPNLHNHRFWVESENRFVTLRVSSKGMRVIDKRG 57


>gi|303245780|ref|ZP_07332063.1| ribosomal protein L28 [Desulfovibrio fructosovorans JJ]
 gi|302493043|gb|EFL52908.1| ribosomal protein L28 [Desulfovibrio fructosovorans JJ]
          Length = 68

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 20/36 (55%), Positives = 27/36 (75%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRI 36
          M+++CE   K   SGN VSHANNK++RRF PNL ++
Sbjct: 1  MAKICEHCGKKPQSGNNVSHANNKSKRRFSPNLVKV 36


>gi|302498845|ref|XP_003011419.1| hypothetical protein ARB_02269 [Arthroderma benhamiae CBS 112371]
 gi|291174970|gb|EFE30779.1| hypothetical protein ARB_02269 [Arthroderma benhamiae CBS 112371]
          Length = 280

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 46/76 (60%), Gaps = 6/76 (7%)

Query: 11  TVMSGNKVSHANNK--TRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRF 68
           T++ GNK+S   NK  TRR + PN+ +  + S  ++++ +L+++   LR++ + GGLD +
Sbjct: 121 TIIFGNKISKGRNKGKTRRIWKPNVRKEKIYSKALDEEIELKVTHGVLRTINKVGGLDEY 180

Query: 69  LSNSKKENLSARMRTL 84
           L   K     AR++ L
Sbjct: 181 LLGDK----PARIKEL 192


>gi|330995105|ref|ZP_08319022.1| ribosomal protein L28 [Paraprevotella xylaniphila YIT 11841]
 gi|329576681|gb|EGG58184.1| ribosomal protein L28 [Paraprevotella xylaniphila YIT 11841]
          Length = 86

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 27/72 (37%), Positives = 40/72 (55%), Gaps = 1/72 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS++C++T K  M GN VSH+  +T+RRF  NL          +    L+IS   LR + 
Sbjct: 1  MSKICQITGKKAMVGNNVSHSKRRTKRRFDVNLFTKKFYYVEQDCWISLKISAAGLRYIN 60

Query: 61 RQGGLDRFLSNS 72
          +  GLD  L+N+
Sbjct: 61 KV-GLDAALANA 71


>gi|320354592|ref|YP_004195931.1| 50S ribosomal protein L28P [Desulfobulbus propionicus DSM 2032]
 gi|320123094|gb|ADW18640.1| LSU ribosomal protein L28P [Desulfobulbus propionicus DSM 2032]
          Length = 64

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 30/40 (75%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLIS 40
          M+R C +  K   +GN VSHA+NKTRRR++PNL R+ +++
Sbjct: 1  MARNCAICGKGPSTGNNVSHAHNKTRRRWMPNLQRVRMVT 40


>gi|225559900|gb|EEH08182.1| 50S ribosomal protein L24 [Ajellomyces capsulatus G186AR]
 gi|225559950|gb|EEH08232.1| 50S ribosomal protein L24 [Ajellomyces capsulatus G186AR]
          Length = 187

 Score = 47.8 bits (112), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 27/76 (35%), Positives = 44/76 (57%), Gaps = 6/76 (7%)

Query: 11  TVMSGNKVSHANNK--TRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRF 68
           T+  GNK+S   NK  TRR + PN+    L S+ + +  QL++    LR++++ GGLD++
Sbjct: 65  TIQFGNKISKGRNKGKTRRTWKPNIRHEELYSEALGKTLQLKVQHRVLRTIKKVGGLDQY 124

Query: 69  LSNSKKENLSARMRTL 84
           L   K     AR++ L
Sbjct: 125 LLGDK----PARIKEL 136


>gi|302658408|ref|XP_003020908.1| hypothetical protein TRV_04984 [Trichophyton verrucosum HKI 0517]
 gi|291184778|gb|EFE40290.1| hypothetical protein TRV_04984 [Trichophyton verrucosum HKI 0517]
          Length = 339

 Score = 47.8 bits (112), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 46/76 (60%), Gaps = 6/76 (7%)

Query: 11  TVMSGNKVSHANNK--TRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRF 68
           T++ GNK+S   NK  TRR + PN+ +  + S  ++++ +L+++   LR++ + GGLD +
Sbjct: 180 TIIFGNKISKGRNKGKTRRIWKPNVRKEKIYSKALDEEIELKVTHGVLRTINKVGGLDEY 239

Query: 69  LSNSKKENLSARMRTL 84
           L   K     AR++ L
Sbjct: 240 LLGDK----PARIKEL 251


>gi|154287660|ref|XP_001544625.1| conserved hypothetical protein [Ajellomyces capsulatus NAm1]
 gi|150408266|gb|EDN03807.1| conserved hypothetical protein [Ajellomyces capsulatus NAm1]
          Length = 191

 Score = 47.8 bits (112), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 27/76 (35%), Positives = 44/76 (57%), Gaps = 6/76 (7%)

Query: 11  TVMSGNKVSHANNK--TRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRF 68
           T+  GNK+S   NK  TRR + PN+    L S+ + +  QL++    LR++++ GGLD++
Sbjct: 65  TIQFGNKISKGRNKGKTRRTWKPNIRHEELYSEALGKTLQLKVQHRVLRTIKKVGGLDQY 124

Query: 69  LSNSKKENLSARMRTL 84
           L   K     AR++ L
Sbjct: 125 LLGDK----PARIKEL 136


>gi|327483098|gb|AEA77505.1| LSU ribosomal protein L28p [Vibrio cholerae LMA3894-4]
          Length = 78

 Score = 47.4 bits (111), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 38/63 (60%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K    GN  SHA N T+ RFLPNL       +  ++  +LR++   +R ++
Sbjct: 1  MSRVCQVTGKRPAVGNNRSHAKNATKYRFLPNLQTHRFWVESEKRFVKLRLTAKGMRIID 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|327295266|ref|XP_003232328.1| 50S ribosomal protein L24 [Trichophyton rubrum CBS 118892]
 gi|326465500|gb|EGD90953.1| 50S ribosomal protein L24 [Trichophyton rubrum CBS 118892]
          Length = 232

 Score = 47.4 bits (111), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 46/76 (60%), Gaps = 6/76 (7%)

Query: 11  TVMSGNKVSHANNK--TRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRF 68
           T++ GNK+S   NK  TRR + PN+ +  + S  ++++ +L+++   LR++ + GGLD +
Sbjct: 73  TIIFGNKISKGRNKGKTRRIWKPNVRKEKIYSKALDEEIELKVTHGVLRTINKVGGLDEY 132

Query: 69  LSNSKKENLSARMRTL 84
           L   K     AR++ L
Sbjct: 133 LLGDK----PARIKEL 144


>gi|240276199|gb|EER39711.1| 50S ribosomal protein L24 [Ajellomyces capsulatus H143]
 gi|325089935|gb|EGC43245.1| 50S ribosomal protein [Ajellomyces capsulatus H88]
          Length = 187

 Score = 47.4 bits (111), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 27/76 (35%), Positives = 44/76 (57%), Gaps = 6/76 (7%)

Query: 11  TVMSGNKVSHANNK--TRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRF 68
           T+  GNK+S   NK  TRR + PN+    L S+ + +  QL++    LR++++ GGLD++
Sbjct: 65  TIQFGNKISKGRNKGKTRRTWKPNIRHEELYSEALGKTLQLKVQHRVLRTIKKVGGLDQY 124

Query: 69  LSNSKKENLSARMRTL 84
           L   K     AR++ L
Sbjct: 125 LLGDK----PARIKEL 136


>gi|237752497|ref|ZP_04582977.1| 50s ribosomal protein l28 [Helicobacter winghamensis ATCC
          BAA-430]
 gi|229375986|gb|EEO26077.1| 50s ribosomal protein l28 [Helicobacter winghamensis ATCC
          BAA-430]
          Length = 62

 Score = 47.4 bits (111), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 28/64 (43%), Positives = 40/64 (62%), Gaps = 5/64 (7%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNL--CRITLISDIMEQKYQLRISKCALRS 58
          M+R C  T K  M GN VSHANNKT++R LPNL   RI L      +  ++RI+   LR+
Sbjct: 1  MARKCFFTGKGPMVGNNVSHANNKTKKRTLPNLRTVRIKLEDG---RTMKVRIAASTLRT 57

Query: 59 VERQ 62
          ++++
Sbjct: 58 MKKR 61


>gi|188527670|ref|YP_001910357.1| 50S ribosomal protein L28 [Helicobacter pylori Shi470]
 gi|207092590|ref|ZP_03240377.1| 50S ribosomal protein L28 [Helicobacter pylori HPKX_438_AG0C1]
 gi|208434415|ref|YP_002266081.1| ribosomal protein L28 [Helicobacter pylori G27]
 gi|217034359|ref|ZP_03439774.1| hypothetical protein HP9810_889g4 [Helicobacter pylori 98-10]
 gi|308182646|ref|YP_003926773.1| 50S ribosomal protein L28 [Helicobacter pylori PeCan4]
 gi|226694946|sp|B5Z6L6|RL28_HELPG RecName: Full=50S ribosomal protein L28
 gi|226694948|sp|B2UTZ5|RL28_HELPS RecName: Full=50S ribosomal protein L28
 gi|188143910|gb|ACD48327.1| 50S ribosomal protein L28 [Helicobacter pylori Shi470]
 gi|208432344|gb|ACI27215.1| ribosomal protein L28 [Helicobacter pylori G27]
 gi|216943154|gb|EEC22624.1| hypothetical protein HP9810_889g4 [Helicobacter pylori 98-10]
 gi|297379688|gb|ADI34575.1| ribosomal protein L28 [Helicobacter pylori v225d]
 gi|308061820|gb|ADO03708.1| 50S ribosomal protein L28 [Helicobacter pylori Cuz20]
 gi|308063711|gb|ADO05598.1| 50S ribosomal protein L28 [Helicobacter pylori Sat464]
 gi|308064831|gb|ADO06723.1| 50S ribosomal protein L28 [Helicobacter pylori PeCan4]
 gi|317177670|dbj|BAJ55459.1| 50S ribosomal protein L28 [Helicobacter pylori F16]
 gi|317179139|dbj|BAJ56927.1| 50S ribosomal protein L28 [Helicobacter pylori F30]
 gi|317181812|dbj|BAJ59596.1| 50S ribosomal protein L28 [Helicobacter pylori F57]
 gi|332673716|gb|AEE70533.1| 50S ribosomal protein L28 [Helicobacter pylori 83]
          Length = 62

 Score = 47.4 bits (111), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 26/61 (42%), Positives = 38/61 (62%), Gaps = 1/61 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M++ C LT K  M GN VSHANNK +RR LPNL  I +  D    K +++++   LR++ 
Sbjct: 1  MAKRCALTFKGPMVGNHVSHANNKNKRRLLPNLRSIKIQLDDGTTK-RIKVAASTLRTMR 59

Query: 61 R 61
          +
Sbjct: 60 K 60


>gi|315043030|ref|XP_003170891.1| 54S ribosomal protein L24 [Arthroderma gypseum CBS 118893]
 gi|311344680|gb|EFR03883.1| 54S ribosomal protein L24 [Arthroderma gypseum CBS 118893]
          Length = 232

 Score = 47.4 bits (111), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 46/76 (60%), Gaps = 6/76 (7%)

Query: 11  TVMSGNKVSHANNK--TRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRF 68
           T++ GNK+S   NK  TRR + PN+ +  + S  ++++ +L+++   LR++ + GGLD +
Sbjct: 73  TIIFGNKISKGRNKGKTRRIWKPNVRKEKVYSKALDEEIELKVTHGVLRTINKVGGLDEY 132

Query: 69  LSNSKKENLSARMRTL 84
           L   K     AR++ L
Sbjct: 133 LLGDK----PARIKEL 144


>gi|21672371|ref|NP_660438.1| 50S ribosomal protein L28 [Buchnera aphidicola str. Sg
          (Schizaphis graminum)]
 gi|25009086|sp|Q8KA33|RL28_BUCAP RecName: Full=50S ribosomal protein L28
 gi|21622976|gb|AAM67649.1| 50S ribosomal protein L28 [Buchnera aphidicola str. Sg
          (Schizaphis graminum)]
          Length = 78

 Score = 47.4 bits (111), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 39/63 (61%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR+C++T+K  M GN  SHA N  +R+FLPN+          ++  +LRIS   +R ++
Sbjct: 1  MSRICQVTRKKRMIGNNRSHAMNAKKRQFLPNIQYHRFWIPEEKRFIKLRISAHGMRCID 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|224009912|ref|XP_002293914.1| RM24, ribosomal protein 24 mitochondrial large ribosomal subunit
          [Thalassiosira pseudonana CCMP1335]
 gi|220970586|gb|EED88923.1| RM24, ribosomal protein 24 mitochondrial large ribosomal subunit
          [Thalassiosira pseudonana CCMP1335]
          Length = 70

 Score = 47.4 bits (111), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 36/60 (60%)

Query: 10 KTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFL 69
          K V  GN V  +  KTRRR+ PN+    + S+I+ +     I+  ALRS+++ GGLD +L
Sbjct: 10 KDVRFGNNVPFSLKKTRRRWNPNVQLKRVYSEILGEMIPFHITTSALRSIDKMGGLDNYL 69


>gi|207109912|ref|ZP_03244074.1| 50S ribosomal protein L28 [Helicobacter pylori HPKX_438_CA4C1]
          Length = 61

 Score = 47.4 bits (111), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 26/61 (42%), Positives = 38/61 (62%), Gaps = 1/61 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M++ C LT K  M GN VSHANNK +RR LPNL  I +  D    K +++++   LR++ 
Sbjct: 1  MAKRCALTFKGPMVGNHVSHANNKNKRRLLPNLRSIKIQLDDGTTK-RIKVAASTLRTMR 59

Query: 61 R 61
          +
Sbjct: 60 K 60


>gi|293333379|ref|NP_001168906.1| hypothetical protein LOC100382712 [Zea mays]
 gi|223973641|gb|ACN31008.1| unknown [Zea mays]
          Length = 207

 Score = 47.4 bits (111), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 44/79 (55%), Gaps = 1/79 (1%)

Query: 15  GNKVSH-ANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFLSNSK 73
           GNKVS    NK+RR + PN+    L S + +Q  +++++  ALR +++ GG+D +L  + 
Sbjct: 57  GNKVSEDGGNKSRRSWKPNVQEKRLFSYVHDQHIRVKVTTHALRCIDKAGGIDEYLLKTP 116

Query: 74  KENLSARMRTLRSQILKKM 92
              +   M  +    ++KM
Sbjct: 117 YNKMDTEMGIVWKANIEKM 135


>gi|262201431|ref|YP_003272639.1| 50S ribosomal protein L28 [Gordonia bronchialis DSM 43247]
 gi|262084778|gb|ACY20746.1| ribosomal protein L28 [Gordonia bronchialis DSM 43247]
          Length = 78

 Score = 47.4 bits (111), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 37/63 (58%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS  C++T  T   GN+VSH++ KTRRR+ PN+ R        ++   L +S   L++++
Sbjct: 1  MSARCQVTGATPGFGNRVSHSHRKTRRRWNPNIQRRRFYIPAEDRHITLNVSAKGLKTID 60

Query: 61 RQG 63
          R G
Sbjct: 61 RHG 63


>gi|326480944|gb|EGE04954.1| 54S ribosomal protein L24 [Trichophyton equinum CBS 127.97]
          Length = 232

 Score = 47.4 bits (111), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 46/76 (60%), Gaps = 6/76 (7%)

Query: 11  TVMSGNKVSHANNK--TRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRF 68
           T++ GNK+S   NK  TRR + PN+ +  + S  ++++ +L+++   LR++ + GGLD +
Sbjct: 73  TIIFGNKISKGRNKGKTRRIWKPNVRKEKVYSKALDEEIELKVTHGVLRTINKVGGLDEY 132

Query: 69  LSNSKKENLSARMRTL 84
           L   K     AR++ L
Sbjct: 133 LLGDK----PARIKEL 144


>gi|34556763|ref|NP_906578.1| 50S ribosomal protein L28 [Wolinella succinogenes DSM 1740]
 gi|67461486|sp|Q7MAD1|RL28_WOLSU RecName: Full=50S ribosomal protein L28
 gi|34482477|emb|CAE09478.1| 50S RIBOSOMAL PROTEIN L28 [Wolinella succinogenes]
          Length = 62

 Score = 47.4 bits (111), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 39/64 (60%), Gaps = 5/64 (7%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNL--CRITLISDIMEQKYQLRISKCALRS 58
          M+R C  T K  M GN VSHANNKT++R LPNL   R+ L         +LR++   LR+
Sbjct: 1  MARKCFFTGKGPMVGNNVSHANNKTKKRSLPNLRTVRVKLEDGTT---VKLRVAASTLRT 57

Query: 59 VERQ 62
          ++++
Sbjct: 58 MKKR 61


>gi|315586825|gb|ADU41206.1| 50S ribosomal protein L28 [Helicobacter pylori 35A]
          Length = 62

 Score = 47.4 bits (111), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 26/61 (42%), Positives = 38/61 (62%), Gaps = 1/61 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M++ C LT K  M GN VSHANNK +RR LPNL  I +  D    K +++++   LR++ 
Sbjct: 1  MAKRCALTFKGSMVGNHVSHANNKNKRRLLPNLRSIKIQLDDGTTK-RIKVAASTLRTMR 59

Query: 61 R 61
          +
Sbjct: 60 K 60


>gi|332827125|gb|EGJ99910.1| 50S ribosomal protein L28 [Dysgonomonas gadei ATCC BAA-286]
          Length = 79

 Score = 47.4 bits (111), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 36/63 (57%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS++C++T K  M GN VSH+N KT+R+F  NL +        +    L +S   LR++ 
Sbjct: 1  MSKICQITGKKAMVGNNVSHSNRKTKRKFNVNLFKKKFYWVEEDCWVSLNVSAAGLRTIN 60

Query: 61 RQG 63
          + G
Sbjct: 61 KIG 63


>gi|319779276|ref|YP_004130189.1| LSU ribosomal protein L28p [Taylorella equigenitalis MCE9]
 gi|317109300|gb|ADU92046.1| LSU ribosomal protein L28p [Taylorella equigenitalis MCE9]
          Length = 61

 Score = 47.4 bits (111), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 40/61 (65%), Gaps = 1/61 (1%)

Query: 18 VSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFLSNSKKENL 77
          +SHA+NKT+RRFLPNL       +   +  +LRIS  ALR+++++ G+D  L++ +K   
Sbjct: 1  MSHAHNKTKRRFLPNLQTHRFWVESENRWVRLRISSAALRTIDKK-GIDAVLADMRKNGQ 59

Query: 78 S 78
          S
Sbjct: 60 S 60


>gi|317010740|gb|ADU84487.1| 50S ribosomal protein L28 [Helicobacter pylori SouthAfrica7]
          Length = 62

 Score = 47.4 bits (111), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 22/33 (66%), Positives = 24/33 (72%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNL 33
          M+R C LT K  M GN VSHANNK +RR LPNL
Sbjct: 1  MARRCALTFKGPMIGNHVSHANNKNKRRLLPNL 33


>gi|89076359|ref|ZP_01162692.1| putative ribosomal protein L28 [Photobacterium sp. SKA34]
 gi|89047930|gb|EAR53521.1| putative ribosomal protein L28 [Photobacterium sp. SKA34]
          Length = 75

 Score = 47.4 bits (111), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 38/60 (63%)

Query: 4  VCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQG 63
          VC++T K  ++GN  SHA N T+RRFLPNL       +  ++  +LR+S   +R ++++G
Sbjct: 1  VCQVTGKRPVTGNNRSHARNATKRRFLPNLQTHRFWVESEKRFVKLRLSAKGMRIIDKKG 60


>gi|261839673|gb|ACX99438.1| 50S ribosomal protein L28 [Helicobacter pylori 52]
          Length = 62

 Score = 47.4 bits (111), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 26/61 (42%), Positives = 38/61 (62%), Gaps = 1/61 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M++ C LT K  M GN VSHANNK +RR LPNL  I +  D    K +++++   LR++ 
Sbjct: 1  MAKRCALTFKGPMVGNHVSHANNKNKRRLLPNLRSIKVQLDDGTTK-RIKVAASTLRTMR 59

Query: 61 R 61
          +
Sbjct: 60 K 60


>gi|326473945|gb|EGD97954.1| 50S ribosomal protein L24 [Trichophyton tonsurans CBS 112818]
          Length = 234

 Score = 47.4 bits (111), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 46/76 (60%), Gaps = 6/76 (7%)

Query: 11  TVMSGNKVSHANNK--TRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRF 68
           T++ GNK+S   NK  TRR + PN+ +  + S  ++++ +L+++   LR++ + GGLD +
Sbjct: 73  TIIFGNKISKGRNKGKTRRIWKPNVRKEKVYSKALDEEIELKVTHGVLRTINKVGGLDEY 132

Query: 69  LSNSKKENLSARMRTL 84
           L   K     AR++ L
Sbjct: 133 LLGDK----PARIKEL 144


>gi|261838262|gb|ACX98028.1| ribosomal protein L28 [Helicobacter pylori 51]
          Length = 62

 Score = 47.0 bits (110), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 26/61 (42%), Positives = 38/61 (62%), Gaps = 1/61 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M++ C LT K  M GN VSHANNK +RR LPNL  I +  D    K +++++   LR++ 
Sbjct: 1  MAKRCTLTFKGPMVGNHVSHANNKNKRRLLPNLRSIKIQLDDGTTK-RIKVAASTLRTMR 59

Query: 61 R 61
          +
Sbjct: 60 K 60


>gi|88859002|ref|ZP_01133643.1| 50S ribosomal protein L28 [Pseudoalteromonas tunicata D2]
 gi|88819228|gb|EAR29042.1| 50S ribosomal protein L28 [Pseudoalteromonas tunicata D2]
          Length = 78

 Score = 47.0 bits (110), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS+VC++T K    GN  SHA N T+RRFLPNL       +   +  +LR++   +R ++
Sbjct: 1  MSKVCQVTGKRPAVGNNRSHALNATKRRFLPNLQTHRFWVESENRFVKLRLTTKGMRIID 60

Query: 61 RQGGLDRFLS 70
          ++ G+D  L+
Sbjct: 61 KK-GIDAVLT 69


>gi|315127737|ref|YP_004069740.1| 50S ribosomal subunit protein L28 [Pseudoalteromonas sp. SM9913]
 gi|315016251|gb|ADT69589.1| 50S ribosomal subunit protein L28 [Pseudoalteromonas sp. SM9913]
          Length = 95

 Score = 47.0 bits (110), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 41/70 (58%), Gaps = 1/70 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS+VC++T K    GN  SHA N T+RRFLPNL       +  ++   LR +   +R ++
Sbjct: 18 MSKVCQVTGKRPAVGNHRSHARNATKRRFLPNLQTHRFWVESEKRFVTLRTTTKGMRIID 77

Query: 61 RQGGLDRFLS 70
          ++ G+D  L+
Sbjct: 78 KK-GIDTVLT 86


>gi|15611510|ref|NP_223161.1| 50S ribosomal protein L28 [Helicobacter pylori J99]
 gi|15645118|ref|NP_207288.1| 50S ribosomal protein L28 [Helicobacter pylori 26695]
 gi|210134694|ref|YP_002301133.1| 50S ribosomal protein L28 [Helicobacter pylori P12]
 gi|54039147|sp|P66143|RL28_HELPJ RecName: Full=50S ribosomal protein L28
 gi|54041847|sp|P66142|RL28_HELPY RecName: Full=50S ribosomal protein L28
 gi|226694945|sp|B6JL75|RL28_HELP2 RecName: Full=50S ribosomal protein L28
 gi|2313612|gb|AAD07567.1| ribosomal protein L28 (rpL28) [Helicobacter pylori 26695]
 gi|4154978|gb|AAD06021.1| 50S RIBOSOMAL PROTEIN L28 [Helicobacter pylori J99]
 gi|210132662|gb|ACJ07653.1| 50S ribosomal protein L28 [Helicobacter pylori P12]
 gi|317009530|gb|ADU80110.1| 50S ribosomal protein L28 [Helicobacter pylori India7]
 gi|317012309|gb|ADU82917.1| 50S ribosomal protein L28 [Helicobacter pylori Lithuania75]
 gi|317013910|gb|ADU81346.1| 50S ribosomal protein L28 [Helicobacter pylori Gambia94/24]
 gi|317180268|dbj|BAJ58054.1| 50S ribosomal protein L28 [Helicobacter pylori F32]
          Length = 62

 Score = 47.0 bits (110), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 26/61 (42%), Positives = 38/61 (62%), Gaps = 1/61 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M++ C LT K  M GN VSHANNK +RR LPNL  I +  D    K +++++   LR++ 
Sbjct: 1  MAKRCALTFKGPMIGNHVSHANNKNKRRLLPNLRSIKIQLDDGTTK-RIKVAASTLRTMR 59

Query: 61 R 61
          +
Sbjct: 60 K 60


>gi|212550483|ref|YP_002308800.1| 50S ribosomal protein L28 [Candidatus Azobacteroides
          pseudotrichonymphae genomovar. CFP2]
 gi|226738027|sp|B6YQB7|RL28_AZOPC RecName: Full=50S ribosomal protein L28
 gi|212548721|dbj|BAG83389.1| 50S ribosomal protein L28 [Candidatus Azobacteroides
          pseudotrichonymphae genomovar. CFP2]
          Length = 80

 Score = 47.0 bits (110), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 43/75 (57%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR+C++T+K  M GN V+H+N+KTRR+F  N           +   +L IS   LR++ 
Sbjct: 1  MSRICQITRKKSMKGNSVAHSNHKTRRKFNVNFFSKRFYWVEKDCWIKLNISANGLRTIN 60

Query: 61 RQGGLDRFLSNSKKE 75
          +  GLD  +  + K+
Sbjct: 61 KI-GLDAAIKQASKK 74


>gi|254779487|ref|YP_003057592.1| 50S ribosomal protein L28 [Helicobacter pylori B38]
 gi|308184272|ref|YP_003928405.1| 50S ribosomal protein L28 [Helicobacter pylori SJM180]
 gi|254001398|emb|CAX29389.1| 50S ribosomal subunit protein L28 [Helicobacter pylori B38]
 gi|307637167|gb|ADN79617.1| LSU ribosomal protein: L28p [Helicobacter pylori 908]
 gi|308060192|gb|ADO02088.1| 50S ribosomal protein L28 [Helicobacter pylori SJM180]
 gi|325995757|gb|ADZ51162.1| 50S ribosomal protein L28 [Helicobacter pylori 2018]
 gi|325997353|gb|ADZ49561.1| 50S ribosomal protein L28 [Helicobacter pylori 2017]
          Length = 62

 Score = 47.0 bits (110), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/61 (42%), Positives = 38/61 (62%), Gaps = 1/61 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M++ C LT K  M GN VSHANNK +RR LPNL  I +  D    K +++++   LR++ 
Sbjct: 1  MAKRCTLTFKGPMIGNHVSHANNKNKRRLLPNLRSIKIQLDDGTTK-RIKVAASTLRTMR 59

Query: 61 R 61
          +
Sbjct: 60 K 60


>gi|217032925|ref|ZP_03438401.1| hypothetical protein HPB128_10g17 [Helicobacter pylori B128]
 gi|298736171|ref|YP_003728697.1| 50S ribosomal protein L28 [Helicobacter pylori B8]
 gi|216945374|gb|EEC24044.1| hypothetical protein HPB128_10g17 [Helicobacter pylori B128]
 gi|298355361|emb|CBI66233.1| 50S ribosomal protein L28 [Helicobacter pylori B8]
          Length = 62

 Score = 47.0 bits (110), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/61 (42%), Positives = 38/61 (62%), Gaps = 1/61 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M++ C LT K  M GN VSHANNK +RR LPNL  I +  D    K +++++   LR++ 
Sbjct: 1  MAKRCALTFKGSMIGNHVSHANNKNKRRLLPNLRSIKIQLDDGTTK-RIKVAASTLRTMR 59

Query: 61 R 61
          +
Sbjct: 60 K 60


>gi|237750768|ref|ZP_04581248.1| ribosomal protein L28 [Helicobacter bilis ATCC 43879]
 gi|229373858|gb|EEO24249.1| ribosomal protein L28 [Helicobacter bilis ATCC 43879]
          Length = 63

 Score = 47.0 bits (110), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/33 (63%), Positives = 26/33 (78%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNL 33
          M+R C++T K VM G  VSHANNKT++R LPNL
Sbjct: 1  MARRCDITGKGVMVGCNVSHANNKTKKRSLPNL 33


>gi|109947365|ref|YP_664593.1| 50S ribosomal protein L28 [Helicobacter acinonychis str. Sheeba]
 gi|123066239|sp|Q17XN2|RL28_HELAH RecName: Full=50S ribosomal protein L28
 gi|109714586|emb|CAJ99594.1| 50S ribosomal protein L28 [Helicobacter acinonychis str. Sheeba]
          Length = 62

 Score = 47.0 bits (110), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/33 (66%), Positives = 24/33 (72%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNL 33
          M+R C LT K  M GN VSHANNK +RR LPNL
Sbjct: 1  MARRCTLTFKGSMIGNHVSHANNKNKRRLLPNL 33


>gi|228471213|ref|ZP_04056026.1| ribosomal protein L28 [Porphyromonas uenonis 60-3]
 gi|313887404|ref|ZP_07821094.1| ribosomal protein L28 [Porphyromonas asaccharolytica PR426713P-I]
 gi|332300840|ref|YP_004442761.1| ribosomal protein L28 [Porphyromonas asaccharolytica DSM 20707]
 gi|228307028|gb|EEK16110.1| ribosomal protein L28 [Porphyromonas uenonis 60-3]
 gi|312923172|gb|EFR33991.1| ribosomal protein L28 [Porphyromonas asaccharolytica PR426713P-I]
 gi|332177903|gb|AEE13593.1| ribosomal protein L28 [Porphyromonas asaccharolytica DSM 20707]
          Length = 82

 Score = 47.0 bits (110), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 35/63 (55%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS++C++T K  M GN VSH+  +T+R F  NL R        ++   L++S   LR + 
Sbjct: 1  MSKICQITGKKAMVGNNVSHSKRRTKRTFDVNLFRKKFYWPEEDRWISLKVSAAGLRLIN 60

Query: 61 RQG 63
          R G
Sbjct: 61 RVG 63


>gi|219118234|ref|XP_002179896.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gi|217408949|gb|EEC48882.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
          Length = 89

 Score = 47.0 bits (110), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 40/67 (59%), Gaps = 1/67 (1%)

Query: 10 KTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRF- 68
          K V +GN VS +   T+R F PN+    + S+I+++  +  ++   LRS+++ GGLD + 
Sbjct: 23 KDVRTGNNVSFSMRATKRTFKPNVMIKRVYSEILDEMVKFHLTTSTLRSIDKAGGLDNYL 82

Query: 69 LSNSKKE 75
          L N  KE
Sbjct: 83 LKNEYKE 89


>gi|110005235|emb|CAK99561.1| 50s ribosomal protein l28 [Spiroplasma citri]
          Length = 65

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 42/63 (66%), Gaps = 2/63 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+R CE+T K+ +SGNK SHA N T R++  NL ++ ++ D   +   LR++   L++++
Sbjct: 1  MARKCEITGKSALSGNKRSHALNATHRKWNVNLQKVRIVVD--GEVKTLRVATRTLKTLK 58

Query: 61 RQG 63
          R+G
Sbjct: 59 RKG 61


>gi|325130940|gb|EGC53668.1| ribosomal protein L28 [Neisseria meningitidis OX99.30304]
          Length = 32

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/27 (77%), Positives = 23/27 (85%)

Query: 7  LTKKTVMSGNKVSHANNKTRRRFLPNL 33
          +T K  MSGN VSHANNKT+RRFLPNL
Sbjct: 1  MTGKRPMSGNNVSHANNKTKRRFLPNL 27


>gi|260942223|ref|XP_002615410.1| hypothetical protein CLUG_04292 [Clavispora lusitaniae ATCC 42720]
 gi|238850700|gb|EEQ40164.1| hypothetical protein CLUG_04292 [Clavispora lusitaniae ATCC 42720]
          Length = 263

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 43/80 (53%), Gaps = 11/80 (13%)

Query: 19  SHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFLSNSKKENLS 78
           S + NK  R  LPN+ R  L S+ + ++   R+S   LR+V ++GGLD +L   K     
Sbjct: 108 SESGNKNNRVHLPNIVRAKLWSETLNKRISARVSTTLLRTVTKEGGLDNYLLKDK----P 163

Query: 79  ARMRT-------LRSQILKK 91
           AR++T       L+  I+KK
Sbjct: 164 ARVKTMGLKAWRLKYDIMKK 183


>gi|258405533|ref|YP_003198275.1| 50S ribosomal protein L28 [Desulfohalobium retbaense DSM 5692]
 gi|257797760|gb|ACV68697.1| ribosomal protein L28 [Desulfohalobium retbaense DSM 5692]
          Length = 65

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 25/36 (69%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRI 36
          MS+ C    K    GN VSHANNKT+RRF+PNL R+
Sbjct: 1  MSKECYFCGKKPQVGNNVSHANNKTKRRFMPNLQRV 36


>gi|32266788|ref|NP_860820.1| 50S ribosomal protein L28 [Helicobacter hepaticus ATCC 51449]
 gi|67461504|sp|Q7VGN1|RL28_HELHP RecName: Full=50S ribosomal protein L28
 gi|32262840|gb|AAP77886.1| ribosomal protein L28 [Helicobacter hepaticus ATCC 51449]
          Length = 62

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/62 (41%), Positives = 39/62 (62%), Gaps = 3/62 (4%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITL-ISDIMEQKYQLRISKCALRSV 59
          M+R C  T K  M GN VSHANNKT++R LPNL  I L + D      +++++   LR++
Sbjct: 1  MARKCFFTGKGPMVGNNVSHANNKTKKRSLPNLRSIRLKLED--GTSVRVKVAASTLRTI 58

Query: 60 ER 61
          ++
Sbjct: 59 KK 60


>gi|225012676|ref|ZP_03703111.1| ribosomal protein L28 [Flavobacteria bacterium MS024-2A]
 gi|225003209|gb|EEG41184.1| ribosomal protein L28 [Flavobacteria bacterium MS024-2A]
          Length = 79

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 37/63 (58%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS++CEL+ K VM GN VS A N+T+RRF  N+          ++   L IS   L+++ 
Sbjct: 1  MSKICELSGKRVMFGNNVSKALNRTKRRFDANIINKRFYIPEEDKWVTLTISTATLKTIN 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|156369464|ref|XP_001627996.1| predicted protein [Nematostella vectensis]
 gi|156389150|ref|XP_001634855.1| predicted protein [Nematostella vectensis]
 gi|156214961|gb|EDO35933.1| predicted protein [Nematostella vectensis]
 gi|156221942|gb|EDO42792.1| predicted protein [Nematostella vectensis]
          Length = 113

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/84 (26%), Positives = 47/84 (55%), Gaps = 4/84 (4%)

Query: 10  KTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFL 69
           K +M G+  + +  KT+R + PN+ R    S+++E+      +  A+R +++ GG D ++
Sbjct: 26  KGIMFGHVETFSGKKTKRAWKPNVHRKKYYSEVLEKNLSYNFTTHAMRCIDKAGGFDNYI 85

Query: 70  SNSKKENLSAR----MRTLRSQIL 89
            N+K   L ++    ++ L S++L
Sbjct: 86  LNTKDSKLQSKAAIELKNLMSKVL 109


>gi|224436839|ref|ZP_03657828.1| 50S ribosomal protein L28 [Helicobacter cinaedi CCUG 18818]
 gi|313143318|ref|ZP_07805511.1| 50S ribosomal protein L28 [Helicobacter cinaedi CCUG 18818]
 gi|313128349|gb|EFR45966.1| 50S ribosomal protein L28 [Helicobacter cinaedi CCUG 18818]
          Length = 62

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 28/64 (43%), Positives = 38/64 (59%), Gaps = 5/64 (7%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCA--LRS 58
          M+R C  T K  M GN VSHANNKT++R LPNL  I L    +E    +R+   A  LR+
Sbjct: 1  MARKCFFTGKGPMVGNNVSHANNKTKKRSLPNLRSIRL---KLEDGSSIRVKVAASTLRT 57

Query: 59 VERQ 62
          +++ 
Sbjct: 58 LKKH 61


>gi|307720496|ref|YP_003891636.1| 50S ribosomal protein L28P [Sulfurimonas autotrophica DSM 16294]
 gi|306978589|gb|ADN08624.1| LSU ribosomal protein L28P [Sulfurimonas autotrophica DSM 16294]
          Length = 62

 Score = 46.2 bits (108), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 28/64 (43%), Positives = 41/64 (64%), Gaps = 5/64 (7%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNL--CRITLISDIMEQKYQLRISKCALRS 58
          M+R C ++ K  MSGN VSHA N+T+RRFL NL   RITL     +   +++IS   LR+
Sbjct: 1  MARRCAISGKGPMSGNNVSHAKNRTKRRFLLNLRTVRITLEDGTTK---KIKISARELRT 57

Query: 59 VERQ 62
          +++ 
Sbjct: 58 LKKN 61


>gi|119500374|ref|XP_001266944.1| 50S ribosomal protein L24 [Neosartorya fischeri NRRL 181]
 gi|119415109|gb|EAW25047.1| 50S ribosomal protein L24 [Neosartorya fischeri NRRL 181]
          Length = 212

 Score = 46.2 bits (108), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 38/60 (63%), Gaps = 2/60 (3%)

Query: 12  VMSGNKVSHANN--KTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFL 69
           +  GNK+S   N  KTRR + PN+ R  L S+ + +   +++++ ALR++ + GGLD +L
Sbjct: 72  IQFGNKISKGRNEGKTRRFWKPNVRRKKLWSEALGEYLYIKVTRKALRTIWKSGGLDNYL 131


>gi|78187460|ref|YP_375503.1| 50S ribosomal protein L28 [Chlorobium luteolum DSM 273]
 gi|123582745|sp|Q3B2H1|RL28_PELLD RecName: Full=50S ribosomal protein L28
 gi|78167362|gb|ABB24460.1| LSU ribosomal protein L28P [Chlorobium luteolum DSM 273]
          Length = 72

 Score = 46.2 bits (108), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/63 (39%), Positives = 37/63 (58%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS+VC LT K    GN VSHANN  R RF PNL    +  D  ++  ++++S  A++ + 
Sbjct: 1  MSKVCVLTGKRPKYGNTVSHANNHRRTRFEPNLHTKRIWIDEEKRWAKVKLSAKAMKIIA 60

Query: 61 RQG 63
          + G
Sbjct: 61 KTG 63


>gi|332703485|ref|ZP_08423573.1| 50S ribosomal protein L28 [Desulfovibrio africanus str. Walvis
          Bay]
 gi|332553634|gb|EGJ50678.1| 50S ribosomal protein L28 [Desulfovibrio africanus str. Walvis
          Bay]
          Length = 67

 Score = 46.2 bits (108), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/72 (37%), Positives = 42/72 (58%), Gaps = 5/72 (6%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CE+ +K    GN VSHANNKT+R F PNL ++ ++    E K+    ++C      
Sbjct: 1  MSRKCEICEKHRSVGNNVSHANNKTKRVFQPNLQKVRVLLPSGEVKHMKVCTRCI----- 55

Query: 61 RQGGLDRFLSNS 72
          R G + + ++N+
Sbjct: 56 RSGKVVKPVANA 67


>gi|115391337|ref|XP_001213173.1| conserved hypothetical protein [Aspergillus terreus NIH2624]
 gi|114194097|gb|EAU35797.1| conserved hypothetical protein [Aspergillus terreus NIH2624]
          Length = 212

 Score = 46.2 bits (108), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 38/60 (63%), Gaps = 2/60 (3%)

Query: 12  VMSGNKVSHANN--KTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFL 69
           +  GNK+S   N  KTRR + PN+ R  L S+ + +   +++++ ALR++ + GGLD +L
Sbjct: 72  IQFGNKISKGRNEGKTRRMWKPNVRRKKLYSEALGEDLYIKVTRKALRTIRKAGGLDNYL 131


>gi|261416330|ref|YP_003250013.1| ribosomal protein L28 [Fibrobacter succinogenes subsp.
          succinogenes S85]
 gi|261372786|gb|ACX75531.1| ribosomal protein L28 [Fibrobacter succinogenes subsp.
          succinogenes S85]
 gi|302326400|gb|ADL25601.1| ribosomal protein L28 [Fibrobacter succinogenes subsp.
          succinogenes S85]
          Length = 73

 Score = 46.2 bits (108), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 36/63 (57%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR+CE+T K  + GN VSH+N K   + LPNL +        ++   LR+S   LR++ 
Sbjct: 1  MSRICEVTGKAGLVGNMVSHSNRKKLMKQLPNLQKKRFYIPEEDRWVTLRVSAAGLRTIN 60

Query: 61 RQG 63
          + G
Sbjct: 61 KLG 63


>gi|108562892|ref|YP_627208.1| 50S ribosomal protein L28 [Helicobacter pylori HPAG1]
 gi|122386623|sp|Q1CU38|RL28_HELPH RecName: Full=50S ribosomal protein L28
 gi|107836665|gb|ABF84534.1| ribosomal protein L28 [Helicobacter pylori HPAG1]
          Length = 62

 Score = 46.2 bits (108), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/61 (42%), Positives = 38/61 (62%), Gaps = 1/61 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M++ C LT K  M GN VSHANNK +RR LPNL  I +  D    K +++++   LR++ 
Sbjct: 1  MAKRCALTFKGPMVGNHVSHANNKNKRRSLPNLRSIKIQLDDGTTK-RIKVAASTLRTMR 59

Query: 61 R 61
          +
Sbjct: 60 K 60


>gi|317038264|ref|XP_001401958.2| 50S ribosomal protein L24 [Aspergillus niger CBS 513.88]
          Length = 212

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 38/60 (63%), Gaps = 2/60 (3%)

Query: 12  VMSGNKVSHANN--KTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFL 69
           +  GNK+S   N  KTRR + PN+ R  L S+ + +   +++++ ALR++ + GGLD +L
Sbjct: 72  IQFGNKISQGRNEGKTRRFWKPNVRRKKLYSEALGEDLFIKVTRKALRTIRKAGGLDNYL 131


>gi|189346166|ref|YP_001942695.1| 50S ribosomal protein L28 [Chlorobium limicola DSM 245]
 gi|226738048|sp|B3EH36|RL28_CHLL2 RecName: Full=50S ribosomal protein L28
 gi|189340313|gb|ACD89716.1| ribosomal protein L28 [Chlorobium limicola DSM 245]
          Length = 72

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/33 (66%), Positives = 23/33 (69%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNL 33
          MS+VC LT K    GN VSHANN TR RF PNL
Sbjct: 1  MSKVCVLTGKRPKYGNNVSHANNHTRTRFEPNL 33


>gi|303283017|ref|XP_003060800.1| predicted protein [Micromonas pusilla CCMP1545]
 gi|226458271|gb|EEH55569.1| predicted protein [Micromonas pusilla CCMP1545]
          Length = 208

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 45/77 (58%), Gaps = 1/77 (1%)

Query: 22  NNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFLSNSKKENL-SAR 80
           N +TRRR+ PN  R  L S+ +++  ++ ++  ALR +++ GGLD +L N+  + L S +
Sbjct: 99  NPRTRRRWKPNAQRKRLYSEALDELVRVNVTTYALRWIDKAGGLDAYLLNTTPQKLMSYK 158

Query: 81  MRTLRSQILKKMSEKSS 97
              LR ++L     K S
Sbjct: 159 ALELRKRVLDAKGIKES 175


>gi|242050462|ref|XP_002462975.1| hypothetical protein SORBIDRAFT_02g035620 [Sorghum bicolor]
 gi|241926352|gb|EER99496.1| hypothetical protein SORBIDRAFT_02g035620 [Sorghum bicolor]
          Length = 210

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 44/79 (55%), Gaps = 1/79 (1%)

Query: 15  GNKVSH-ANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFLSNSK 73
           GNKVS    NK+RR + PN+    L S I ++  +++++  ALR +++ GG+D +L  + 
Sbjct: 57  GNKVSEDGGNKSRRSWKPNVQEKRLFSYIHDRHIRVKVTTHALRCIDKAGGIDEYLLKTP 116

Query: 74  KENLSARMRTLRSQILKKM 92
              +   M  +    ++KM
Sbjct: 117 YNKMDTEMGIVWKAKIEKM 135


>gi|288574877|ref|ZP_06393234.1| ribosomal protein L28 [Dethiosulfovibrio peptidovorans DSM 11002]
 gi|288570618|gb|EFC92175.1| ribosomal protein L28 [Dethiosulfovibrio peptidovorans DSM 11002]
          Length = 64

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/58 (44%), Positives = 37/58 (63%), Gaps = 1/58 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS 58
          MS+VC+   K  ++GN VSH++ KTRRR+LPNL  + +     E + +LRI    LRS
Sbjct: 1  MSKVCDCCGKGPVTGNSVSHSHRKTRRRWLPNLHSVRVDLGAGETR-KLRICSRCLRS 57


>gi|219681464|ref|YP_002467849.1| 50S ribosomal protein L28 [Buchnera aphidicola str. 5A
          (Acyrthosiphon pisum)]
 gi|219682020|ref|YP_002468404.1| 50S ribosomal protein L28 [Buchnera aphidicola str. Tuc7
          (Acyrthosiphon pisum)]
 gi|257471139|ref|ZP_05635138.1| 50S ribosomal protein L28 [Buchnera aphidicola str. LSR1
          (Acyrthosiphon pisum)]
 gi|254801346|sp|B8D8P0|RL28_BUCA5 RecName: Full=50S ribosomal protein L28
 gi|254801347|sp|B8D6Z4|RL28_BUCAT RecName: Full=50S ribosomal protein L28
 gi|219621753|gb|ACL29909.1| 50S ribosomal protein L28 [Buchnera aphidicola str. Tuc7
          (Acyrthosiphon pisum)]
 gi|219624307|gb|ACL30462.1| 50S ribosomal protein L28 [Buchnera aphidicola str. 5A
          (Acyrthosiphon pisum)]
 gi|311085828|gb|ADP65910.1| 50S ribosomal protein L28 [Buchnera aphidicola str. LL01
          (Acyrthosiphon pisum)]
 gi|311086401|gb|ADP66482.1| 50S ribosomal protein L28 [Buchnera aphidicola str. TLW03
          (Acyrthosiphon pisum)]
 gi|311086980|gb|ADP67060.1| 50S ribosomal protein L28 [Buchnera aphidicola str. JF99
          (Acyrthosiphon pisum)]
 gi|311087556|gb|ADP67635.1| 50S ribosomal protein L28 [Buchnera aphidicola str. JF98
          (Acyrthosiphon pisum)]
          Length = 75

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 43/65 (66%), Gaps = 4/65 (6%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNL-CRITLISDIMEQKY-QLRISKCALRS 58
          MSR+C++T K  M GN  SHA N T+R+FL N+      I+D  E+++ +LR+S   +R 
Sbjct: 1  MSRICQITGKKRMIGNNRSHALNATKRKFLINIQYHRFWIAD--EKRFIKLRVSTNGMRY 58

Query: 59 VERQG 63
          ++++G
Sbjct: 59 IDKKG 63


>gi|226507934|ref|NP_001149701.1| 60S ribosomal protein L24 [Zea mays]
 gi|195629596|gb|ACG36439.1| 60S ribosomal protein L24 [Zea mays]
          Length = 210

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 44/79 (55%), Gaps = 1/79 (1%)

Query: 15  GNKVSH-ANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFLSNSK 73
           GNKVS    NK+RR + PN+    L S I ++  +++++  ALR +++ GG+D +L  + 
Sbjct: 57  GNKVSEDGGNKSRRSWKPNVQEKRLFSYIHDRHIRVKVTTHALRCIDKAGGIDEYLLKTP 116

Query: 74  KENLSARMRTLRSQILKKM 92
              +   M  +    ++KM
Sbjct: 117 YNKMDTEMGIVWKAKIEKM 135


>gi|21674429|ref|NP_662494.1| 50S ribosomal protein L28 [Chlorobium tepidum TLS]
 gi|25009090|sp|Q93SU8|RL28_CHLTE RecName: Full=50S ribosomal protein L28
 gi|13899154|gb|AAG12418.1| RL28 [Chlorobaculum tepidum]
 gi|21647613|gb|AAM72836.1| ribosomal protein L28 [Chlorobium tepidum TLS]
          Length = 72

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/63 (39%), Positives = 37/63 (58%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS+VC LT K    GN VSHANN TR RF PNL    +  +   +  ++R++  A++ + 
Sbjct: 1  MSKVCVLTGKRPKYGNNVSHANNHTRTRFEPNLHTKRIWIEEERRWVKVRLTAKAMKIMS 60

Query: 61 RQG 63
          + G
Sbjct: 61 KTG 63


>gi|77361557|ref|YP_341132.1| 50S ribosomal subunit protein L28 [Pseudoalteromonas haloplanktis
          TAC125]
 gi|76876468|emb|CAI87690.1| 50S ribosomal subunit protein L28 [Pseudoalteromonas haloplanktis
          TAC125]
          Length = 95

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/70 (35%), Positives = 41/70 (58%), Gaps = 1/70 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M++VC++T K    GN  SHA N T+RRFLPNL       +  ++   LR +   +R ++
Sbjct: 18 MAKVCQVTGKRPAVGNHRSHARNATKRRFLPNLQTHRFWVESEKRFVTLRTTTKGMRIID 77

Query: 61 RQGGLDRFLS 70
          ++ G+D  L+
Sbjct: 78 KK-GIDTVLT 86


>gi|110597044|ref|ZP_01385333.1| ribosomal protein L28 [Chlorobium ferrooxidans DSM 13031]
 gi|110341235|gb|EAT59700.1| ribosomal protein L28 [Chlorobium ferrooxidans DSM 13031]
          Length = 71

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 37/63 (58%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M +VC LT K  + GN VSHANN  R RF PNL    +  +  ++  ++++S  A+R + 
Sbjct: 1  MPKVCLLTGKKPIYGNTVSHANNHVRTRFEPNLHTKKVWIEEEKRFVKVKLSAKAMRIIA 60

Query: 61 RQG 63
          + G
Sbjct: 61 KTG 63


>gi|224142087|ref|XP_002324390.1| predicted protein [Populus trichocarpa]
 gi|222865824|gb|EEF02955.1| predicted protein [Populus trichocarpa]
          Length = 177

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/90 (24%), Positives = 49/90 (54%), Gaps = 1/90 (1%)

Query: 7   LTKKTVMSGNKVSH-ANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGL 65
              + +  GN++S    NK+RR + PN+    L S I+++  +++++  A+R +++ GG+
Sbjct: 49  FAGRHIQFGNQISEDGGNKSRRSWKPNVQDKRLFSYILDRHVRVKVTTHAIRCIDKAGGI 108

Query: 66  DRFLSNSKKENLSARMRTLRSQILKKMSEK 95
           D +L  +    +   M  L    ++K+ E+
Sbjct: 109 DEYLLKTPYHKMDTEMGILWKAKIEKLYEE 138


>gi|121586296|ref|ZP_01676085.1| ribosomal protein L28 [Vibrio cholerae 2740-80]
 gi|121549416|gb|EAX59444.1| ribosomal protein L28 [Vibrio cholerae 2740-80]
          Length = 50

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/33 (63%), Positives = 24/33 (72%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNL 33
          MSRVC++T K    GN  SHA N T+RRFLPNL
Sbjct: 1  MSRVCQVTGKRPAVGNNRSHAKNATKRRFLPNL 33


>gi|156048865|ref|XP_001590399.1| hypothetical protein SS1G_08139 [Sclerotinia sclerotiorum 1980]
 gi|154692538|gb|EDN92276.1| hypothetical protein SS1G_08139 [Sclerotinia sclerotiorum 1980
           UF-70]
          Length = 231

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/64 (40%), Positives = 38/64 (59%), Gaps = 1/64 (1%)

Query: 15  GNKVSHANN-KTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFLSNSK 73
           GN VS  N  KTRR + PN+ R  L S  + +  +LRI+   LR++++ GGLD +L   K
Sbjct: 66  GNIVSKKNEIKTRRHWRPNVQRKRLYSASLGKHIKLRITTKVLRTIDKAGGLDEYLLGEK 125

Query: 74  KENL 77
            + L
Sbjct: 126 TQRL 129


>gi|239908626|ref|YP_002955368.1| 50S ribosomal protein L28 [Desulfovibrio magneticus RS-1]
 gi|259646734|sp|C4XNY1|RL28_DESMR RecName: Full=50S ribosomal protein L28
 gi|239798493|dbj|BAH77482.1| 50S ribosomal protein L28 [Desulfovibrio magneticus RS-1]
          Length = 68

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/33 (57%), Positives = 25/33 (75%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNL 33
          M+++C+   K   SGN VSHANNK++RRF PNL
Sbjct: 1  MAKICDHCGKKPQSGNNVSHANNKSKRRFEPNL 33


>gi|330794352|ref|XP_003285243.1| hypothetical protein DICPUDRAFT_22474 [Dictyostelium purpureum]
 gi|325084785|gb|EGC38205.1| hypothetical protein DICPUDRAFT_22474 [Dictyostelium purpureum]
          Length = 127

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 43/72 (59%)

Query: 10 KTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFL 69
          K ++ GN +S +N KTRR + PN+   T  S+++    ++R++   +R +++ G  D ++
Sbjct: 27 KDILFGNILSFSNKKTRRDWKPNVHNKTYHSNLLGTDIRVRVTSYVIRCIDKAGSFDNYI 86

Query: 70 SNSKKENLSARM 81
            +K ++L + +
Sbjct: 87 VQTKDKDLQSEL 98


>gi|291276684|ref|YP_003516456.1| 50S ribosomal protein L28 [Helicobacter mustelae 12198]
 gi|290963878|emb|CBG39714.1| 50S ribosomal protein L28 [Helicobacter mustelae 12198]
          Length = 62

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/33 (63%), Positives = 25/33 (75%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNL 33
          M++ C LT K  M GN VSHANNKT++R LPNL
Sbjct: 1  MAKKCFLTGKGPMVGNHVSHANNKTKKRSLPNL 33


>gi|222055240|ref|YP_002537602.1| ribosomal protein L28 [Geobacter sp. FRC-32]
 gi|254801362|sp|B9M905|RL28_GEOSF RecName: Full=50S ribosomal protein L28
 gi|221564529|gb|ACM20501.1| ribosomal protein L28 [Geobacter sp. FRC-32]
          Length = 63

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 27/41 (65%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISD 41
          MS+VCE+  K    GN VSHANNKT R + PNL +I  + +
Sbjct: 1  MSKVCEICGKGPSFGNNVSHANNKTSRTWYPNLQKIKAVKN 41


>gi|126133881|ref|XP_001383465.1| hypothetical protein PICST_43496 [Scheffersomyces stipitis CBS
           6054]
 gi|126095614|gb|ABN65436.1| predicted protein [Scheffersomyces stipitis CBS 6054]
          Length = 266

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 46/76 (60%), Gaps = 3/76 (3%)

Query: 19  SHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFLSN---SKKE 75
           S + NK  R  LPN+ +  L S+ +++   +++S   L+++ ++GGLD +L+    S+++
Sbjct: 106 SESGNKGLRVHLPNIQKTKLWSETLQKSIPIKVSTKVLKTITKEGGLDNYLTKNKPSREK 165

Query: 76  NLSARMRTLRSQILKK 91
            L  +   LR Q+LK+
Sbjct: 166 TLGLKGWQLRYQVLKQ 181


>gi|332296145|ref|YP_004438068.1| 50S ribosomal protein L28 [Thermodesulfobium narugense DSM 14796]
 gi|332179248|gb|AEE14937.1| 50S ribosomal protein L28 [Thermodesulfobium narugense DSM 14796]
          Length = 62

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 26/36 (72%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRI 36
          MS+ C +  K   +GN VSH+N KTRRRFLPNL +I
Sbjct: 1  MSKFCAICGKGPSTGNNVSHSNRKTRRRFLPNLQKI 36


>gi|317154495|ref|YP_004122543.1| 50S ribosomal protein L28 [Desulfovibrio aespoeensis Aspo-2]
 gi|316944746|gb|ADU63797.1| ribosomal protein L28 [Desulfovibrio aespoeensis Aspo-2]
          Length = 70

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/33 (57%), Positives = 26/33 (78%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNL 33
          MS+VC++  K   SGN VSH++ KT+RRF+PNL
Sbjct: 1  MSQVCDICGKGPQSGNNVSHSHIKTKRRFMPNL 33


>gi|115472627|ref|NP_001059912.1| Os07g0544900 [Oryza sativa Japonica Group]
 gi|34393259|dbj|BAC83129.1| unknown protein [Oryza sativa Japonica Group]
 gi|113611448|dbj|BAF21826.1| Os07g0544900 [Oryza sativa Japonica Group]
 gi|125558698|gb|EAZ04234.1| hypothetical protein OsI_26378 [Oryza sativa Indica Group]
 gi|125600612|gb|EAZ40188.1| hypothetical protein OsJ_24633 [Oryza sativa Japonica Group]
          Length = 204

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 44/82 (53%), Gaps = 1/82 (1%)

Query: 12  VMSGNKVSH-ANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFLS 70
           +  GNKVS    NK+RR + PN+    L S I ++  +++++  ALR +++ GG+D +L 
Sbjct: 54  IQFGNKVSEDGGNKSRRTWKPNVQEKRLFSYIHDRHIRVKVTTHALRCIDKAGGIDEYLL 113

Query: 71  NSKKENLSARMRTLRSQILKKM 92
            +    +   M       ++KM
Sbjct: 114 KTPYNKMDTEMGVAWKAKIEKM 135


>gi|169771529|ref|XP_001820234.1| 50S ribosomal protein L24 [Aspergillus oryzae RIB40]
 gi|238485896|ref|XP_002374186.1| 50S ribosomal protein L24 [Aspergillus flavus NRRL3357]
 gi|83768093|dbj|BAE58232.1| unnamed protein product [Aspergillus oryzae]
 gi|220699065|gb|EED55404.1| 50S ribosomal protein L24 [Aspergillus flavus NRRL3357]
          Length = 212

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 39/60 (65%), Gaps = 2/60 (3%)

Query: 12  VMSGNKVSHANN--KTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFL 69
           +  GNK+S   N  KTRR + PN+ R  + S+ +++   +++++ ALR++ + GGLD +L
Sbjct: 72  IQFGNKISKGRNEGKTRRFWKPNVRRKKIYSEALDEWLFIKVTRKALRTIRKSGGLDNYL 131


>gi|301065048|ref|ZP_07205393.1| ribosomal protein L28 [delta proteobacterium NaphS2]
 gi|300440897|gb|EFK05317.1| ribosomal protein L28 [delta proteobacterium NaphS2]
          Length = 97

 Score = 45.4 bits (106), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 29/41 (70%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISD 41
          MS+VC++  K  ++G  VSHA+NKT++R+ PNL  +  + D
Sbjct: 28 MSKVCDICGKGPLTGYNVSHAHNKTKKRWYPNLQSVRCVRD 68


>gi|152993734|ref|YP_001359455.1| 50S ribosomal protein L28 [Sulfurovum sp. NBC37-1]
 gi|166228165|sp|A6QC89|RL28_SULNB RecName: Full=50S ribosomal protein L28
 gi|151425595|dbj|BAF73098.1| 50S ribosomal protein L28 [Sulfurovum sp. NBC37-1]
          Length = 69

 Score = 45.4 bits (106), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/33 (63%), Positives = 25/33 (75%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNL 33
          MSR C ++ K  + GN VSHANNKT+RR LPNL
Sbjct: 1  MSRRCSVSGKGPLVGNNVSHANNKTKRRQLPNL 33


>gi|296106029|ref|YP_003617729.1| large subunit ribosomal protein L28 [Legionella pneumophila
          2300/99 Alcoy]
 gi|295647930|gb|ADG23777.1| large subunit ribosomal protein L28 [Legionella pneumophila
          2300/99 Alcoy]
 gi|307609285|emb|CBW98760.1| 50S ribosomal protein L28 [Legionella pneumophila 130b]
          Length = 66

 Score = 45.4 bits (106), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 32/51 (62%)

Query: 13 MSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQG 63
          M G+KVSHANNKT+RRFLPN+       +   +   LR+S   +R +++ G
Sbjct: 1  MVGHKVSHANNKTKRRFLPNIQNHKFWVEEENRFVTLRLSTKGMRIIDKLG 51


>gi|154295457|ref|XP_001548164.1| hypothetical protein BC1G_13207 [Botryotinia fuckeliana B05.10]
 gi|150844075|gb|EDN19268.1| hypothetical protein BC1G_13207 [Botryotinia fuckeliana B05.10]
          Length = 233

 Score = 45.4 bits (106), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 39/64 (60%), Gaps = 1/64 (1%)

Query: 15  GNKVSHANN-KTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFLSNSK 73
           GN VS  N  KTRR + PN+ R  L S  + ++ +LR++   LR++++ GGLD +L   K
Sbjct: 68  GNIVSEKNEIKTRRHWRPNVQRKRLYSPSLGRQIKLRVTTKVLRTIDKAGGLDEYLLGEK 127

Query: 74  KENL 77
            + +
Sbjct: 128 TQRI 131


>gi|77918893|ref|YP_356708.1| 50S ribosomal protein L28 [Pelobacter carbinolicus DSM 2380]
 gi|123574379|sp|Q3A519|RL28_PELCD RecName: Full=50S ribosomal protein L28
 gi|77544976|gb|ABA88538.1| LSU ribosomal protein L28P [Pelobacter carbinolicus DSM 2380]
          Length = 63

 Score = 45.4 bits (106), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/33 (57%), Positives = 25/33 (75%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNL 33
          MSRVC++  K   +GN VSHA+NKTR+ + PNL
Sbjct: 1  MSRVCDICGKKPTTGNNVSHAHNKTRKVWYPNL 33


>gi|145220200|ref|YP_001130909.1| 50S ribosomal protein L28 [Prosthecochloris vibrioformis DSM 265]
 gi|189029450|sp|A4SFZ8|RL28_PROVI RecName: Full=50S ribosomal protein L28
 gi|145206364|gb|ABP37407.1| LSU ribosomal protein L28P [Chlorobium phaeovibrioides DSM 265]
          Length = 72

 Score = 45.4 bits (106), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/63 (39%), Positives = 37/63 (58%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS+VC LT K    GN VSHANN  R RF PNL    +  +  ++  ++++S  A+R + 
Sbjct: 1  MSKVCVLTGKRPKYGNTVSHANNHRRTRFEPNLHTKRIWIEEEKRWAKVKLSAKAMRIIA 60

Query: 61 RQG 63
          + G
Sbjct: 61 KTG 63


>gi|302689635|ref|XP_003034497.1| hypothetical protein SCHCODRAFT_37408 [Schizophyllum commune
          H4-8]
 gi|300108192|gb|EFI99594.1| hypothetical protein SCHCODRAFT_37408 [Schizophyllum commune
          H4-8]
          Length = 96

 Score = 45.4 bits (106), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 39/60 (65%), Gaps = 1/60 (1%)

Query: 10 KTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFL 69
          KT   GN V H+  KTRR +LPN+   T+ S+ +    +L+I+  A+R+V++ GGLD ++
Sbjct: 22 KTKRYGNNVPHSMQKTRRTWLPNIRSKTMHSESLGL-MKLKITTTAMRAVKKMGGLDDYV 80


>gi|304414060|ref|ZP_07395428.1| 50S ribosomal subunit protein L28 [Candidatus Regiella
          insecticola LSR1]
 gi|304283274|gb|EFL91670.1| 50S ribosomal subunit protein L28 [Candidatus Regiella
          insecticola LSR1]
          Length = 83

 Score = 45.4 bits (106), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/63 (39%), Positives = 36/63 (57%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR+C ++ K  M GNK SHA N T+R F  NL           +  +LRIS  A+R+++
Sbjct: 6  MSRICPVSGKRAMRGNKRSHAMNATKRSFNVNLQSHRFWDTEKGRFVKLRISTKAMRTID 65

Query: 61 RQG 63
          + G
Sbjct: 66 KHG 68


>gi|224418948|ref|ZP_03656954.1| 50S ribosomal protein L28 [Helicobacter canadensis MIT 98-5491]
 gi|253827896|ref|ZP_04870781.1| 50S ribosomal protein L28 [Helicobacter canadensis MIT 98-5491]
 gi|313142460|ref|ZP_07804653.1| 50S ribosomal protein L28 [Helicobacter canadensis MIT 98-5491]
 gi|253511302|gb|EES89961.1| 50S ribosomal protein L28 [Helicobacter canadensis MIT 98-5491]
 gi|313131491|gb|EFR49108.1| 50S ribosomal protein L28 [Helicobacter canadensis MIT 98-5491]
          Length = 62

 Score = 45.4 bits (106), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 39/62 (62%), Gaps = 1/62 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M++ C  + K  M GN VSHANNKT++R LPNL R+  I        ++RI+   LR+++
Sbjct: 1  MAKRCVFSGKGPMVGNNVSHANNKTKKRSLPNL-RVVRIKLEDGTTAKVRIAASTLRTMK 59

Query: 61 RQ 62
          ++
Sbjct: 60 KR 61


>gi|242309014|ref|ZP_04808169.1| 50S ribosomal protein L28 [Helicobacter pullorum MIT 98-5489]
 gi|239524438|gb|EEQ64304.1| 50S ribosomal protein L28 [Helicobacter pullorum MIT 98-5489]
          Length = 62

 Score = 45.4 bits (106), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 39/62 (62%), Gaps = 1/62 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M++ C  + K  M GN VSHANNKT++R LPNL R+  I        ++RI+   LR+++
Sbjct: 1  MAKRCFFSGKGPMVGNNVSHANNKTKKRSLPNL-RVVRIKLEDGTSAKVRIAASTLRTMK 59

Query: 61 RQ 62
          ++
Sbjct: 60 KR 61


>gi|70993812|ref|XP_751753.1| 50S ribosomal protein L24 [Aspergillus fumigatus Af293]
 gi|66849387|gb|EAL89715.1| 50S ribosomal protein L24 [Aspergillus fumigatus Af293]
 gi|159125327|gb|EDP50444.1| 50S ribosomal protein L24 [Aspergillus fumigatus A1163]
          Length = 212

 Score = 45.4 bits (106), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 38/60 (63%), Gaps = 2/60 (3%)

Query: 12  VMSGNKVSHANN--KTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFL 69
           +  GNK+S   N  KTRR + PN+ R  L S+ + +   +++++ ALR++ + GGLD +L
Sbjct: 72  IQFGNKISKGRNEGKTRRFWKPNVRRKKLWSEALGEYLFIKVTRKALRTIWKSGGLDNYL 131


>gi|296808247|ref|XP_002844462.1| 54S ribosomal protein L24 [Arthroderma otae CBS 113480]
 gi|238843945|gb|EEQ33607.1| 54S ribosomal protein L24 [Arthroderma otae CBS 113480]
          Length = 232

 Score = 45.4 bits (106), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 45/76 (59%), Gaps = 6/76 (7%)

Query: 11  TVMSGNKVSHANNK--TRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRF 68
           T++ GNK+S   NK  TRR + PN+ +  + S  ++++  L+++   LR++ + GGLD +
Sbjct: 73  TIIFGNKISKGRNKGKTRRIWKPNVRKEKVYSKALDEELDLKVTHRVLRTINKVGGLDEY 132

Query: 69  LSNSKKENLSARMRTL 84
           L   K     AR++ L
Sbjct: 133 LLGDK----PARIKEL 144


>gi|134074563|emb|CAK38856.1| unnamed protein product [Aspergillus niger]
          Length = 299

 Score = 45.4 bits (106), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 38/60 (63%), Gaps = 2/60 (3%)

Query: 12  VMSGNKVSHANN--KTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFL 69
           +  GNK+S   N  KTRR + PN+ R  L S+ + +   +++++ ALR++ + GGLD +L
Sbjct: 159 IQFGNKISQGRNEGKTRRFWKPNVRRKKLYSEALGEDLFIKVTRKALRTIRKAGGLDNYL 218


>gi|194335825|ref|YP_002017619.1| ribosomal protein L28 [Pelodictyon phaeoclathratiforme BU-1]
 gi|226699142|sp|B4SE11|RL28_PELPB RecName: Full=50S ribosomal protein L28
 gi|194308302|gb|ACF43002.1| ribosomal protein L28 [Pelodictyon phaeoclathratiforme BU-1]
          Length = 72

 Score = 45.4 bits (106), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/33 (63%), Positives = 23/33 (69%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNL 33
          MS+VC LT K  + GN VSHANN  R RF PNL
Sbjct: 1  MSKVCLLTGKRPIYGNTVSHANNHVRTRFEPNL 33


>gi|225682598|gb|EEH20882.1| 50S ribosomal protein L24 [Paracoccidioides brasiliensis Pb03]
 gi|226290013|gb|EEH45497.1| 50S ribosomal protein L24 [Paracoccidioides brasiliensis Pb18]
          Length = 203

 Score = 45.4 bits (106), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 44/76 (57%), Gaps = 6/76 (7%)

Query: 11  TVMSGNKVSHANNK--TRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRF 68
           T+  GNK+S   NK  TRR + PN+    L S+ +    +L+++   LR++++ GGLD++
Sbjct: 75  TIQFGNKISKGRNKGKTRRTWKPNVRHEELYSEALGTTLKLKVTHRVLRTIKKVGGLDQY 134

Query: 69  LSNSKKENLSARMRTL 84
           L   K     AR++ L
Sbjct: 135 LLGDK----PARIKEL 146


>gi|189425341|ref|YP_001952518.1| 50S ribosomal protein L28 [Geobacter lovleyi SZ]
 gi|226694925|sp|B3E4R2|RL28_GEOLS RecName: Full=50S ribosomal protein L28
 gi|189421600|gb|ACD95998.1| ribosomal protein L28 [Geobacter lovleyi SZ]
          Length = 64

 Score = 45.4 bits (106), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/33 (60%), Positives = 23/33 (69%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNL 33
          MSR CE+  K   +GN VSHANNKTR  + PNL
Sbjct: 1  MSRKCEICGKGPSTGNNVSHANNKTRTTWYPNL 33


>gi|297568236|ref|YP_003689580.1| ribosomal protein L28 [Desulfurivibrio alkaliphilus AHT2]
 gi|296924151|gb|ADH84961.1| ribosomal protein L28 [Desulfurivibrio alkaliphilus AHT2]
          Length = 62

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/33 (60%), Positives = 25/33 (75%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNL 33
          MS+VC +  K    GN VSHA+NK+RRR+LPNL
Sbjct: 1  MSKVCSVCGKKPEVGNNVSHAHNKSRRRWLPNL 33


>gi|219847552|ref|YP_002461985.1| 50S ribosomal protein L28 [Chloroflexus aggregans DSM 9485]
 gi|219541811|gb|ACL23549.1| ribosomal protein L28 [Chloroflexus aggregans DSM 9485]
          Length = 83

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 41/65 (63%), Gaps = 4/65 (6%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNL-CRITLISDIMEQKY-QLRISKCALRS 58
          M+R C+LT K    G+ VS +  +T RR+LPN+  R   + +  EQ+Y +L++S  ALR 
Sbjct: 1  MARRCDLTGKGPSFGHHVSFSKRRTNRRWLPNVQTRRIWVPE--EQRYVKLKLSAAALRE 58

Query: 59 VERQG 63
          + R+G
Sbjct: 59 INRKG 63


>gi|85859469|ref|YP_461671.1| 50S ribosomal protein L28 [Syntrophus aciditrophicus SB]
 gi|123516639|sp|Q2LTU0|RL28_SYNAS RecName: Full=50S ribosomal protein L28
 gi|85722560|gb|ABC77503.1| ribosomal protein L28 [Syntrophus aciditrophicus SB]
          Length = 65

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/33 (54%), Positives = 25/33 (75%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNL 33
          MSR+C++  K  + GN VSHANNKT++ + PNL
Sbjct: 1  MSRICDVCGKGPVVGNNVSHANNKTKKVWYPNL 33


>gi|295669208|ref|XP_002795152.1| 50S ribosomal protein L24 [Paracoccidioides brasiliensis Pb01]
 gi|226285086|gb|EEH40652.1| 50S ribosomal protein L24 [Paracoccidioides brasiliensis Pb01]
          Length = 199

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 44/76 (57%), Gaps = 6/76 (7%)

Query: 11  TVMSGNKVSHANNK--TRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRF 68
           T+  GNK+S   NK  TRR + PN+    L S+ +    +L+++   LR++++ GGLD++
Sbjct: 75  TIQFGNKISKGRNKGKTRRTWKPNVRHEELYSEALGTTLKLKVTHRVLRTIKKVGGLDQY 134

Query: 69  LSNSKKENLSARMRTL 84
           L   K     AR++ L
Sbjct: 135 LLGDK----PARIKEL 146


>gi|328868000|gb|EGG16381.1| hypothetical protein DFA_09412 [Dictyostelium fasciculatum]
          Length = 146

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 19/83 (22%), Positives = 48/83 (57%)

Query: 10  KTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFL 69
           K +  GN +S ++ KTRR + PN+   T  S +++ + ++ ++   +R +++ G  D ++
Sbjct: 36  KLIQYGNIISFSHKKTRRNWKPNVQAKTYFSHLLDAEVKVNVTTYTIRCIDKAGTFDNYI 95

Query: 70  SNSKKENLSARMRTLRSQILKKM 92
             +K +++++ + T    +LK +
Sbjct: 96  LKTKNKDMASELGTDLKSVLKNV 118


>gi|163848340|ref|YP_001636384.1| 50S ribosomal protein L28 [Chloroflexus aurantiacus J-10-fl]
 gi|222526259|ref|YP_002570730.1| 50S ribosomal protein L28 [Chloroflexus sp. Y-400-fl]
 gi|163669629|gb|ABY35995.1| ribosomal protein L28 [Chloroflexus aurantiacus J-10-fl]
 gi|222450138|gb|ACM54404.1| ribosomal protein L28 [Chloroflexus sp. Y-400-fl]
          Length = 84

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 39/63 (61%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR C+LT ++   G  VS +  +T RR+LPN+ +  +     ++  +L++S  ALR +E
Sbjct: 1  MSRRCDLTGRSPSFGYNVSFSKRRTNRRWLPNVQKRRIWVPEEQRFVRLKLSAAALREIE 60

Query: 61 RQG 63
          R+G
Sbjct: 61 RKG 63


>gi|158522067|ref|YP_001529937.1| ribosomal protein L28 [Desulfococcus oleovorans Hxd3]
 gi|226738068|sp|A8ZTS7|RL28_DESOH RecName: Full=50S ribosomal protein L28
 gi|158510893|gb|ABW67860.1| ribosomal protein L28 [Desulfococcus oleovorans Hxd3]
          Length = 63

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/45 (48%), Positives = 28/45 (62%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQ 45
          M+R CE+  K  M G  VSHA+N T+RRF PNL R+  + D   Q
Sbjct: 1  MARQCEICGKKPMVGANVSHAHNVTKRRFNPNLQRVRAVRDGKPQ 45


>gi|119356418|ref|YP_911062.1| 50S ribosomal protein L28 [Chlorobium phaeobacteroides DSM 266]
 gi|166226561|sp|A1BE11|RL28_CHLPD RecName: Full=50S ribosomal protein L28
 gi|119353767|gb|ABL64638.1| LSU ribosomal protein L28P [Chlorobium phaeobacteroides DSM 266]
          Length = 72

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 37/63 (58%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS+VC LT K    GN VSHANN  R RF PNL    +  +  ++  ++++S  A++ + 
Sbjct: 1  MSKVCVLTGKRPKYGNTVSHANNHVRTRFEPNLHTKKIWIEEEKRFVKVKLSAKAMKIIA 60

Query: 61 RQG 63
          + G
Sbjct: 61 KTG 63


>gi|121707801|ref|XP_001271945.1| 50S ribosomal protein L24 [Aspergillus clavatus NRRL 1]
 gi|119400093|gb|EAW10519.1| 50S ribosomal protein L24 [Aspergillus clavatus NRRL 1]
          Length = 212

 Score = 45.1 bits (105), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 38/60 (63%), Gaps = 2/60 (3%)

Query: 12  VMSGNKVSHANN--KTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFL 69
           +  GNK+S   N  KTRR + PN+ R  L S+ + +   +++++ ALR++ + GGLD +L
Sbjct: 72  IQFGNKISKGRNEGKTRRSWKPNVRRKKLWSEALGEFLFIKVTRKALRTIWKSGGLDNYL 131


>gi|28493080|ref|NP_787241.1| 50S ribosomal protein L28 [Tropheryma whipplei str. Twist]
 gi|28572288|ref|NP_789068.1| 50S ribosomal protein L28 [Tropheryma whipplei TW08/27]
 gi|67461516|sp|Q83GW8|RL28_TROWT RecName: Full=50S ribosomal protein L28
 gi|67461518|sp|Q83IB6|RL28_TROW8 RecName: Full=50S ribosomal protein L28
 gi|28410419|emb|CAD66805.1| 50s ribosomal protein L28 [Tropheryma whipplei TW08/27]
 gi|28476120|gb|AAO44210.1| 50S ribosomal protein L28 [Tropheryma whipplei str. Twist]
          Length = 78

 Score = 45.1 bits (105), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 38/63 (60%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS VC++T  +   G  VSH++ +T+RRF PN+ R T     + ++  L +S   LR ++
Sbjct: 1  MSSVCQVTGASPGFGYAVSHSHRRTKRRFDPNVRRRTFYVATLGRRVTLNVSVKGLRLID 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KRG 63


>gi|218961694|ref|YP_001741469.1| ribosomal protein L28 [Candidatus Cloacamonas acidaminovorans]
 gi|167730351|emb|CAO81263.1| ribosomal protein L28 [Candidatus Cloacamonas acidaminovorans]
          Length = 63

 Score = 44.7 bits (104), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 22/49 (44%), Positives = 30/49 (61%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQL 49
          MS+VC++  KT   GN  SHA N T+RRF PNL  I +  D   +K ++
Sbjct: 1  MSKVCDICGKTAQVGNHRSHALNATKRRFYPNLHEIRVAIDGGTKKIKV 49


>gi|261199896|ref|XP_002626349.1| 50S ribosomal protein L24 [Ajellomyces dermatitidis SLH14081]
 gi|239594557|gb|EEQ77138.1| 50S ribosomal protein L24 [Ajellomyces dermatitidis SLH14081]
 gi|239607948|gb|EEQ84935.1| 50S ribosomal protein L24 [Ajellomyces dermatitidis ER-3]
 gi|327350437|gb|EGE79294.1| 50S ribosomal protein L24 [Ajellomyces dermatitidis ATCC 18188]
          Length = 193

 Score = 44.7 bits (104), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 27/94 (28%), Positives = 50/94 (53%), Gaps = 10/94 (10%)

Query: 12  VMSGNKVSHANNK--TRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFL 69
           +  GNK+S   NK  TRR + PN+    L S+ + +  +L++    LR++++ GGLD++L
Sbjct: 72  IQFGNKISKGRNKGKTRRTWKPNIRHEELYSEALGKTLKLKVQHRVLRTIKKVGGLDQYL 131

Query: 70  SNSKKE--------NLSARMRTLRSQILKKMSEK 95
              K            + R + +RS+ +K+  E+
Sbjct: 132 LGDKPARIKELGVFGWNLRWKVMRSKAMKEKFEQ 165


>gi|145518488|ref|XP_001445116.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 gi|124412560|emb|CAK77719.1| unnamed protein product [Paramecium tetraurelia]
          Length = 289

 Score = 44.7 bits (104), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 53/97 (54%), Gaps = 1/97 (1%)

Query: 1   MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
           MS+ C    K   SGN+   +  KTRR ++PN+ + T  S I+ +K  ++++   ++ + 
Sbjct: 58  MSQFCLWHGKQPKSGNQTCFSEKKTRRSWMPNVQKQTYESLILGRKIHVKVTTKTMKCIR 117

Query: 61  RQGGLDRFLSNSKKENL-SARMRTLRSQILKKMSEKS 96
           + G  D ++  +K ++L S     LR  +L K+++ S
Sbjct: 118 KAGSFDNYVLLTKPQDLDSIYGEYLRKLMLTKVNDPS 154


>gi|228478059|ref|ZP_04062670.1| ribosomal protein L28 [Streptococcus salivarius SK126]
 gi|312862383|ref|ZP_07722626.1| ribosomal protein L28 [Streptococcus vestibularis F0396]
 gi|320548007|ref|ZP_08042288.1| 50S ribosomal protein L28 [Streptococcus equinus ATCC 9812]
 gi|322515849|ref|ZP_08068793.1| 50S ribosomal protein L28 [Streptococcus vestibularis ATCC 49124]
 gi|228250239|gb|EEK09492.1| ribosomal protein L28 [Streptococcus salivarius SK126]
 gi|311102026|gb|EFQ60226.1| ribosomal protein L28 [Streptococcus vestibularis F0396]
 gi|320447353|gb|EFW88115.1| 50S ribosomal protein L28 [Streptococcus equinus ATCC 9812]
 gi|322125735|gb|EFX97057.1| 50S ribosomal protein L28 [Streptococcus vestibularis ATCC 49124]
          Length = 62

 Score = 44.7 bits (104), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 27/63 (42%), Positives = 39/63 (61%), Gaps = 4/63 (6%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS-- 58
          M++VC  T +  +SGN  SHA NKT+R   PNL ++T++ D   +K  +  S  AL+S  
Sbjct: 1  MAKVCYFTGRKTVSGNNRSHAMNKTKRAVKPNLQKVTILVDGKPKK--VWASARALKSGK 58

Query: 59 VER 61
          VER
Sbjct: 59 VER 61


>gi|218780246|ref|YP_002431564.1| 50S ribosomal protein L28 [Desulfatibacillum alkenivorans AK-01]
 gi|226738066|sp|B8FB10|RL28_DESAA RecName: Full=50S ribosomal protein L28
 gi|218761630|gb|ACL04096.1| ribosomal protein L28 [Desulfatibacillum alkenivorans AK-01]
          Length = 63

 Score = 44.7 bits (104), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/33 (60%), Positives = 24/33 (72%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNL 33
          MSR+CE+  K  M GN VSHA+N  +RRF PNL
Sbjct: 1  MSRMCEICGKKPMVGNNVSHAHNVNKRRFNPNL 33


>gi|258567372|ref|XP_002584430.1| conserved hypothetical protein [Uncinocarpus reesii 1704]
 gi|237905876|gb|EEP80277.1| conserved hypothetical protein [Uncinocarpus reesii 1704]
          Length = 232

 Score = 44.7 bits (104), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 44/76 (57%), Gaps = 6/76 (7%)

Query: 11  TVMSGNKVSHANN--KTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRF 68
           T+  GNK+S   N  KTRR + PN+ +  + S+ + +   L++    LR++++ GGLD++
Sbjct: 73  TIQFGNKISKGRNEGKTRRTWKPNIRKEKIYSEALGKWLDLKVQHRVLRTIKKVGGLDQY 132

Query: 69  LSNSKKENLSARMRTL 84
           L   K     AR++ L
Sbjct: 133 LLGEK----PARIKEL 144


>gi|317495236|ref|ZP_07953606.1| ribosomal protein L28 [Gemella moribillum M424]
 gi|316914658|gb|EFV36134.1| ribosomal protein L28 [Gemella moribillum M424]
          Length = 62

 Score = 44.7 bits (104), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 40/63 (63%), Gaps = 4/63 (6%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS-- 58
          M++VC +T +   SGN  SHA N T+R+F  NL ++T++ D   Q  ++ +S  AL+S  
Sbjct: 1  MAKVCYVTGRKARSGNTRSHAMNATKRKFKANLQKVTILVD--GQPKKVWVSARALKSGK 58

Query: 59 VER 61
          VER
Sbjct: 59 VER 61


>gi|145517660|ref|XP_001444713.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 gi|124412135|emb|CAK77316.1| unnamed protein product [Paramecium tetraurelia]
          Length = 289

 Score = 44.7 bits (104), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 26/97 (26%), Positives = 53/97 (54%), Gaps = 1/97 (1%)

Query: 1   MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
           MS+ C    K   SGN+   +  KTRR ++PN+ + T  S I+ ++  ++++   ++ + 
Sbjct: 58  MSQFCLWHGKQPKSGNQTCFSEKKTRRSWMPNVQKQTYESLILGRRIHVKVTAKTMKCIR 117

Query: 61  RQGGLDRFLSNSKKENL-SARMRTLRSQILKKMSEKS 96
           + G  D ++  +K ++L S     LR  +L K+++ S
Sbjct: 118 KAGSFDNYILLTKPQDLDSIYGEYLRQLMLTKINDPS 154


>gi|323699071|ref|ZP_08110983.1| ribosomal protein L28 [Desulfovibrio sp. ND132]
 gi|323459003|gb|EGB14868.1| ribosomal protein L28 [Desulfovibrio desulfuricans ND132]
          Length = 71

 Score = 44.3 bits (103), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 18/33 (54%), Positives = 26/33 (78%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNL 33
          MS+VC++  K   +GN VSH++ KT+RRF+PNL
Sbjct: 1  MSQVCDICGKGPQTGNNVSHSHIKTKRRFMPNL 33


>gi|78044163|ref|YP_360301.1| 50S ribosomal protein L28 [Carboxydothermus hydrogenoformans
          Z-2901]
 gi|123576142|sp|Q3AC33|RL28_CARHZ RecName: Full=50S ribosomal protein L28
 gi|77996278|gb|ABB15177.1| ribosomal protein L28 [Carboxydothermus hydrogenoformans Z-2901]
          Length = 62

 Score = 44.3 bits (103), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 29/36 (80%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRI 36
          M++VCE+  K V+ G+++SH+N  T+R++LPNL R+
Sbjct: 1  MAKVCEICGKGVVYGHQISHSNIHTKRKWLPNLQRV 36


>gi|224541308|ref|ZP_03681847.1| hypothetical protein CATMIT_00468 [Catenibacterium mitsuokai DSM
          15897]
 gi|224525745|gb|EEF94850.1| hypothetical protein CATMIT_00468 [Catenibacterium mitsuokai DSM
          15897]
          Length = 65

 Score = 44.3 bits (103), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 26/61 (42%), Positives = 39/61 (63%), Gaps = 2/61 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR C+L+ K  MSGN  SHA N TRR++  NL + T+I D   +  ++R+S   LR++ 
Sbjct: 5  MSRKCQLSGKGPMSGNNRSHALNATRRKWNVNLQKATVIID--GKPTKVRVSARQLRTLR 62

Query: 61 R 61
          +
Sbjct: 63 K 63


>gi|148265186|ref|YP_001231892.1| 50S ribosomal protein L28 [Geobacter uraniireducens Rf4]
 gi|189029442|sp|A5G6A1|RL28_GEOUR RecName: Full=50S ribosomal protein L28
 gi|146398686|gb|ABQ27319.1| LSU ribosomal protein L28P [Geobacter uraniireducens Rf4]
          Length = 63

 Score = 44.3 bits (103), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/41 (48%), Positives = 27/41 (65%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISD 41
          MS++CE+  K    GN VSHANNKT R + PNL +I  + +
Sbjct: 1  MSKICEICGKGPSFGNNVSHANNKTSRIWYPNLQKIKAVKN 41


>gi|319955905|ref|YP_004167168.1| LSU ribosomal protein l28p [Nitratifractor salsuginis DSM 16511]
 gi|319418309|gb|ADV45419.1| LSU ribosomal protein L28P [Nitratifractor salsuginis DSM 16511]
          Length = 70

 Score = 44.3 bits (103), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 29/40 (72%), Gaps = 2/40 (5%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNL--CRITL 38
          M+R C++T K  + G  VSHA+NKT++R LPNL   RITL
Sbjct: 1  MARRCQITGKGPLVGYNVSHAHNKTKKRQLPNLRTVRITL 40


>gi|154148353|ref|YP_001406344.1| ribosomal protein L28 [Campylobacter hominis ATCC BAA-381]
 gi|166226558|sp|A7I1F3|RL28_CAMHC RecName: Full=50S ribosomal protein L28
 gi|153804362|gb|ABS51369.1| ribosomal protein L28 [Campylobacter hominis ATCC BAA-381]
          Length = 63

 Score = 44.3 bits (103), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 19/33 (57%), Positives = 26/33 (78%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNL 33
          MSR C +T K+ M+G+ VSHANNKT+++F  NL
Sbjct: 1  MSRRCAITGKSAMNGHSVSHANNKTKKKFGVNL 33


>gi|297798834|ref|XP_002867301.1| ribosomal protein L28 family protein [Arabidopsis lyrata subsp.
           lyrata]
 gi|297313137|gb|EFH43560.1| ribosomal protein L28 family protein [Arabidopsis lyrata subsp.
           lyrata]
          Length = 212

 Score = 44.3 bits (103), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 12  VMSGNKVSH-ANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFLS 70
           +  GN+VS    NK+RR + PN+    L S I ++  +++++  ALR +++ GG+D +L 
Sbjct: 53  IQYGNRVSEDGGNKSRRCWKPNVQEKRLFSYIFDRHIKVKVTTHALRCIDKAGGIDEYLL 112

Query: 71  NSKKENLSARM 81
            +  + +   M
Sbjct: 113 KTPYQKMDTEM 123


>gi|77407549|ref|ZP_00784368.1| ribosomal protein L28 [Streptococcus agalactiae H36B]
 gi|77173841|gb|EAO76891.1| ribosomal protein L28 [Streptococcus agalactiae H36B]
          Length = 77

 Score = 44.3 bits (103), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 40/63 (63%), Gaps = 4/63 (6%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS-- 58
          M++VC  T +  +SGN  SHA N+T+R   PNL ++T++ D   +K  + +S  AL+S  
Sbjct: 16 MAKVCYFTGRKTVSGNNRSHAMNQTKRTVKPNLQKVTVLIDGKPKK--VWVSARALKSGK 73

Query: 59 VER 61
          VER
Sbjct: 74 VER 76


>gi|332879563|ref|ZP_08447258.1| ribosomal protein L28 [Capnocytophaga sp. oral taxon 329 str.
          F0087]
 gi|332682529|gb|EGJ55431.1| ribosomal protein L28 [Capnocytophaga sp. oral taxon 329 str.
          F0087]
          Length = 86

 Score = 44.3 bits (103), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 39/72 (54%), Gaps = 1/72 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS++C++T K  M GN VSH+  +T+RRF  NL          +    L IS   LR + 
Sbjct: 1  MSKICQITGKKAMVGNNVSHSKRRTKRRFNVNLFTKKFYYVEQDCWISLNISAAGLRYIN 60

Query: 61 RQGGLDRFLSNS 72
          +  GLD  L+++
Sbjct: 61 KV-GLDAALASA 71


>gi|223984328|ref|ZP_03634470.1| hypothetical protein HOLDEFILI_01764 [Holdemania filiformis DSM
          12042]
 gi|223963685|gb|EEF68055.1| hypothetical protein HOLDEFILI_01764 [Holdemania filiformis DSM
          12042]
          Length = 64

 Score = 44.3 bits (103), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 24/62 (38%), Positives = 42/62 (67%), Gaps = 2/62 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC ++ K  +SGNK SH+ + +RR++  NL ++ ++ D   Q+  +RIS  AL++++
Sbjct: 1  MSRVCAVSGKKALSGNKRSHSLHASRRKWNVNLQKVKVMVDGKPQR--IRISARALKTLK 58

Query: 61 RQ 62
           Q
Sbjct: 59 AQ 60


>gi|15616708|ref|NP_239920.1| 50S ribosomal protein L28 [Buchnera aphidicola str. APS
          (Acyrthosiphon pisum)]
 gi|11134521|sp|P57188|RL28_BUCAI RecName: Full=50S ribosomal protein L28
 gi|25295494|pir||F84939 50S ribosomal protein L28 [imported] - Buchnera sp. (strain APS)
 gi|10038771|dbj|BAB12806.1| 50S ribosomal protein L28 [Buchnera aphidicola str. APS
          (Acyrthosiphon pisum)]
          Length = 75

 Score = 44.3 bits (103), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 42/65 (64%), Gaps = 4/65 (6%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNL-CRITLISDIMEQKY-QLRISKCALRS 58
          MSR+C++T K  M GN  SHA N T+R+FL N+      I+D  E+++ +L +S   +R 
Sbjct: 1  MSRICQITGKKRMIGNNRSHALNATKRKFLINIQYHRFWIAD--EKRFIKLHVSTNGMRY 58

Query: 59 VERQG 63
          ++++G
Sbjct: 59 IDKKG 63


>gi|114776359|ref|ZP_01451404.1| 50S ribosomal protein L28 [Mariprofundus ferrooxydans PV-1]
 gi|114553189|gb|EAU55587.1| 50S ribosomal protein L28 [Mariprofundus ferrooxydans PV-1]
          Length = 51

 Score = 44.3 bits (103), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 33/50 (66%), Gaps = 2/50 (4%)

Query: 13 MSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQ 62
          MSGN VSHA+N T+RRFLPNL ++  I  +  Q  ++++    LRS + Q
Sbjct: 1  MSGNNVSHAHNTTKRRFLPNLMQVRAI--VNGQTSKIKVCASCLRSDKVQ 48


>gi|116328129|ref|YP_797849.1| 50S ribosomal protein L28 [Leptospira borgpetersenii serovar
          Hardjo-bovis L550]
 gi|116331418|ref|YP_801136.1| 50S ribosomal protein L28 [Leptospira borgpetersenii serovar
          Hardjo-bovis JB197]
 gi|122280837|sp|Q04RU2|RL28_LEPBJ RecName: Full=50S ribosomal protein L28
 gi|122284079|sp|Q051S9|RL28_LEPBL RecName: Full=50S ribosomal protein L28
 gi|116120873|gb|ABJ78916.1| 50S Ribosomal protein L28 [Leptospira borgpetersenii serovar
          Hardjo-bovis L550]
 gi|116125107|gb|ABJ76378.1| 50S Ribosomal protein L28 [Leptospira borgpetersenii serovar
          Hardjo-bovis JB197]
          Length = 94

 Score = 44.3 bits (103), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 40/63 (63%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+R CE+T +  +SGN VSH++ KTRR +  NL +  +  +   +   +R+S  ALR++ 
Sbjct: 1  MARRCEVTGRGTVSGNNVSHSHIKTRRTWKVNLIKKRIFLEDENRWVTIRLSTRALRTLR 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|22536314|ref|NP_687165.1| 50S ribosomal protein L28 [Streptococcus agalactiae 2603V/R]
 gi|25010202|ref|NP_734597.1| 50S ribosomal protein L28 [Streptococcus agalactiae NEM316]
 gi|76788045|ref|YP_328853.1| 50S ribosomal protein L28 [Streptococcus agalactiae A909]
 gi|77410284|ref|ZP_00786724.1| ribosomal protein L28 [Streptococcus agalactiae COH1]
 gi|329117624|ref|ZP_08246341.1| ribosomal protein L28 [Streptococcus parauberis NCFD 2020]
 gi|67461525|sp|Q8E268|RL28_STRA5 RecName: Full=50S ribosomal protein L28
 gi|67461527|sp|Q8E7M7|RL28_STRA3 RecName: Full=50S ribosomal protein L28
 gi|123602577|sp|Q3K3Q0|RL28_STRA1 RecName: Full=50S ribosomal protein L28
 gi|22533137|gb|AAM99037.1|AE014197_5 ribosomal protein L28 [Streptococcus agalactiae 2603V/R]
 gi|23094553|emb|CAD45772.1| 50S ribosomal protein L28 [Streptococcus agalactiae NEM316]
 gi|76563102|gb|ABA45686.1| ribosomal protein L28 [Streptococcus agalactiae A909]
 gi|77171106|gb|EAO74535.1| ribosomal protein L28 [Streptococcus agalactiae COH1]
 gi|319744072|gb|EFV96449.1| 50S ribosomal protein L28 [Streptococcus agalactiae ATCC 13813]
 gi|326908029|gb|EGE54943.1| ribosomal protein L28 [Streptococcus parauberis NCFD 2020]
          Length = 62

 Score = 43.9 bits (102), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 40/63 (63%), Gaps = 4/63 (6%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS-- 58
          M++VC  T +  +SGN  SHA N+T+R   PNL ++T++ D   +K  + +S  AL+S  
Sbjct: 1  MAKVCYFTGRKTVSGNNRSHAMNQTKRTVKPNLQKVTVLIDGKPKK--VWVSARALKSGK 58

Query: 59 VER 61
          VER
Sbjct: 59 VER 61


>gi|34541560|ref|NP_906039.1| 50S ribosomal protein L28 [Porphyromonas gingivalis W83]
 gi|188995755|ref|YP_001930007.1| 50S ribosomal protein L28 [Porphyromonas gingivalis ATCC 33277]
 gi|67461488|sp|Q7MTJ4|RL28_PORGI RecName: Full=50S ribosomal protein L28
 gi|226699145|sp|B2RM15|RL28_PORG3 RecName: Full=50S ribosomal protein L28
 gi|34397877|gb|AAQ66938.1| ribosomal protein L28 [Porphyromonas gingivalis W83]
 gi|188595435|dbj|BAG34410.1| 50S ribosomal protein L28 [Porphyromonas gingivalis ATCC 33277]
          Length = 79

 Score = 43.9 bits (102), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 34/63 (53%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS++C++T K  M GN VSH+  +T+R F  NL R        +    LRIS   LR + 
Sbjct: 1  MSKICQITGKKAMVGNNVSHSKRRTKRVFDVNLFRKKFYWVEQDCWVVLRISAAGLRLIN 60

Query: 61 RQG 63
          + G
Sbjct: 61 KIG 63


>gi|39997332|ref|NP_953283.1| 50S ribosomal protein L28 [Geobacter sulfurreducens PCA]
 gi|67461477|sp|Q74AW5|RL28_GEOSL RecName: Full=50S ribosomal protein L28
 gi|39984223|gb|AAR35610.1| ribosomal protein L28 [Geobacter sulfurreducens PCA]
 gi|298506269|gb|ADI84992.1| ribosomal protein L28 [Geobacter sulfurreducens KN400]
          Length = 63

 Score = 43.9 bits (102), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 20/33 (60%), Positives = 23/33 (69%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNL 33
          MS+VCE+  K    GN VSHANNKTR  + PNL
Sbjct: 1  MSKVCEICGKGPSFGNNVSHANNKTRTTWHPNL 33


>gi|24214862|ref|NP_712343.1| 50S ribosomal protein L28 [Leptospira interrogans serovar Lai
          str. 56601]
 gi|45657626|ref|YP_001712.1| 50S ribosomal protein L28 [Leptospira interrogans serovar
          Copenhageni str. Fiocruz L1-130]
 gi|67461465|sp|Q72RI5|RL28_LEPIC RecName: Full=50S ribosomal protein L28
 gi|67461531|sp|Q8F483|RL28_LEPIN RecName: Full=50S ribosomal protein L28
 gi|24195881|gb|AAN49361.1| 50S ribosomal protein L28 [Leptospira interrogans serovar Lai
          str. 56601]
 gi|45600866|gb|AAS70349.1| 50S ribosomal protein L28 [Leptospira interrogans serovar
          Copenhageni str. Fiocruz L1-130]
          Length = 94

 Score = 43.9 bits (102), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 40/63 (63%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+R CE+T +  +SGN VSH++ KTRR +  NL +  +  +   +   +R+S  ALR++ 
Sbjct: 1  MARRCEVTGRGTVSGNNVSHSHIKTRRTWKVNLIKKRIFLEDENRWVTIRLSTRALRTLR 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|253795690|ref|YP_003038786.1| putative 50S ribosomal subunit protein L28 [Candidatus Hodgkinia
          cicadicola Dsem]
 gi|253739998|gb|ACT34333.1| putative 50S ribosomal subunit protein L28 [Candidatus Hodgkinia
          cicadicola Dsem]
          Length = 91

 Score = 43.9 bits (102), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 36/62 (58%)

Query: 13 MSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFLSNS 72
          + G +VSH+N KT+R+F PN  +  L S ++ +    +     +R V + GG+D ++ N 
Sbjct: 11 LFGARVSHSNKKTKRKFKPNAVKTKLWSLVLNRFVSFKARARFVREVRKYGGVDFYVVNR 70

Query: 73 KK 74
          K+
Sbjct: 71 KR 72


>gi|77411802|ref|ZP_00788137.1| ribosomal protein L28 [Streptococcus agalactiae CJB111]
 gi|77162137|gb|EAO73113.1| ribosomal protein L28 [Streptococcus agalactiae CJB111]
          Length = 71

 Score = 43.9 bits (102), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 40/63 (63%), Gaps = 4/63 (6%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS-- 58
          M++VC  T +  +SGN  SHA N+T+R   PNL ++T++ D   +K  + +S  AL+S  
Sbjct: 10 MAKVCYFTGRKTVSGNNRSHAMNQTKRTVKPNLQKVTVLIDGKPKK--VWVSARALKSGK 67

Query: 59 VER 61
          VER
Sbjct: 68 VER 70


>gi|322392552|ref|ZP_08066012.1| 50S ribosomal protein L28 [Streptococcus peroris ATCC 700780]
 gi|321144544|gb|EFX39945.1| 50S ribosomal protein L28 [Streptococcus peroris ATCC 700780]
          Length = 62

 Score = 43.9 bits (102), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 27/63 (42%), Positives = 39/63 (61%), Gaps = 4/63 (6%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS-- 58
          M++VC  T +  +SGN  SHA NKT+R   PNL ++T++ D   +K  +  S  AL+S  
Sbjct: 1  MAKVCYFTGRKTVSGNNRSHAMNKTKRAVKPNLQKVTVLIDGKPKK--VWASARALKSGK 58

Query: 59 VER 61
          VER
Sbjct: 59 VER 61


>gi|206890424|ref|YP_002249673.1| ribosomal protein L28 [Thermodesulfovibrio yellowstonii DSM
          11347]
 gi|206742362|gb|ACI21419.1| ribosomal protein L28 [Thermodesulfovibrio yellowstonii DSM
          11347]
          Length = 62

 Score = 43.9 bits (102), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 29/45 (64%)

Query: 5  CELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQL 49
          C +  K  + GN VSHANNKT+R F PNL R+ +I++   Q+  +
Sbjct: 4  CYVCGKKKVIGNNVSHANNKTKRYFFPNLQRMKIITERGPQRVHV 48


>gi|254567473|ref|XP_002490847.1| 54S ribosomal protein L24, mitochondrial [Pichia pastoris GS115]
 gi|238030643|emb|CAY68567.1| 54S ribosomal protein L24, mitochondrial [Pichia pastoris GS115]
 gi|328351230|emb|CCA37630.1| 54S ribosomal protein L24, mitochondrial [Pichia pastoris CBS 7435]
          Length = 248

 Score = 43.9 bits (102), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 44/70 (62%), Gaps = 4/70 (5%)

Query: 15  GNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFLSNSKK 74
           GNK+S   NK  R++  N+   +L S+I+ +  +++++   LR++ ++GGLD++L   K 
Sbjct: 79  GNKISEFKNKNGRKWSLNVHTKSLWSEILNKSIRVKLTARVLRTINKEGGLDQYLLKDK- 137

Query: 75  ENLSARMRTL 84
              SAR++ L
Sbjct: 138 ---SARIKEL 144


>gi|78777799|ref|YP_394114.1| 50S ribosomal protein L28 [Sulfurimonas denitrificans DSM 1251]
 gi|123549874|sp|Q30Q52|RL28_SULDN RecName: Full=50S ribosomal protein L28
 gi|78498339|gb|ABB44879.1| LSU ribosomal protein L28P [Sulfurimonas denitrificans DSM 1251]
          Length = 62

 Score = 43.9 bits (102), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 24/62 (38%), Positives = 40/62 (64%), Gaps = 1/62 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M++ C ++ K  MSGN VSHA N+T+RRFL NL  + +  D    + +++IS   LR+++
Sbjct: 1  MAKKCAISGKGPMSGNNVSHAKNRTKRRFLLNLRTVRIALDDGTTR-KIKISARELRTLK 59

Query: 61 RQ 62
          + 
Sbjct: 60 KN 61


>gi|15235960|ref|NP_194874.1| ribosomal protein L28 family protein [Arabidopsis thaliana]
 gi|15724234|gb|AAL06510.1|AF412057_1 AT4g31460/F3L17_30 [Arabidopsis thaliana]
 gi|5262757|emb|CAB45905.1| putative protein [Arabidopsis thaliana]
 gi|7270049|emb|CAB79864.1| putative protein [Arabidopsis thaliana]
 gi|21593391|gb|AAM65340.1| unknown [Arabidopsis thaliana]
 gi|30102482|gb|AAP21159.1| At4g31460/F3L17_30 [Arabidopsis thaliana]
 gi|332660516|gb|AEE85916.1| Ribosomal L28 family [Arabidopsis thaliana]
          Length = 212

 Score = 43.5 bits (101), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 12  VMSGNKVSH-ANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFLS 70
           +  GN+VS    NK+RR + PN+    L S I +   +++++  ALR +++ GG+D +L 
Sbjct: 53  IQYGNRVSEDGGNKSRRCWKPNVQEKRLFSYIFDSHIKVKVTTHALRCIDKAGGIDEYLL 112

Query: 71  NSKKENLSARM 81
            +  + +   M
Sbjct: 113 KTPYQKMDTEM 123


>gi|229496123|ref|ZP_04389844.1| ribosomal protein L28 [Porphyromonas endodontalis ATCC 35406]
 gi|229316954|gb|EEN82866.1| ribosomal protein L28 [Porphyromonas endodontalis ATCC 35406]
          Length = 79

 Score = 43.5 bits (101), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 35/63 (55%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS+ C++T K  M GN VSH+N+KT+R F  NL          +   +L++S   LR + 
Sbjct: 1  MSKACQITGKRAMVGNNVSHSNHKTKRVFNVNLFEKKFYWPEQDCWIRLKVSADGLRLIN 60

Query: 61 RQG 63
          + G
Sbjct: 61 KIG 63


>gi|116750695|ref|YP_847382.1| 50S ribosomal protein L28 [Syntrophobacter fumaroxidans MPOB]
 gi|166228166|sp|A0LNE5|RL28_SYNFM RecName: Full=50S ribosomal protein L28
 gi|116699759|gb|ABK18947.1| LSU ribosomal protein L28P [Syntrophobacter fumaroxidans MPOB]
          Length = 64

 Score = 43.5 bits (101), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 20/33 (60%), Positives = 22/33 (66%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNL 33
          MSR CE   K    GN VSHANNKT+R + PNL
Sbjct: 1  MSRKCEFCGKEPHVGNNVSHANNKTKRLWYPNL 33


>gi|299139061|ref|ZP_07032237.1| ribosomal protein L28 [Acidobacterium sp. MP5ACTX8]
 gi|298598741|gb|EFI54903.1| ribosomal protein L28 [Acidobacterium sp. MP5ACTX8]
          Length = 62

 Score = 43.5 bits (101), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 19/33 (57%), Positives = 24/33 (72%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNL 33
          M++VCEL  K    GN +SHA+N TRRR+ PNL
Sbjct: 1  MAQVCELCGKGPQFGNNISHAHNVTRRRWNPNL 33


>gi|193215033|ref|YP_001996232.1| 50S ribosomal protein L28 [Chloroherpeton thalassium ATCC 35110]
 gi|226738052|sp|B3QZ92|RL28_CHLT3 RecName: Full=50S ribosomal protein L28
 gi|193088510|gb|ACF13785.1| ribosomal protein L28 [Chloroherpeton thalassium ATCC 35110]
          Length = 74

 Score = 43.5 bits (101), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 38/63 (60%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS+VC LT K    GN VSHANN  R RF PN+    +  +  ++  ++++S  A++ + 
Sbjct: 1  MSKVCILTGKKHQYGNTVSHANNHRRTRFEPNIQAKRIWLEEEKRWVKVKLSAKAIKIIS 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KRG 63


>gi|154492235|ref|ZP_02031861.1| hypothetical protein PARMER_01869 [Parabacteroides merdae ATCC
          43184]
 gi|218261813|ref|ZP_03476528.1| hypothetical protein PRABACTJOHN_02199 [Parabacteroides johnsonii
          DSM 18315]
 gi|154087460|gb|EDN86505.1| hypothetical protein PARMER_01869 [Parabacteroides merdae ATCC
          43184]
 gi|218223759|gb|EEC96409.1| hypothetical protein PRABACTJOHN_02199 [Parabacteroides johnsonii
          DSM 18315]
          Length = 79

 Score = 43.5 bits (101), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 34/63 (53%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS++C++T K  M GN VSH+  +T+R+F  NL          +    L IS   LR++ 
Sbjct: 1  MSKICQITGKKAMVGNNVSHSKRRTKRKFDVNLFTKKFYWVEQDCWVSLNISAAGLRTIN 60

Query: 61 RQG 63
          + G
Sbjct: 61 KLG 63


>gi|301116497|ref|XP_002905977.1| conserved hypothetical protein [Phytophthora infestans T30-4]
 gi|262109277|gb|EEY67329.1| conserved hypothetical protein [Phytophthora infestans T30-4]
          Length = 119

 Score = 43.5 bits (101), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 45/81 (55%), Gaps = 1/81 (1%)

Query: 15  GNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFLSNSKK 74
           GN VS +  +TRR +  N    +L S+ +++K  L ++   LR V++ GGLD +L + K 
Sbjct: 38  GNNVSFSKRRTRRAWKVNHQWKSLYSEALDEKVGLNVTTHTLRCVDKIGGLDNYLLSIKD 97

Query: 75  E-NLSARMRTLRSQILKKMSE 94
           E  L  +    R ++L  +SE
Sbjct: 98  ERELGVKGLKTRDRVLAALSE 118


>gi|115375937|ref|ZP_01463185.1| ribosomal protein L28 [Stigmatella aurantiaca DW4/3-1]
 gi|310820701|ref|YP_003953059.1| 50S ribosomal protein L28 [Stigmatella aurantiaca DW4/3-1]
 gi|115367020|gb|EAU66007.1| ribosomal protein L28 [Stigmatella aurantiaca DW4/3-1]
 gi|309393773|gb|ADO71232.1| 50S ribosomal protein L28 [Stigmatella aurantiaca DW4/3-1]
          Length = 63

 Score = 43.5 bits (101), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 20/36 (55%), Positives = 26/36 (72%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRI 36
          M+  C++  K  + GN VSHANNKT+RR LPNL +I
Sbjct: 1  MAWKCDICGKRPLVGNNVSHANNKTKRRTLPNLQKI 36


>gi|312213496|emb|CBX93578.1| similar to 50S ribosomal protein L24 [Leptosphaeria maculans]
          Length = 490

 Score = 43.5 bits (101), Expect = 0.011,   Method: Composition-based stats.
 Identities = 22/61 (36%), Positives = 40/61 (65%), Gaps = 1/61 (1%)

Query: 10  KTVMSGNKVSH-ANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRF 68
           + +  GN VS     KTRR + PN+   +L S ++++K +LR++   L++++R+GGLD +
Sbjct: 90  QMIQFGNNVSKKTETKTRRVWRPNVLSKSLYSVVLKKKIKLRVTANVLKTIDREGGLDEY 149

Query: 69  L 69
           L
Sbjct: 150 L 150


>gi|95931488|ref|ZP_01314186.1| ribosomal protein L28 [Desulfuromonas acetoxidans DSM 684]
 gi|95132458|gb|EAT14159.1| ribosomal protein L28 [Desulfuromonas acetoxidans DSM 684]
          Length = 61

 Score = 43.5 bits (101), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 18/32 (56%), Positives = 24/32 (75%)

Query: 2  SRVCELTKKTVMSGNKVSHANNKTRRRFLPNL 33
          SR CE+  K  ++GN VSHA+NKTR+ + PNL
Sbjct: 1  SRTCEICGKKPVTGNNVSHAHNKTRKVWYPNL 32


>gi|108757179|ref|YP_630912.1| 50S ribosomal protein L28 [Myxococcus xanthus DK 1622]
 gi|108461059|gb|ABF86244.1| ribosomal protein L28 [Myxococcus xanthus DK 1622]
          Length = 63

 Score = 43.5 bits (101), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 20/36 (55%), Positives = 26/36 (72%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRI 36
          M+  C+L  K  + GN VSHANNKT++R LPNL +I
Sbjct: 1  MAWKCDLCGKRPLVGNNVSHANNKTKKRTLPNLQKI 36


>gi|55821925|ref|YP_140367.1| 50S ribosomal protein L28 [Streptococcus thermophilus LMG 18311]
 gi|55823844|ref|YP_142285.1| 50S ribosomal protein L28 [Streptococcus thermophilus CNRZ1066]
 gi|116628623|ref|YP_821242.1| 50S ribosomal protein L28 [Streptococcus thermophilus LMD-9]
 gi|67461279|sp|Q5LXP2|RL28_STRT1 RecName: Full=50S ribosomal protein L28
 gi|67461285|sp|Q5M294|RL28_STRT2 RecName: Full=50S ribosomal protein L28
 gi|122266783|sp|Q03IC6|RL28_STRTD RecName: Full=50S ribosomal protein L28
 gi|55737910|gb|AAV61552.1| 50S ribosomal protein L28 [Streptococcus thermophilus LMG 18311]
 gi|55739829|gb|AAV63470.1| 50S ribosomal protein L28 [Streptococcus thermophilus CNRZ1066]
 gi|116101900|gb|ABJ67046.1| LSU ribosomal protein L28P [Streptococcus thermophilus LMD-9]
 gi|312279276|gb|ADQ63933.1| Ribosomal protein L28 [Streptococcus thermophilus ND03]
          Length = 62

 Score = 43.1 bits (100), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 27/63 (42%), Positives = 39/63 (61%), Gaps = 4/63 (6%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS-- 58
          M++VC  T +  +SGN  SHA NKT+R   PNL ++T++ D   +K  +  S  AL+S  
Sbjct: 1  MAKVCYFTGRKTVSGNNRSHAMNKTKRVVKPNLQKVTVLIDGKPKK--VWASARALKSGK 58

Query: 59 VER 61
          VER
Sbjct: 59 VER 61


>gi|78223526|ref|YP_385273.1| 50S ribosomal protein L28 [Geobacter metallireducens GS-15]
 gi|123571476|sp|Q39T76|RL28_GEOMG RecName: Full=50S ribosomal protein L28
 gi|78194781|gb|ABB32548.1| LSU ribosomal protein L28P [Geobacter metallireducens GS-15]
          Length = 63

 Score = 43.1 bits (100), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 20/33 (60%), Positives = 22/33 (66%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNL 33
          MSR CE+  K    GN VSHANNKTR  + PNL
Sbjct: 1  MSRKCEICGKGPSFGNNVSHANNKTRTTWYPNL 33


>gi|296417908|ref|XP_002838589.1| hypothetical protein [Tuber melanosporum Mel28]
 gi|295634539|emb|CAZ82780.1| unnamed protein product [Tuber melanosporum]
          Length = 249

 Score = 43.1 bits (100), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 39/74 (52%), Gaps = 8/74 (10%)

Query: 12  VMSGNKVSHANN--------KTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQG 63
           +  G  +   NN        KTRR+++PN+   ++ S  +   + L I+   LR++++ G
Sbjct: 59  LYGGKHIQFGNNVPENFLRYKTRRQWMPNVRHRSVYSRALGMHFSLDITTSVLRTIDKVG 118

Query: 64  GLDRFLSNSKKENL 77
           GLD +L+ +K   L
Sbjct: 119 GLDAYLTGTKPARL 132


>gi|295394905|ref|ZP_06805118.1| 50S ribosomal protein L28 [Brevibacterium mcbrellneri ATCC 49030]
 gi|294972238|gb|EFG48100.1| 50S ribosomal protein L28 [Brevibacterium mcbrellneri ATCC 49030]
          Length = 78

 Score = 43.1 bits (100), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 37/63 (58%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+ VC++T  T   G+ VSH+N +T+RRF PN+ +       + +   L +S   ++ ++
Sbjct: 1  MAAVCQVTGTTPGFGHNVSHSNRRTKRRFDPNIQKKKYYVPSLRRNVTLTVSARGIKVID 60

Query: 61 RQG 63
          R+G
Sbjct: 61 RRG 63


>gi|222152512|ref|YP_002561687.1| 50S ribosomal protein L28 [Streptococcus uberis 0140J]
 gi|319939717|ref|ZP_08014075.1| 50S ribosomal protein L28 [Streptococcus anginosus 1_2_62CV]
 gi|254801380|sp|B9DTK1|RL28_STRU0 RecName: Full=50S ribosomal protein L28
 gi|222113323|emb|CAR40906.1| 50S ribosomal protein L28 [Streptococcus uberis 0140J]
 gi|319811135|gb|EFW07444.1| 50S ribosomal protein L28 [Streptococcus anginosus 1_2_62CV]
          Length = 62

 Score = 43.1 bits (100), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 39/63 (61%), Gaps = 4/63 (6%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS-- 58
          M++VC  T +  +SGN  SHA N+T+R   PNL ++T++ D   +K  +  S  AL+S  
Sbjct: 1  MAKVCYFTGRKTVSGNNRSHAMNQTKRTVKPNLQKVTILVDGKPKK--VWASARALKSGK 58

Query: 59 VER 61
          VER
Sbjct: 59 VER 61


>gi|329770509|ref|ZP_08261887.1| 50S ribosomal protein L28 [Gemella sanguinis M325]
 gi|328836258|gb|EGF85927.1| 50S ribosomal protein L28 [Gemella sanguinis M325]
          Length = 62

 Score = 43.1 bits (100), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 25/63 (39%), Positives = 40/63 (63%), Gaps = 4/63 (6%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS-- 58
          M++VC +T +   SGN  SHA N ++R+F  NL ++T++ D   Q  ++ +S  AL+S  
Sbjct: 1  MAKVCYVTGRKARSGNTRSHAMNASKRKFKANLQKVTILVD--GQPKKVWVSARALKSGK 58

Query: 59 VER 61
          VER
Sbjct: 59 VER 61


>gi|325279590|ref|YP_004252132.1| 50S ribosomal protein L28 [Odoribacter splanchnicus DSM 20712]
 gi|324311399|gb|ADY31952.1| 50S ribosomal protein L28 [Odoribacter splanchnicus DSM 20712]
          Length = 80

 Score = 43.1 bits (100), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 35/63 (55%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  M GN VSH+  + +R F  NL +        ++  +L +S   LR + 
Sbjct: 1  MSRVCQITGKRAMGGNHVSHSKRRVKRTFSINLFKRNFYWPEEDRWIRLNVSADGLRLIN 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KRG 63


>gi|224368343|ref|YP_002602506.1| 50S ribosomal protein L28 [Desulfobacterium autotrophicum HRM2]
 gi|259646733|sp|C0QM36|RL28_DESAH RecName: Full=50S ribosomal protein L28
 gi|223691059|gb|ACN14342.1| RpmB [Desulfobacterium autotrophicum HRM2]
          Length = 74

 Score = 43.1 bits (100), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 20/41 (48%), Positives = 27/41 (65%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISD 41
          MS+ C++  K  M GN VSHA+N  +RRF PNL R+  + D
Sbjct: 1  MSKECKICGKKPMVGNNVSHAHNVNKRRFNPNLQRVKALFD 41


>gi|239618031|ref|YP_002941353.1| ribosomal protein L28 [Kosmotoga olearia TBF 19.5.1]
 gi|259646742|sp|C5CFE0|RL28_KOSOT RecName: Full=50S ribosomal protein L28
 gi|239506862|gb|ACR80349.1| ribosomal protein L28 [Kosmotoga olearia TBF 19.5.1]
          Length = 63

 Score = 43.1 bits (100), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 28/41 (68%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISD 41
          MS+VCE+  K   +GN VSH+N K +R + PN+ ++ +I D
Sbjct: 1  MSKVCEICGKRPTTGNTVSHSNKKNKRWWKPNVQKVKVIVD 41


>gi|15675704|ref|NP_269878.1| 50S ribosomal protein L28 [Streptococcus pyogenes M1 GAS]
 gi|19746812|ref|NP_607948.1| 50S ribosomal protein L28 [Streptococcus pyogenes MGAS8232]
 gi|21911165|ref|NP_665433.1| 50S ribosomal protein L28 [Streptococcus pyogenes MGAS315]
 gi|28895150|ref|NP_801500.1| 50S ribosomal protein L28 [Streptococcus pyogenes SSI-1]
 gi|50914961|ref|YP_060933.1| 50S ribosomal protein L28 [Streptococcus pyogenes MGAS10394]
 gi|71904258|ref|YP_281061.1| 50S ribosomal protein L28 [Streptococcus pyogenes MGAS6180]
 gi|71911419|ref|YP_282969.1| 50S ribosomal protein L28 [Streptococcus pyogenes MGAS5005]
 gi|94989239|ref|YP_597340.1| 50S ribosomal protein L28 [Streptococcus pyogenes MGAS9429]
 gi|94991184|ref|YP_599284.1| 50S ribosomal protein L28 [Streptococcus pyogenes MGAS10270]
 gi|94993127|ref|YP_601226.1| 50S ribosomal protein L28 [Streptococcus pyogenes MGAS2096]
 gi|94995058|ref|YP_603156.1| 50S ribosomal protein L28 [Streptococcus pyogenes MGAS10750]
 gi|139473123|ref|YP_001127838.1| 50S ribosomal protein L28 [Streptococcus pyogenes str. Manfredo]
 gi|195978814|ref|YP_002124058.1| 50S ribosomal protein L28 [Streptococcus equi subsp.
          zooepidemicus MGCS10565]
 gi|209560041|ref|YP_002286513.1| 50S ribosomal protein L28 [Streptococcus pyogenes NZ131]
 gi|225867869|ref|YP_002743817.1| 50S ribosomal protein L28 [Streptococcus equi subsp.
          zooepidemicus]
 gi|225871217|ref|YP_002747164.1| 50S ribosomal protein L28 [Streptococcus equi subsp. equi 4047]
 gi|251781759|ref|YP_002996061.1| 50S ribosomal protein L28 [Streptococcus dysgalactiae subsp.
          equisimilis GGS_124]
 gi|306826665|ref|ZP_07459968.1| 50S ribosomal protein L28 [Streptococcus pyogenes ATCC 10782]
 gi|54039153|sp|P66158|RL28_STRP3 RecName: Full=50S ribosomal protein L28
 gi|54039154|sp|P66159|RL28_STRP8 RecName: Full=50S ribosomal protein L28
 gi|54041853|sp|P66157|RL28_STRP1 RecName: Full=50S ribosomal protein L28
 gi|67461343|sp|Q5XA13|RL28_STRP6 RecName: Full=50S ribosomal protein L28
 gi|123639246|sp|Q48RF4|RL28_STRPM RecName: Full=50S ribosomal protein L28
 gi|166228157|sp|Q1J9X9|RL28_STRPB RecName: Full=50S ribosomal protein L28
 gi|166228158|sp|Q1JK27|RL28_STRPC RecName: Full=50S ribosomal protein L28
 gi|166228159|sp|Q1JF19|RL28_STRPD RecName: Full=50S ribosomal protein L28
 gi|166228160|sp|Q1J4X4|RL28_STRPF RecName: Full=50S ribosomal protein L28
 gi|166228161|sp|A2RCL6|RL28_STRPG RecName: Full=50S ribosomal protein L28
 gi|226699167|sp|B4U4X8|RL28_STREM RecName: Full=50S ribosomal protein L28
 gi|226699173|sp|B5XIF6|RL28_STRPZ RecName: Full=50S ribosomal protein L28
 gi|254801377|sp|C0M8K2|RL28_STRE4 RecName: Full=50S ribosomal protein L28
 gi|259646750|sp|C0MFR4|RL28_STRS7 RecName: Full=50S ribosomal protein L28
 gi|13622921|gb|AAK34599.1| 50S ribosomal protein L28 [Streptococcus pyogenes M1 GAS]
 gi|15425743|dbj|BAB64349.1| ribosome protein L28 [Streptococcus pyogenes]
 gi|19749048|gb|AAL98447.1| 50S ribosomal protein L28 [Streptococcus pyogenes MGAS8232]
 gi|21905376|gb|AAM80236.1| 50S ribosomal protein L28 [Streptococcus pyogenes MGAS315]
 gi|28810395|dbj|BAC63333.1| 50S ribosomal protein L28 [Streptococcus pyogenes SSI-1]
 gi|50904035|gb|AAT87750.1| LSU ribosomal protein L28P [Streptococcus pyogenes MGAS10394]
 gi|71803353|gb|AAX72706.1| LSU ribosomal protein L28P [Streptococcus pyogenes MGAS6180]
 gi|71854201|gb|AAZ52224.1| LSU ribosomal protein L28P [Streptococcus pyogenes MGAS5005]
 gi|94542747|gb|ABF32796.1| LSU ribosomal protein L28P [Streptococcus pyogenes MGAS9429]
 gi|94544692|gb|ABF34740.1| LSU ribosomal protein L28P [Streptococcus pyogenes MGAS10270]
 gi|94546635|gb|ABF36682.1| LSU ribosomal protein L28P [Streptococcus pyogenes MGAS2096]
 gi|94548566|gb|ABF38612.1| LSU ribosomal protein L28P [Streptococcus pyogenes MGAS10750]
 gi|134271369|emb|CAM29589.1| 50S ribosomal protein L28 [Streptococcus pyogenes str. Manfredo]
 gi|195975519|gb|ACG63045.1| 50S ribosomal protein L28 RpmB [Streptococcus equi subsp.
          zooepidemicus MGCS10565]
 gi|209541242|gb|ACI61818.1| LSU ribosomal protein L28p [Streptococcus pyogenes NZ131]
 gi|225700621|emb|CAW95165.1| 50S ribosomal protein L28 [Streptococcus equi subsp. equi 4047]
 gi|225701145|emb|CAW98026.1| 50S ribosomal protein L28 [Streptococcus equi subsp.
          zooepidemicus]
 gi|242390388|dbj|BAH80847.1| 50S ribosomal protein L28 [Streptococcus dysgalactiae subsp.
          equisimilis GGS_124]
 gi|304431113|gb|EFM34119.1| 50S ribosomal protein L28 [Streptococcus pyogenes ATCC 10782]
 gi|322411097|gb|EFY02005.1| 50S ribosomal protein L28 [Streptococcus dysgalactiae subsp.
          dysgalactiae ATCC 27957]
 gi|323126564|gb|ADX23861.1| 50S ribosomal protein L28 [Streptococcus dysgalactiae subsp.
          equisimilis ATCC 12394]
          Length = 62

 Score = 43.1 bits (100), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 39/63 (61%), Gaps = 4/63 (6%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS-- 58
          M++VC  T +  +SGN  SHA N+T+R   PNL ++T++ D   +K  +  S  AL+S  
Sbjct: 1  MAKVCYFTGRKTVSGNNRSHAMNQTKRTVKPNLQKVTILVDGKPKK--VWASARALKSGK 58

Query: 59 VER 61
          VER
Sbjct: 59 VER 61


>gi|238927485|ref|ZP_04659245.1| ribosomal protein L28 [Selenomonas flueggei ATCC 43531]
 gi|238884767|gb|EEQ48405.1| ribosomal protein L28 [Selenomonas flueggei ATCC 43531]
          Length = 63

 Score = 43.1 bits (100), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 28/36 (77%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRI 36
          M+ VCE+  K +MSGN VSH++ KT+R++ PN+ R+
Sbjct: 1  MASVCEVCGKGMMSGNNVSHSHVKTKRKWKPNIQRV 36


>gi|221632124|ref|YP_002521345.1| 50S ribosomal protein L28 [Thermomicrobium roseum DSM 5159]
 gi|254801384|sp|B9L2A7|RL28_THERP RecName: Full=50S ribosomal protein L28
 gi|221156171|gb|ACM05298.1| ribosomal protein L28 [Thermomicrobium roseum DSM 5159]
          Length = 63

 Score = 43.1 bits (100), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 39/60 (65%), Gaps = 2/60 (3%)

Query: 4  VCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQG 63
          +CEL  K  M G+ VSH+N KT R+F PN+ R+T+I + + ++  +RI    LR++ ++ 
Sbjct: 3  MCELCGKKPMFGHNVSHSNRKTNRKFKPNVQRVTVILNGVPKR--MRICTRCLRTLYKEA 60


>gi|304404151|ref|ZP_07385813.1| ribosomal protein L28 [Paenibacillus curdlanolyticus YK9]
 gi|304347129|gb|EFM12961.1| ribosomal protein L28 [Paenibacillus curdlanolyticus YK9]
          Length = 62

 Score = 43.1 bits (100), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS 58
          MSR C +T K   +GN VSHANNK RR +  N+ ++ ++ D   +  ++ +S  AL+S
Sbjct: 1  MSRKCAITGKAPGTGNHVSHANNKNRRSWGVNVQKVRILVD--GKPKRVWVSARALKS 56


>gi|118580811|ref|YP_902061.1| 50S ribosomal protein L28 [Pelobacter propionicus DSM 2379]
 gi|166226596|sp|A1ARN3|RL28_PELPD RecName: Full=50S ribosomal protein L28
 gi|118503521|gb|ABL00004.1| LSU ribosomal protein L28P [Pelobacter propionicus DSM 2379]
          Length = 63

 Score = 43.1 bits (100), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 25/39 (64%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLI 39
          MSR+C +  K    GN VSHANNKTR  + PNL +I  +
Sbjct: 1  MSRICAICGKGPSFGNNVSHANNKTRTVWYPNLQKIKAV 39


>gi|304437378|ref|ZP_07397337.1| 50S ribosomal protein L28 [Selenomonas sp. oral taxon 149 str.
          67H29BP]
 gi|304369634|gb|EFM23300.1| 50S ribosomal protein L28 [Selenomonas sp. oral taxon 149 str.
          67H29BP]
          Length = 63

 Score = 43.1 bits (100), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 28/36 (77%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRI 36
          M+ VCE+  K +MSGN VSH++ KT+R++ PN+ R+
Sbjct: 1  MASVCEVCGKGMMSGNNVSHSHVKTKRKWKPNIQRV 36


>gi|78357468|ref|YP_388917.1| 50S ribosomal protein L28 [Desulfovibrio desulfuricans subsp.
          desulfuricans str. G20]
 gi|123552043|sp|Q30YM4|RL28_DESDG RecName: Full=50S ribosomal protein L28
 gi|78219873|gb|ABB39222.1| LSU ribosomal protein L28P [Desulfovibrio desulfuricans subsp.
          desulfuricans str. G20]
          Length = 69

 Score = 43.1 bits (100), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 18/33 (54%), Positives = 23/33 (69%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNL 33
          M + CE   K   +GN VSH+N KT+RRF+PNL
Sbjct: 1  MGKQCEFCGKKPQTGNNVSHSNIKTKRRFMPNL 33


>gi|302037986|ref|YP_003798308.1| 50S ribosomal protein L28 [Candidatus Nitrospira defluvii]
 gi|300606050|emb|CBK42383.1| 50S ribosomal protein L28 [Candidatus Nitrospira defluvii]
          Length = 63

 Score = 43.1 bits (100), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 20/36 (55%), Positives = 25/36 (69%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRI 36
          M+  C+L  K   +GN VSHANNKT+R F PNL R+
Sbjct: 1  MAFACDLCGKKHQTGNNVSHANNKTKRVFNPNLQRV 36


>gi|197119577|ref|YP_002140004.1| 50S ribosomal protein L28 [Geobacter bemidjiensis Bem]
 gi|253699684|ref|YP_003020873.1| 50S ribosomal protein L28 [Geobacter sp. M21]
 gi|322420741|ref|YP_004199964.1| 50S ribosomal protein L28 [Geobacter sp. M18]
 gi|226694924|sp|B5E9N4|RL28_GEOBB RecName: Full=50S ribosomal protein L28
 gi|259646739|sp|C6E2G9|RL28_GEOSM RecName: Full=50S ribosomal protein L28
 gi|197088937|gb|ACH40208.1| ribosomal protein L28 [Geobacter bemidjiensis Bem]
 gi|251774534|gb|ACT17115.1| ribosomal protein L28 [Geobacter sp. M21]
 gi|320127128|gb|ADW14688.1| ribosomal protein L28 [Geobacter sp. M18]
          Length = 63

 Score = 43.1 bits (100), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 20/41 (48%), Positives = 27/41 (65%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISD 41
          MSR+CE+  K    GN VSHANNKT + + PNL +I  + +
Sbjct: 1  MSRICEICGKGPSFGNNVSHANNKTSKIWRPNLQKIKAVKN 41


>gi|160915445|ref|ZP_02077656.1| hypothetical protein EUBDOL_01453 [Eubacterium dolichum DSM 3991]
 gi|158432565|gb|EDP10854.1| hypothetical protein EUBDOL_01453 [Eubacterium dolichum DSM 3991]
          Length = 63

 Score = 42.7 bits (99), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 40/65 (61%), Gaps = 2/65 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS+VC +T K  +SGNK SH+   TRR +  NL ++ +I D   Q   +RIS  AL++++
Sbjct: 1  MSKVCAITGKGPLSGNKRSHSMRATRRNWNVNLQKVKVIVDGKPQ--TIRISARALKTLK 58

Query: 61 RQGGL 65
           +  +
Sbjct: 59 NKNAI 63


>gi|255321506|ref|ZP_05362664.1| ribosomal protein L28 [Campylobacter showae RM3277]
 gi|255301362|gb|EET80621.1| ribosomal protein L28 [Campylobacter showae RM3277]
          Length = 51

 Score = 42.7 bits (99), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 35/52 (67%), Gaps = 5/52 (9%)

Query: 13 MSGNKVSHANNKTRRRFLPNL--CRITLISDIMEQKYQLRISKCALRSVERQ 62
          M GN VSHA N+T+RRFLPNL   R+TL  D   +K  ++++   LR++ +Q
Sbjct: 1  MVGNNVSHAKNRTKRRFLPNLRTIRVTL-EDGTTRK--IKVAASTLRTMRKQ 49


>gi|242769719|ref|XP_002341828.1| 50S ribosomal protein L24 [Talaromyces stipitatus ATCC 10500]
 gi|218725024|gb|EED24441.1| 50S ribosomal protein L24 [Talaromyces stipitatus ATCC 10500]
          Length = 247

 Score = 42.7 bits (99), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 39/61 (63%), Gaps = 2/61 (3%)

Query: 11  TVMSGNKVSHANNK--TRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRF 68
           T+  GNK+S   NK  TRR + PN+    L S+ + ++  +++++ ALR++ + GGLD +
Sbjct: 75  TISFGNKISKGRNKGKTRRSWKPNVRWKKLPSEALGEEVFVKLTRKALRTIRKCGGLDNY 134

Query: 69  L 69
           L
Sbjct: 135 L 135


>gi|298385681|ref|ZP_06995239.1| ribosomal protein L28 [Bacteroides sp. 1_1_14]
 gi|298261822|gb|EFI04688.1| ribosomal protein L28 [Bacteroides sp. 1_1_14]
          Length = 86

 Score = 42.7 bits (99), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 43/74 (58%), Gaps = 5/74 (6%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCA--LRS 58
          MS++C++T K  M GN VSH+  +T+R F  NL         +EQ   + +S CA  LR 
Sbjct: 1  MSKICQITGKKAMIGNNVSHSKRRTKRNFDLNLFNKKFY--YVEQDCWISLSLCANGLRI 58

Query: 59 VERQGGLDRFLSNS 72
          + ++ GLD  L+++
Sbjct: 59 INKK-GLDAALNDA 71


>gi|294656483|ref|XP_458758.2| DEHA2D06842p [Debaryomyces hansenii CBS767]
 gi|199431508|emb|CAG86902.2| DEHA2D06842p [Debaryomyces hansenii]
          Length = 269

 Score = 42.7 bits (99), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 42/80 (52%), Gaps = 11/80 (13%)

Query: 19  SHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFLSNSKKENLS 78
           S + NK+ R   PN+ +  L S+ + +    R+S   LR++ R+GGLD +L   K     
Sbjct: 110 SESKNKSLRAHKPNIVKAKLWSETLNKTIATRVSTTVLRTITREGGLDNYLLKDK----P 165

Query: 79  ARMRT-------LRSQILKK 91
           AR++T       L+  I+KK
Sbjct: 166 ARVKTMGLKGWNLKYDIMKK 185


>gi|322388613|ref|ZP_08062213.1| 50S ribosomal protein L28 [Streptococcus infantis ATCC 700779]
 gi|321140533|gb|EFX36038.1| 50S ribosomal protein L28 [Streptococcus infantis ATCC 700779]
          Length = 62

 Score = 42.7 bits (99), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 39/63 (61%), Gaps = 4/63 (6%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS-- 58
          M++VC  T +  +SGN  SHA N+T+R   PNL ++T++ D   +K  +  S  AL+S  
Sbjct: 1  MAKVCYFTGRKTVSGNNRSHAMNQTKRSVKPNLQKVTVLIDGKPKK--VWASARALKSGK 58

Query: 59 VER 61
          VER
Sbjct: 59 VER 61


>gi|150007342|ref|YP_001302085.1| 50S ribosomal protein L28 [Parabacteroides distasonis ATCC 8503]
 gi|256839632|ref|ZP_05545141.1| ribosomal protein L28 [Parabacteroides sp. D13]
 gi|262382084|ref|ZP_06075222.1| ribosomal protein L28 [Bacteroides sp. 2_1_33B]
 gi|298375329|ref|ZP_06985286.1| ribosomal protein L28 [Bacteroides sp. 3_1_19]
 gi|301310657|ref|ZP_07216596.1| ribosomal protein L28 [Bacteroides sp. 20_3]
 gi|166226594|sp|A6L9U9|RL28_PARD8 RecName: Full=50S ribosomal protein L28
 gi|149935766|gb|ABR42463.1| ribosomal protein L28 [Parabacteroides distasonis ATCC 8503]
 gi|256738562|gb|EEU51887.1| ribosomal protein L28 [Parabacteroides sp. D13]
 gi|262297261|gb|EEY85191.1| ribosomal protein L28 [Bacteroides sp. 2_1_33B]
 gi|298267829|gb|EFI09485.1| ribosomal protein L28 [Bacteroides sp. 3_1_19]
 gi|300832231|gb|EFK62862.1| ribosomal protein L28 [Bacteroides sp. 20_3]
          Length = 79

 Score = 42.7 bits (99), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 34/63 (53%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS++C++T K  M GN VSH+  +T+R+F  NL          +    L IS   LR++ 
Sbjct: 1  MSKICQITGKRAMVGNNVSHSKRRTKRKFNVNLFTKKFYWVEQDCWVSLNISAAGLRTIN 60

Query: 61 RQG 63
          + G
Sbjct: 61 KLG 63


>gi|15900358|ref|NP_344962.1| 50S ribosomal protein L28 [Streptococcus pneumoniae TIGR4]
 gi|15902442|ref|NP_357992.1| 50S ribosomal protein L28 [Streptococcus pneumoniae R6]
 gi|111657905|ref|ZP_01408616.1| hypothetical protein SpneT_02000914 [Streptococcus pneumoniae
          TIGR4]
 gi|116515847|ref|YP_815911.1| 50S ribosomal protein L28 [Streptococcus pneumoniae D39]
 gi|125718769|ref|YP_001035902.1| 50S ribosomal protein L28 [Streptococcus sanguinis SK36]
 gi|146317996|ref|YP_001197708.1| 50S ribosomal protein L28 [Streptococcus suis 05ZYH33]
 gi|146320178|ref|YP_001199889.1| 50S ribosomal protein L28 [Streptococcus suis 98HAH33]
 gi|148983835|ref|ZP_01817154.1| 50S ribosomal protein L28, putative [Streptococcus pneumoniae
          SP3-BS71]
 gi|148988192|ref|ZP_01819655.1| 50S ribosomal protein L28, putative [Streptococcus pneumoniae
          SP6-BS73]
 gi|148993983|ref|ZP_01823353.1| 50S ribosomal protein L28, putative [Streptococcus pneumoniae
          SP9-BS68]
 gi|148996843|ref|ZP_01824561.1| 50S ribosomal protein L28, putative [Streptococcus pneumoniae
          SP11-BS70]
 gi|149003538|ref|ZP_01828412.1| 50S ribosomal protein L28, putative [Streptococcus pneumoniae
          SP14-BS69]
 gi|149006422|ref|ZP_01830134.1| 50S ribosomal protein L28, putative [Streptococcus pneumoniae
          SP18-BS74]
 gi|149012192|ref|ZP_01833301.1| 50S ribosomal protein L28, putative [Streptococcus pneumoniae
          SP19-BS75]
 gi|149023727|ref|ZP_01836207.1| 50S ribosomal protein L28, putative [Streptococcus pneumoniae
          SP23-BS72]
 gi|157150697|ref|YP_001451009.1| 50S ribosomal protein L28 [Streptococcus gordonii str. Challis
          substr. CH1]
 gi|168482680|ref|ZP_02707632.1| ribosomal protein L28 [Streptococcus pneumoniae CDC1873-00]
 gi|168485574|ref|ZP_02710082.1| ribosomal protein L28 [Streptococcus pneumoniae CDC1087-00]
 gi|168488130|ref|ZP_02712329.1| ribosomal protein L28 [Streptococcus pneumoniae SP195]
 gi|168490646|ref|ZP_02714789.1| ribosomal protein L28 [Streptococcus pneumoniae CDC0288-04]
 gi|168495045|ref|ZP_02719188.1| ribosomal protein L28 [Streptococcus pneumoniae CDC3059-06]
 gi|168576841|ref|ZP_02722691.1| ribosomal protein L28 [Streptococcus pneumoniae MLV-016]
 gi|169834016|ref|YP_001693944.1| 50S ribosomal protein L28 [Streptococcus pneumoniae Hungary19A-6]
 gi|182683406|ref|YP_001835153.1| 50S ribosomal protein L28 [Streptococcus pneumoniae CGSP14]
 gi|194396811|ref|YP_002037118.1| 50S ribosomal protein L28 [Streptococcus pneumoniae G54]
 gi|221231304|ref|YP_002510456.1| 50S ribosomal protein L28 [Streptococcus pneumoniae ATCC 700669]
 gi|225854013|ref|YP_002735525.1| 50S ribosomal protein L28 [Streptococcus pneumoniae JJA]
 gi|225856169|ref|YP_002737680.1| 50S ribosomal protein L28 [Streptococcus pneumoniae P1031]
 gi|225858291|ref|YP_002739801.1| 50S ribosomal protein L28 [Streptococcus pneumoniae 70585]
 gi|225860463|ref|YP_002741972.1| 50S ribosomal protein L28 [Streptococcus pneumoniae Taiwan19F-14]
 gi|237650346|ref|ZP_04524598.1| 50S ribosomal protein L28 [Streptococcus pneumoniae CCRI 1974]
 gi|237822034|ref|ZP_04597879.1| 50S ribosomal protein L28 [Streptococcus pneumoniae CCRI 1974M2]
 gi|253751212|ref|YP_003024353.1| 50S ribosomal protein L28 [Streptococcus suis SC84]
 gi|253753113|ref|YP_003026253.1| 50S ribosomal protein L28 [Streptococcus suis P1/7]
 gi|253754935|ref|YP_003028075.1| 50S ribosomal protein L28 [Streptococcus suis BM407]
 gi|262283297|ref|ZP_06061063.1| ribosomal protein L28 [Streptococcus sp. 2_1_36FAA]
 gi|270293410|ref|ZP_06199619.1| conserved domain protein [Streptococcus sp. M143]
 gi|289168659|ref|YP_003446928.1| 50S ribosomal protein L28 [Streptococcus mitis B6]
 gi|293364271|ref|ZP_06610997.1| 50S ribosomal protein L28 [Streptococcus oralis ATCC 35037]
 gi|296877399|ref|ZP_06901437.1| 50S ribosomal protein L28 [Streptococcus parasanguinis ATCC
          15912]
 gi|298229391|ref|ZP_06963072.1| 50S ribosomal protein L28 [Streptococcus pneumoniae str. Canada
          MDR_19F]
 gi|298254599|ref|ZP_06978185.1| 50S ribosomal protein L28 [Streptococcus pneumoniae str. Canada
          MDR_19A]
 gi|298502236|ref|YP_003724176.1| 50S ribosomal protein L28 [Streptococcus pneumoniae TCH8431/19A]
 gi|303255938|ref|ZP_07341968.1| 50S ribosomal protein L28 [Streptococcus pneumoniae BS455]
 gi|303259514|ref|ZP_07345491.1| 50S ribosomal protein L28 [Streptococcus pneumoniae SP-BS293]
 gi|303262378|ref|ZP_07348321.1| 50S ribosomal protein L28 [Streptococcus pneumoniae SP14-BS292]
 gi|303264794|ref|ZP_07350711.1| 50S ribosomal protein L28 [Streptococcus pneumoniae BS397]
 gi|303267374|ref|ZP_07353232.1| 50S ribosomal protein L28 [Streptococcus pneumoniae BS457]
 gi|303269692|ref|ZP_07355448.1| 50S ribosomal protein L28 [Streptococcus pneumoniae BS458]
 gi|306825887|ref|ZP_07459226.1| 50S ribosomal protein L28 [Streptococcus sp. oral taxon 071 str.
          73H25AP]
 gi|306828860|ref|ZP_07462052.1| 50S ribosomal protein L28 [Streptococcus mitis ATCC 6249]
 gi|307067085|ref|YP_003876051.1| hypothetical protein SPAP_0456 [Streptococcus pneumoniae AP200]
 gi|307126656|ref|YP_003878687.1| 50S ribosomal protein L28 [Streptococcus pneumoniae 670-6B]
 gi|307702823|ref|ZP_07639772.1| ribosomal protein L28 [Streptococcus oralis ATCC 35037]
 gi|307703994|ref|ZP_07640928.1| ribosomal protein L28 [Streptococcus mitis SK597]
 gi|307707991|ref|ZP_07644465.1| ribosomal protein L28 [Streptococcus mitis NCTC 12261]
 gi|307710407|ref|ZP_07646846.1| ribosomal protein L28 [Streptococcus mitis SK564]
 gi|307711319|ref|ZP_07647739.1| ribosomal protein L28 [Streptococcus mitis SK321]
 gi|309799500|ref|ZP_07693730.1| ribosomal protein L28 [Streptococcus infantis SK1302]
 gi|312868090|ref|ZP_07728294.1| ribosomal protein L28 [Streptococcus parasanguinis F0405]
 gi|315612499|ref|ZP_07887412.1| 50S ribosomal protein L28 [Streptococcus sanguinis ATCC 49296]
 gi|319945603|ref|ZP_08019855.1| 50S ribosomal protein L28 [Streptococcus australis ATCC 700641]
 gi|322374961|ref|ZP_08049475.1| ribosomal protein L28 [Streptococcus sp. C300]
 gi|322377160|ref|ZP_08051652.1| ribosomal protein L28 [Streptococcus sp. M334]
 gi|322386816|ref|ZP_08060440.1| 50S ribosomal protein L28 [Streptococcus cristatus ATCC 51100]
 gi|322390955|ref|ZP_08064461.1| 50S ribosomal protein L28 [Streptococcus parasanguinis ATCC 903]
 gi|323350433|ref|ZP_08086096.1| 50S ribosomal protein L28 [Streptococcus sanguinis VMC66]
 gi|330832176|ref|YP_004401001.1| 50S ribosomal protein L28 [Streptococcus suis ST3]
 gi|331267054|ref|YP_004326684.1| 50S ribosomal protein L28 [Streptococcus oralis Uo5]
 gi|54039152|sp|P66156|RL28_STRR6 RecName: Full=50S ribosomal protein L28
 gi|54041852|sp|P66155|RL28_STRPN RecName: Full=50S ribosomal protein L28
 gi|122279203|sp|Q04M37|RL28_STRP2 RecName: Full=50S ribosomal protein L28
 gi|166228162|sp|A4VZF0|RL28_STRS2 RecName: Full=50S ribosomal protein L28
 gi|166228163|sp|A3CQ97|RL28_STRSV RecName: Full=50S ribosomal protein L28
 gi|166228164|sp|A4VT69|RL28_STRSY RecName: Full=50S ribosomal protein L28
 gi|189029459|sp|A8AYZ9|RL28_STRGC RecName: Full=50S ribosomal protein L28
 gi|226699170|sp|B5E1Q0|RL28_STRP4 RecName: Full=50S ribosomal protein L28
 gi|226699171|sp|B1I9N1|RL28_STRPI RecName: Full=50S ribosomal protein L28
 gi|226699172|sp|B2ILY3|RL28_STRPS RecName: Full=50S ribosomal protein L28
 gi|254801378|sp|C1C5H5|RL28_STRP7 RecName: Full=50S ribosomal protein L28
 gi|254801379|sp|B8ZLK5|RL28_STRPJ RecName: Full=50S ribosomal protein L28
 gi|254801381|sp|C1CCK4|RL28_STRZJ RecName: Full=50S ribosomal protein L28
 gi|254801382|sp|C1CIU2|RL28_STRZP RecName: Full=50S ribosomal protein L28
 gi|254801383|sp|C1CPV0|RL28_STRZT RecName: Full=50S ribosomal protein L28
 gi|14971910|gb|AAK74602.1| ribosomal protein L28 [Streptococcus pneumoniae TIGR4]
 gi|15457960|gb|AAK99202.1| 50S Ribosomal protein L28 [Streptococcus pneumoniae R6]
 gi|116076423|gb|ABJ54143.1| ribosomal protein L28 [Streptococcus pneumoniae D39]
 gi|125498686|gb|ABN45352.1| 50S ribosomal protein L28, putative [Streptococcus sanguinis
          SK36]
 gi|145688802|gb|ABP89308.1| Ribosomal protein L28 [Streptococcus suis 05ZYH33]
 gi|145690984|gb|ABP91489.1| Ribosomal protein L28 [Streptococcus suis 98HAH33]
 gi|147757418|gb|EDK64457.1| 50S ribosomal protein L28, putative [Streptococcus pneumoniae
          SP11-BS70]
 gi|147758474|gb|EDK65473.1| 50S ribosomal protein L28, putative [Streptococcus pneumoniae
          SP14-BS69]
 gi|147762199|gb|EDK69161.1| 50S ribosomal protein L28, putative [Streptococcus pneumoniae
          SP18-BS74]
 gi|147763794|gb|EDK70728.1| 50S ribosomal protein L28, putative [Streptococcus pneumoniae
          SP19-BS75]
 gi|147923982|gb|EDK75094.1| 50S ribosomal protein L28, putative [Streptococcus pneumoniae
          SP3-BS71]
 gi|147926656|gb|EDK77729.1| 50S ribosomal protein L28, putative [Streptococcus pneumoniae
          SP6-BS73]
 gi|147927572|gb|EDK78599.1| 50S ribosomal protein L28, putative [Streptococcus pneumoniae
          SP9-BS68]
 gi|147929664|gb|EDK80656.1| 50S ribosomal protein L28, putative [Streptococcus pneumoniae
          SP23-BS72]
 gi|157075491|gb|ABV10174.1| ribosomal protein L28 [Streptococcus gordonii str. Challis
          substr. CH1]
 gi|168996518|gb|ACA37130.1| ribosomal protein L28 [Streptococcus pneumoniae Hungary19A-6]
 gi|172043875|gb|EDT51921.1| ribosomal protein L28 [Streptococcus pneumoniae CDC1873-00]
 gi|182628740|gb|ACB89688.1| 50S ribosomal protein L28 [Streptococcus pneumoniae CGSP14]
 gi|183571219|gb|EDT91747.1| ribosomal protein L28 [Streptococcus pneumoniae CDC1087-00]
 gi|183573024|gb|EDT93552.1| ribosomal protein L28 [Streptococcus pneumoniae SP195]
 gi|183574977|gb|EDT95505.1| ribosomal protein L28 [Streptococcus pneumoniae CDC0288-04]
 gi|183575101|gb|EDT95629.1| ribosomal protein L28 [Streptococcus pneumoniae CDC3059-06]
 gi|183577448|gb|EDT97976.1| ribosomal protein L28 [Streptococcus pneumoniae MLV-016]
 gi|194356478|gb|ACF54926.1| ribosomal protein L28 [Streptococcus pneumoniae G54]
 gi|220673764|emb|CAR68263.1| 50S ribosomal protein L28 [Streptococcus pneumoniae ATCC 700669]
 gi|225720544|gb|ACO16398.1| ribosomal protein L28 [Streptococcus pneumoniae 70585]
 gi|225724006|gb|ACO19859.1| ribosomal protein L28 [Streptococcus pneumoniae JJA]
 gi|225725122|gb|ACO20974.1| ribosomal protein L28 [Streptococcus pneumoniae P1031]
 gi|225726933|gb|ACO22784.1| ribosomal protein L28 [Streptococcus pneumoniae Taiwan19F-14]
 gi|251815501|emb|CAZ51079.1| 50S ribosomal protein L28 [Streptococcus suis SC84]
 gi|251817399|emb|CAZ55135.1| 50S ribosomal protein L28 [Streptococcus suis BM407]
 gi|251819358|emb|CAR44749.1| 50S ribosomal protein L28 [Streptococcus suis P1/7]
 gi|262260788|gb|EEY79488.1| ribosomal protein L28 [Streptococcus sp. 2_1_36FAA]
 gi|270278259|gb|EFA24107.1| conserved domain protein [Streptococcus sp. M143]
 gi|288908226|emb|CBJ23068.1| 50S ribosomal protein L28 [Streptococcus mitis B6]
 gi|291317117|gb|EFE57544.1| 50S ribosomal protein L28 [Streptococcus oralis ATCC 35037]
 gi|292557774|gb|ADE30775.1| 50S ribosomal protein L28 [Streptococcus suis GZ1]
 gi|296431612|gb|EFH17421.1| 50S ribosomal protein L28 [Streptococcus parasanguinis ATCC
          15912]
 gi|298237831|gb|ADI68962.1| 50S ribosomal protein L28 [Streptococcus pneumoniae TCH8431/19A]
 gi|301793678|emb|CBW36064.1| 50S ribosomal protein L28 [Streptococcus pneumoniae INV104]
 gi|301799536|emb|CBW32085.1| 50S ribosomal protein L28 [Streptococcus pneumoniae OXC141]
 gi|301801350|emb|CBW34034.1| 50S ribosomal protein L28 [Streptococcus pneumoniae INV200]
 gi|302597113|gb|EFL64229.1| 50S ribosomal protein L28 [Streptococcus pneumoniae BS455]
 gi|302636477|gb|EFL66969.1| 50S ribosomal protein L28 [Streptococcus pneumoniae SP14-BS292]
 gi|302639448|gb|EFL69906.1| 50S ribosomal protein L28 [Streptococcus pneumoniae SP-BS293]
 gi|302640789|gb|EFL71180.1| 50S ribosomal protein L28 [Streptococcus pneumoniae BS458]
 gi|302643107|gb|EFL73396.1| 50S ribosomal protein L28 [Streptococcus pneumoniae BS457]
 gi|302645661|gb|EFL75891.1| 50S ribosomal protein L28 [Streptococcus pneumoniae BS397]
 gi|304429038|gb|EFM32126.1| 50S ribosomal protein L28 [Streptococcus mitis ATCC 6249]
 gi|304432248|gb|EFM35225.1| 50S ribosomal protein L28 [Streptococcus sp. oral taxon 071 str.
          73H25AP]
 gi|306408622|gb|ADM84049.1| hypothetical protein SPAP_0456 [Streptococcus pneumoniae AP200]
 gi|306483718|gb|ADM90587.1| ribosomal protein L28 [Streptococcus pneumoniae 670-6B]
 gi|307615959|gb|EFN95158.1| ribosomal protein L28 [Streptococcus mitis NCTC 12261]
 gi|307616835|gb|EFN96015.1| ribosomal protein L28 [Streptococcus mitis SK321]
 gi|307618819|gb|EFN97956.1| ribosomal protein L28 [Streptococcus mitis SK564]
 gi|307622460|gb|EFO01463.1| ribosomal protein L28 [Streptococcus mitis SK597]
 gi|307623624|gb|EFO02612.1| ribosomal protein L28 [Streptococcus oralis ATCC 35037]
 gi|308116856|gb|EFO54302.1| ribosomal protein L28 [Streptococcus infantis SK1302]
 gi|311096494|gb|EFQ54734.1| ribosomal protein L28 [Streptococcus parasanguinis F0405]
 gi|315315480|gb|EFU63519.1| 50S ribosomal protein L28 [Streptococcus sanguinis ATCC 49296]
 gi|319748202|gb|EFW00444.1| 50S ribosomal protein L28 [Streptococcus australis ATCC 700641]
 gi|319757484|gb|ADV69426.1| 50S ribosomal protein L28 [Streptococcus suis JS14]
 gi|321142330|gb|EFX37802.1| 50S ribosomal protein L28 [Streptococcus parasanguinis ATCC 903]
 gi|321269098|gb|EFX52034.1| 50S ribosomal protein L28 [Streptococcus cristatus ATCC 51100]
 gi|321280461|gb|EFX57500.1| ribosomal protein L28 [Streptococcus sp. C300]
 gi|321281873|gb|EFX58881.1| ribosomal protein L28 [Streptococcus sp. M334]
 gi|322123370|gb|EFX95048.1| 50S ribosomal protein L28 [Streptococcus sanguinis VMC66]
 gi|324989919|gb|EGC21861.1| 50S ribosomal protein L28 [Streptococcus sanguinis SK353]
 gi|324992369|gb|EGC24290.1| 50S ribosomal protein L28 [Streptococcus sanguinis SK405]
 gi|324996108|gb|EGC28019.1| 50S ribosomal protein L28 [Streptococcus sanguinis SK678]
 gi|325686808|gb|EGD28833.1| 50S ribosomal protein L28 [Streptococcus sanguinis SK72]
 gi|325689065|gb|EGD31073.1| 50S ribosomal protein L28 [Streptococcus sanguinis SK115]
 gi|325695625|gb|EGD37525.1| 50S ribosomal protein L28 [Streptococcus sanguinis SK150]
 gi|325697538|gb|EGD39424.1| 50S ribosomal protein L28 [Streptococcus sanguinis SK160]
 gi|326683726|emb|CBZ01344.1| 50S ribosomal protein L28 [Streptococcus oralis Uo5]
 gi|327390850|gb|EGE89190.1| ribosomal protein L28 [Streptococcus pneumoniae GA04375]
 gi|327460598|gb|EGF06933.1| 50S ribosomal protein L28 [Streptococcus sanguinis SK1]
 gi|327462849|gb|EGF09171.1| 50S ribosomal protein L28 [Streptococcus sanguinis SK1057]
 gi|327468276|gb|EGF13761.1| 50S ribosomal protein L28 [Streptococcus sanguinis SK330]
 gi|327472328|gb|EGF17759.1| 50S ribosomal protein L28 [Streptococcus sanguinis SK408]
 gi|327488955|gb|EGF20752.1| 50S ribosomal protein L28 [Streptococcus sanguinis SK1058]
 gi|328944956|gb|EGG39114.1| 50S ribosomal protein L28 [Streptococcus sanguinis SK1087]
 gi|329306399|gb|AEB80815.1| 50S ribosomal protein L28 [Streptococcus suis ST3]
 gi|332075284|gb|EGI85754.1| ribosomal protein L28 [Streptococcus pneumoniae GA17570]
 gi|332076886|gb|EGI87348.1| ribosomal protein L28 [Streptococcus pneumoniae GA17545]
 gi|332077726|gb|EGI88187.1| ribosomal protein L28 [Streptococcus pneumoniae GA41301]
 gi|332202347|gb|EGJ16416.1| ribosomal protein L28 [Streptococcus pneumoniae GA41317]
 gi|332203611|gb|EGJ17678.1| ribosomal protein L28 [Streptococcus pneumoniae GA47368]
 gi|332204467|gb|EGJ18532.1| ribosomal protein L28 [Streptococcus pneumoniae GA47901]
 gi|332359217|gb|EGJ37038.1| 50S ribosomal protein L28 [Streptococcus sanguinis SK49]
 gi|332359835|gb|EGJ37649.1| 50S ribosomal protein L28 [Streptococcus sanguinis SK1056]
 gi|332365513|gb|EGJ43273.1| 50S ribosomal protein L28 [Streptococcus sanguinis SK1059]
 gi|332366206|gb|EGJ43961.1| 50S ribosomal protein L28 [Streptococcus sanguinis SK355]
          Length = 62

 Score = 42.7 bits (99), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 39/63 (61%), Gaps = 4/63 (6%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS-- 58
          M++VC  T +  +SGN  SHA N+T+R   PNL ++T++ D   +K  +  S  AL+S  
Sbjct: 1  MAKVCYFTGRKTVSGNNRSHAMNQTKRAVKPNLQKVTVLIDGKPKK--VWASARALKSGK 58

Query: 59 VER 61
          VER
Sbjct: 59 VER 61


>gi|291286451|ref|YP_003503267.1| 50S ribosomal protein L28 [Denitrovibrio acetiphilus DSM 12809]
 gi|290883611|gb|ADD67311.1| ribosomal protein L28 [Denitrovibrio acetiphilus DSM 12809]
          Length = 62

 Score = 42.7 bits (99), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 28/39 (71%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLI 39
          M++ CE+  K  M G+++SHA+N +RR F PN+ RI +I
Sbjct: 1  MAKRCEICGKGPMFGHQISHAHNVSRRVFYPNVHRIRVI 39


>gi|283769592|ref|ZP_06342488.1| ribosomal protein L28 [Bulleidia extructa W1219]
 gi|283103860|gb|EFC05246.1| ribosomal protein L28 [Bulleidia extructa W1219]
          Length = 67

 Score = 42.7 bits (99), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 25/60 (41%), Positives = 38/60 (63%), Gaps = 2/60 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC ++ K  + GNK SH+   TRR++  NL ++ +I D   Q   LRIS  AL++++
Sbjct: 1  MSRVCTVSGKKALYGNKRSHSLRATRRKWNVNLQKVHMIVDGKPQ--TLRISARALKTLK 58


>gi|171677089|ref|XP_001903496.1| hypothetical protein [Podospora anserina S mat+]
 gi|170936612|emb|CAP61271.1| unnamed protein product [Podospora anserina S mat+]
          Length = 366

 Score = 42.7 bits (99), Expect = 0.018,   Method: Composition-based stats.
 Identities = 24/60 (40%), Positives = 35/60 (58%), Gaps = 1/60 (1%)

Query: 11  TVMSGNKVSHANN-KTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFL 69
           T+  GN VS  N  KTRR + PN+ R  L S  +    Q R++   LR++++ GGLD +L
Sbjct: 161 TIRYGNNVSEKNEIKTRRTWRPNVHRKRLFSLSLRTWVQTRLTTRVLRTIDKVGGLDEYL 220


>gi|307128561|ref|YP_003880591.1| 50S ribosomal subunit protein L28 [Candidatus Sulcia muelleri
          CARI]
 gi|306483023|gb|ADM89893.1| 50S ribosomal subunit protein L28 [Candidatus Sulcia muelleri
          CARI]
          Length = 73

 Score = 42.7 bits (99), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 25/35 (71%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCR 35
          MS+ CE+T K  + GNKVSHANNK +R F  N+ +
Sbjct: 1  MSKYCEITVKKKIKGNKVSHANNKIKRFFNINISK 35


>gi|255009417|ref|ZP_05281543.1| 50S ribosomal protein L28 [Bacteroides fragilis 3_1_12]
 gi|313147176|ref|ZP_07809369.1| 50S ribosomal protein L28 [Bacteroides fragilis 3_1_12]
 gi|313135943|gb|EFR53303.1| 50S ribosomal protein L28 [Bacteroides fragilis 3_1_12]
          Length = 86

 Score = 42.4 bits (98), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 43/74 (58%), Gaps = 5/74 (6%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCA--LRS 58
          MS++C++T K  M GN VSH+  +T+R F  NL         +EQ   + +S CA  LR 
Sbjct: 1  MSKICQITGKKAMIGNNVSHSKRRTKRTFDLNLFNKKFY--YVEQDCWISLSLCAAGLRI 58

Query: 59 VERQGGLDRFLSNS 72
          + ++ GLD  L+++
Sbjct: 59 INKK-GLDAALNDA 71


>gi|307297644|ref|ZP_07577450.1| ribosomal protein L28 [Thermotogales bacterium mesG1.Ag.4.2]
 gi|306916904|gb|EFN47286.1| ribosomal protein L28 [Thermotogales bacterium mesG1.Ag.4.2]
          Length = 63

 Score = 42.4 bits (98), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 28/41 (68%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISD 41
          MS+VCE+  K+  +GN VSH+N K +R + PN+ ++  + D
Sbjct: 1  MSKVCEICGKSPTTGNMVSHSNKKAKRWWKPNVHKVRAVVD 41


>gi|189465613|ref|ZP_03014398.1| hypothetical protein BACINT_01971 [Bacteroides intestinalis DSM
          17393]
 gi|224540010|ref|ZP_03680549.1| hypothetical protein BACCELL_04922 [Bacteroides cellulosilyticus
          DSM 14838]
 gi|189437887|gb|EDV06872.1| hypothetical protein BACINT_01971 [Bacteroides intestinalis DSM
          17393]
 gi|224518377|gb|EEF87482.1| hypothetical protein BACCELL_04922 [Bacteroides cellulosilyticus
          DSM 14838]
          Length = 86

 Score = 42.4 bits (98), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 43/74 (58%), Gaps = 5/74 (6%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCA--LRS 58
          MS++C++T K  M GN VSH+  +T+R F  NL         +EQ   + +S CA  LR 
Sbjct: 1  MSKICQITGKKAMIGNNVSHSKRRTKRTFDLNLFNKKFY--YVEQDCWISLSICANGLRI 58

Query: 59 VERQGGLDRFLSNS 72
          + ++ GLD  L+++
Sbjct: 59 INKK-GLDAALNDA 71


>gi|161621804|ref|YP_016112.2| 50S ribosomal protein L28 [Mycoplasma mobile 163K]
 gi|67461415|sp|Q6KHM9|RL28_MYCMO RecName: Full=50S ribosomal protein L28
          Length = 65

 Score = 42.4 bits (98), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 25/63 (39%), Positives = 41/63 (65%), Gaps = 1/63 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+R  +LT K  MSGNK SHA N T+R+F  NL +I L++     K ++++S    ++++
Sbjct: 1  MARRDDLTNKGPMSGNKRSHALNATKRKFNLNLQKI-LVTLENGSKVKIKVSAKTAKTLK 59

Query: 61 RQG 63
          +QG
Sbjct: 60 KQG 62


>gi|53713720|ref|YP_099712.1| 50S ribosomal protein L28 [Bacteroides fragilis YCH46]
 gi|60681990|ref|YP_212134.1| 50S ribosomal protein L28 [Bacteroides fragilis NCTC 9343]
 gi|253565668|ref|ZP_04843123.1| 50S ribosomal protein L28 [Bacteroides sp. 3_2_5]
 gi|265764044|ref|ZP_06092612.1| ribosomal protein L28 [Bacteroides sp. 2_1_16]
 gi|67461366|sp|Q64TK1|RL28_BACFR RecName: Full=50S ribosomal protein L28
 gi|81314946|sp|Q5LCF5|RL28_BACFN RecName: Full=50S ribosomal protein L28
 gi|52216585|dbj|BAD49178.1| 50S ribosomal protein L28 [Bacteroides fragilis YCH46]
 gi|60493424|emb|CAH08210.1| 50S ribosomal protein L28 [Bacteroides fragilis NCTC 9343]
 gi|251945947|gb|EES86354.1| 50S ribosomal protein L28 [Bacteroides sp. 3_2_5]
 gi|263256652|gb|EEZ27998.1| ribosomal protein L28 [Bacteroides sp. 2_1_16]
 gi|301163428|emb|CBW22979.1| 50S ribosomal protein L28 [Bacteroides fragilis 638R]
          Length = 86

 Score = 42.4 bits (98), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 43/74 (58%), Gaps = 5/74 (6%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCA--LRS 58
          MS++C++T K  M GN VSH+  +T+R F  NL         +EQ   + +S CA  LR 
Sbjct: 1  MSKICQITGKKAMIGNNVSHSKRRTKRTFDLNLFNKKFY--YVEQDCWISLSLCAAGLRI 58

Query: 59 VERQGGLDRFLSNS 72
          + ++ GLD  L+++
Sbjct: 59 INKK-GLDAALNDA 71


>gi|308272038|emb|CBX28646.1| 50S ribosomal protein L28 [uncultured Desulfobacterium sp.]
          Length = 63

 Score = 42.4 bits (98), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 23/46 (50%), Positives = 29/46 (63%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQK 46
          MSR+CE+  K  M G  VSHA+N T RRF PNL  +  I + M +K
Sbjct: 1  MSRMCEICGKKPMVGKNVSHAHNVTCRRFNPNLQNVRAIRNGMVKK 46


>gi|29346326|ref|NP_809829.1| 50S ribosomal protein L28 [Bacteroides thetaiotaomicron VPI-5482]
 gi|253568251|ref|ZP_04845662.1| 50S ribosomal protein L28 [Bacteroides sp. 1_1_6]
 gi|67461521|sp|Q8A999|RL28_BACTN RecName: Full=50S ribosomal protein L28
 gi|29338221|gb|AAO76023.1| 50S ribosomal protein L28 [Bacteroides thetaiotaomicron VPI-5482]
 gi|251842324|gb|EES70404.1| 50S ribosomal protein L28 [Bacteroides sp. 1_1_6]
          Length = 86

 Score = 42.4 bits (98), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 43/74 (58%), Gaps = 5/74 (6%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCA--LRS 58
          MS++C++T K  M GN VSH+  +T+R F  NL         +EQ   + +S CA  LR 
Sbjct: 1  MSKICQITGKKAMIGNNVSHSKRRTKRTFDLNLFNKKFY--YVEQDCWISLSLCANGLRI 58

Query: 59 VERQGGLDRFLSNS 72
          + ++ GLD  L+++
Sbjct: 59 INKK-GLDAALNDA 71


>gi|309802267|ref|ZP_07696375.1| ribosomal protein L28 [Bifidobacterium dentium JCVIHMP022]
 gi|308221150|gb|EFO77454.1| ribosomal protein L28 [Bifidobacterium dentium JCVIHMP022]
          Length = 152

 Score = 42.4 bits (98), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 35/63 (55%)

Query: 1   MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
           MS+ C++       GN VSH++ KTRR F PNL R       + +   L ++   +++++
Sbjct: 72  MSKHCQVLGTRAHVGNAVSHSHRKTRRTFSPNLQRKRYYVPSLGRTVTLTLTPKGMKTID 131

Query: 61  RQG 63
           RQG
Sbjct: 132 RQG 134


>gi|292669804|ref|ZP_06603230.1| 50S ribosomal protein L28 [Selenomonas noxia ATCC 43541]
 gi|292648601|gb|EFF66573.1| 50S ribosomal protein L28 [Selenomonas noxia ATCC 43541]
          Length = 63

 Score = 42.4 bits (98), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 41/70 (58%), Gaps = 8/70 (11%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRI-TLISDIMEQKYQLRISKCALRSV 59
          M+ VCE+  K  MSGN VSH++ KT+R++ PN+ R+  L+    E K+    ++C     
Sbjct: 1  MASVCEVCGKGPMSGNNVSHSHVKTKRKWKPNIQRVRALVKG--EVKHVNVCTRCL---- 54

Query: 60 ERQGGLDRFL 69
           R G +DR +
Sbjct: 55 -RSGNVDRAV 63


>gi|283456725|ref|YP_003361289.1| 50S ribosomal protein L28 [Bifidobacterium dentium Bd1]
 gi|283103359|gb|ADB10465.1| 50S ribosomal protein L28,50S ribosomal protein L28
          [Bifidobacterium dentium Bd1]
          Length = 81

 Score = 42.4 bits (98), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 35/63 (55%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS+ C++       GN VSH++ KTRR F PNL R       + +   L ++   +++++
Sbjct: 1  MSKHCQVLGTRAHVGNAVSHSHRKTRRTFSPNLQRKRYYVPSLGRTVTLTLTPKGMKTID 60

Query: 61 RQG 63
          RQG
Sbjct: 61 RQG 63


>gi|241889660|ref|ZP_04776958.1| ribosomal protein L28 [Gemella haemolysans ATCC 10379]
 gi|329766994|ref|ZP_08258522.1| 50S ribosomal protein L28 [Gemella haemolysans M341]
 gi|241863282|gb|EER67666.1| ribosomal protein L28 [Gemella haemolysans ATCC 10379]
 gi|328837719|gb|EGF87344.1| 50S ribosomal protein L28 [Gemella haemolysans M341]
          Length = 62

 Score = 42.4 bits (98), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 25/63 (39%), Positives = 39/63 (61%), Gaps = 4/63 (6%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS-- 58
          M++VC +T +   SGN  SHA N  +R+F  NL ++T++ D   Q  ++ +S  AL+S  
Sbjct: 1  MAKVCYVTGRKARSGNTRSHAMNANKRKFKANLQKVTILVD--GQPKKVWVSARALKSGK 58

Query: 59 VER 61
          VER
Sbjct: 59 VER 61


>gi|325335861|gb|ADZ12135.1| Ribosomal protein L28 [Riemerella anatipestifer RA-GD]
          Length = 66

 Score = 42.4 bits (98), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 28/51 (54%)

Query: 13 MSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQG 63
          M GN VSHANNKT+RRF  NL          E+   L++S   LR + + G
Sbjct: 1  MVGNHVSHANNKTKRRFEINLLEKKFYLPEQEKHITLKVSAHGLRVINKIG 51


>gi|288904518|ref|YP_003429739.1| ribosomal protein L28 [Streptococcus gallolyticus UCN34]
 gi|306830512|ref|ZP_07463680.1| 50S ribosomal protein L28 [Streptococcus gallolyticus subsp.
          gallolyticus TX20005]
 gi|306832749|ref|ZP_07465885.1| 50S ribosomal protein L28 [Streptococcus bovis ATCC 700338]
 gi|325977489|ref|YP_004287205.1| 50S ribosomal protein L28 [Streptococcus gallolyticus subsp.
          gallolyticus ATCC BAA-2069]
 gi|288731243|emb|CBI12793.1| ribosomal protein L28 [Streptococcus gallolyticus UCN34]
 gi|304425098|gb|EFM28228.1| 50S ribosomal protein L28 [Streptococcus bovis ATCC 700338]
 gi|304427306|gb|EFM30410.1| 50S ribosomal protein L28 [Streptococcus gallolyticus subsp.
          gallolyticus TX20005]
 gi|325177417|emb|CBZ47461.1| 50S ribosomal protein L28 [Streptococcus gallolyticus subsp.
          gallolyticus ATCC BAA-2069]
          Length = 62

 Score = 42.4 bits (98), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 39/63 (61%), Gaps = 4/63 (6%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS-- 58
          M++VC  T +  +SGN  SHA NKT+R   PNL ++T++ +   +K  +  S  AL+S  
Sbjct: 1  MAKVCYFTGRKTVSGNNRSHAMNKTKRAVKPNLQKVTILVNGKPKK--VWASARALKSGK 58

Query: 59 VER 61
          VER
Sbjct: 59 VER 61


>gi|306822127|ref|ZP_07455509.1| 50S ribosomal protein L28 [Bifidobacterium dentium ATCC 27679]
 gi|304554509|gb|EFM42414.1| 50S ribosomal protein L28 [Bifidobacterium dentium ATCC 27679]
          Length = 110

 Score = 42.4 bits (98), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 35/63 (55%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS+ C++       GN VSH++ KTRR F PNL R       + +   L ++   +++++
Sbjct: 30 MSKHCQVLGTRAHVGNAVSHSHRKTRRTFSPNLQRKRYYVPSLGRTVTLTLTPKGMKTID 89

Query: 61 RQG 63
          RQG
Sbjct: 90 RQG 92


>gi|197123014|ref|YP_002134965.1| 50S ribosomal protein L28 [Anaeromyxobacter sp. K]
 gi|220917804|ref|YP_002493108.1| ribosomal protein L28 [Anaeromyxobacter dehalogenans 2CP-1]
 gi|226738026|sp|B4UGY2|RL28_ANASK RecName: Full=50S ribosomal protein L28
 gi|254801495|sp|B8JDJ3|RL28_ANAD2 RecName: Full=50S ribosomal protein L28
 gi|196172863|gb|ACG73836.1| ribosomal protein L28 [Anaeromyxobacter sp. K]
 gi|219955658|gb|ACL66042.1| ribosomal protein L28 [Anaeromyxobacter dehalogenans 2CP-1]
          Length = 73

 Score = 42.4 bits (98), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 19/33 (57%), Positives = 23/33 (69%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNL 33
          M+R CE+  K  + GN VSHANNK + R LPNL
Sbjct: 1  MARRCEICGKGPLVGNTVSHANNKNKTRSLPNL 33


>gi|47458579|gb|AAT27901.1| 50S ribosomal protein l28 [Mycoplasma mobile 163K]
          Length = 75

 Score = 42.4 bits (98), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 25/63 (39%), Positives = 41/63 (65%), Gaps = 1/63 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+R  +LT K  MSGNK SHA N T+R+F  NL +I L++     K ++++S    ++++
Sbjct: 11 MARRDDLTNKGPMSGNKRSHALNATKRKFNLNLQKI-LVTLENGSKVKIKVSAKTAKTLK 69

Query: 61 RQG 63
          +QG
Sbjct: 70 KQG 72


>gi|256826998|ref|YP_003150957.1| 50S ribosomal protein L28P [Cryptobacterium curtum DSM 15641]
 gi|256583141|gb|ACU94275.1| LSU ribosomal protein L28P [Cryptobacterium curtum DSM 15641]
          Length = 63

 Score = 42.4 bits (98), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 28/41 (68%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISD 41
          MS+VCE+  KT ++G  VSH++  T R F PN+ R+T+  D
Sbjct: 1  MSKVCEVCGKTPVAGRNVSHSHRVTNRMFHPNVQRVTIKDD 41


>gi|226326897|ref|ZP_03802415.1| hypothetical protein PROPEN_00757 [Proteus penneri ATCC 35198]
 gi|225204734|gb|EEG87088.1| hypothetical protein PROPEN_00757 [Proteus penneri ATCC 35198]
          Length = 66

 Score = 42.4 bits (98), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 31/51 (60%)

Query: 13 MSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQG 63
          MSGN  SHA N T+RRFLPNL       +  ++   LR+S   +R ++++G
Sbjct: 1  MSGNNRSHALNATKRRFLPNLHSHRFWVESEKRFVTLRVSAKGMRVIDKKG 51


>gi|302755644|ref|XP_002961246.1| hypothetical protein SELMODRAFT_71657 [Selaginella
          moellendorffii]
 gi|302772124|ref|XP_002969480.1| hypothetical protein SELMODRAFT_68550 [Selaginella
          moellendorffii]
 gi|300162956|gb|EFJ29568.1| hypothetical protein SELMODRAFT_68550 [Selaginella
          moellendorffii]
 gi|300172185|gb|EFJ38785.1| hypothetical protein SELMODRAFT_71657 [Selaginella
          moellendorffii]
          Length = 113

 Score = 42.4 bits (98), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 39/73 (53%), Gaps = 1/73 (1%)

Query: 7  LTKKTVMSGNKVSH-ANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGL 65
             + +  GNKVS    NKTRR + PN+    L S  +++  ++ ++  ALR +++ GGL
Sbjct: 12 FAGRHIQFGNKVSEKGGNKTRRTWKPNVRLKRLYSFSLDRFIRVHVTTHALRCIDKAGGL 71

Query: 66 DRFLSNSKKENLS 78
          D +L N     L 
Sbjct: 72 DEYLLNKPDHKLE 84


>gi|212712580|ref|ZP_03320708.1| hypothetical protein PROVALCAL_03675 [Providencia alcalifaciens
          DSM 30120]
 gi|282600470|ref|ZP_05974416.2| ribosomal protein L28 [Providencia rustigianii DSM 4541]
 gi|212684796|gb|EEB44324.1| hypothetical protein PROVALCAL_03675 [Providencia alcalifaciens
          DSM 30120]
 gi|282565171|gb|EFB70706.1| ribosomal protein L28 [Providencia rustigianii DSM 4541]
          Length = 66

 Score = 42.4 bits (98), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 31/51 (60%)

Query: 13 MSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQG 63
          MSGN  SHA N T+RRFLPNL       +  ++   LR+S   +R ++++G
Sbjct: 1  MSGNNRSHALNATKRRFLPNLHSHRFWVESEKRFVTLRVSAKGMRVIDKKG 51


>gi|293363601|ref|ZP_06610357.1| ribosomal protein L28 [Mycoplasma alligatoris A21JP2]
 gi|292552950|gb|EFF41704.1| ribosomal protein L28 [Mycoplasma alligatoris A21JP2]
          Length = 63

 Score = 42.0 bits (97), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 39/63 (61%), Gaps = 2/63 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRV  LT +   SGNK SHA N T+R+F  NL +I L  D   Q+  +R+S   +++++
Sbjct: 1  MSRVDVLTGRGPQSGNKRSHALNATKRKFNVNLQKIKLNMD--GQRVTVRVSAKTIKTLK 58

Query: 61 RQG 63
           +G
Sbjct: 59 TKG 61


>gi|313896664|ref|ZP_07830212.1| ribosomal protein L28 [Selenomonas sp. oral taxon 137 str. F0430]
 gi|320529989|ref|ZP_08031065.1| ribosomal protein L28 [Selenomonas artemidis F0399]
 gi|312974581|gb|EFR40048.1| ribosomal protein L28 [Selenomonas sp. oral taxon 137 str. F0430]
 gi|320137786|gb|EFW29692.1| ribosomal protein L28 [Selenomonas artemidis F0399]
          Length = 63

 Score = 42.0 bits (97), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 27/36 (75%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRI 36
          M+ VCE+  K  MSGN VSH++ KT+R++ PN+ R+
Sbjct: 1  MASVCEVCGKGPMSGNNVSHSHVKTKRKWKPNIQRV 36


>gi|171777506|ref|ZP_02919228.1| hypothetical protein STRINF_00055 [Streptococcus infantarius
          subsp. infantarius ATCC BAA-102]
 gi|171283216|gb|EDT48640.1| hypothetical protein STRINF_00055 [Streptococcus infantarius
          subsp. infantarius ATCC BAA-102]
          Length = 62

 Score = 42.0 bits (97), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 39/63 (61%), Gaps = 4/63 (6%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS-- 58
          M++VC  T +  +SGN  SHA NKT+R   PNL ++T++ +   +K  +  S  AL+S  
Sbjct: 1  MAKVCYFTGRKTVSGNNRSHAMNKTKRAVKPNLQKVTVLVNGKPKK--VWASARALKSGK 58

Query: 59 VER 61
          VER
Sbjct: 59 VER 61


>gi|160889553|ref|ZP_02070556.1| hypothetical protein BACUNI_01977 [Bacteroides uniformis ATCC
          8492]
 gi|167763127|ref|ZP_02435254.1| hypothetical protein BACSTE_01496 [Bacteroides stercoris ATCC
          43183]
 gi|218131137|ref|ZP_03459941.1| hypothetical protein BACEGG_02742 [Bacteroides eggerthii DSM
          20697]
 gi|270296677|ref|ZP_06202876.1| conserved hypothetical protein [Bacteroides sp. D20]
 gi|317476986|ref|ZP_07936228.1| ribosomal protein L28 [Bacteroides eggerthii 1_2_48FAA]
 gi|329954828|ref|ZP_08295845.1| ribosomal protein L28 [Bacteroides clarus YIT 12056]
 gi|329963570|ref|ZP_08301049.1| ribosomal protein L28 [Bacteroides fluxus YIT 12057]
 gi|156861070|gb|EDO54501.1| hypothetical protein BACUNI_01977 [Bacteroides uniformis ATCC
          8492]
 gi|167699467|gb|EDS16046.1| hypothetical protein BACSTE_01496 [Bacteroides stercoris ATCC
          43183]
 gi|217986657|gb|EEC52991.1| hypothetical protein BACEGG_02742 [Bacteroides eggerthii DSM
          20697]
 gi|270272664|gb|EFA18527.1| conserved hypothetical protein [Bacteroides sp. D20]
 gi|316906779|gb|EFV28491.1| ribosomal protein L28 [Bacteroides eggerthii 1_2_48FAA]
 gi|328526932|gb|EGF53943.1| ribosomal protein L28 [Bacteroides clarus YIT 12056]
 gi|328528559|gb|EGF55530.1| ribosomal protein L28 [Bacteroides fluxus YIT 12057]
          Length = 86

 Score = 42.0 bits (97), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 42/74 (56%), Gaps = 5/74 (6%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCA--LRS 58
          MS++C++T K  M GN VSH+  +T+R F  NL         +EQ   + +S CA  LR 
Sbjct: 1  MSKICQITGKKAMIGNNVSHSKRRTKRTFDLNLFNKKFY--YVEQDCWISLSICANGLRI 58

Query: 59 VERQGGLDRFLSNS 72
          + ++ GLD  L ++
Sbjct: 59 INKK-GLDAALKDA 71


>gi|288550206|ref|ZP_05969612.2| hypothetical protein ENTCAN_08233 [Enterobacter cancerogenus ATCC
          35316]
 gi|296100495|ref|YP_003610641.1| ribosomal protein L28 [Enterobacter cloacae subsp. cloacae ATCC
          13047]
 gi|288316122|gb|EFC55060.1| ribosomal protein L28 [Enterobacter cancerogenus ATCC 35316]
 gi|295054954|gb|ADF59692.1| ribosomal protein L28 [Enterobacter cloacae subsp. cloacae ATCC
          13047]
          Length = 66

 Score = 42.0 bits (97), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 35/58 (60%), Gaps = 1/58 (1%)

Query: 13 MSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFLS 70
          M+GN  SHA N T+RRFLPNL       +  ++   LR+S   +R ++++ G+D  LS
Sbjct: 1  MTGNNRSHALNATKRRFLPNLHSHRFWVESEKRFVTLRVSAKGMRVIDKK-GIDTVLS 57


>gi|323342149|ref|ZP_08082382.1| 50S ribosomal protein L28 [Erysipelothrix rhusiopathiae ATCC
          19414]
 gi|322464574|gb|EFY09767.1| 50S ribosomal protein L28 [Erysipelothrix rhusiopathiae ATCC
          19414]
          Length = 86

 Score = 42.0 bits (97), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 39/62 (62%), Gaps = 2/62 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M RVC ++ K  +SGNK SH+   TRR++  NL   T++ D   +  ++RIS  AL+S++
Sbjct: 24 MPRVCSVSGKKTLSGNKRSHSLRATRRKWNVNLQNATIMVD--GKPTRVRISARALKSLK 81

Query: 61 RQ 62
           Q
Sbjct: 82 AQ 83


>gi|153806281|ref|ZP_01958949.1| hypothetical protein BACCAC_00537 [Bacteroides caccae ATCC 43185]
 gi|160882780|ref|ZP_02063783.1| hypothetical protein BACOVA_00741 [Bacteroides ovatus ATCC 8483]
 gi|255693891|ref|ZP_05417566.1| ribosomal protein L28 [Bacteroides finegoldii DSM 17565]
 gi|260170249|ref|ZP_05756661.1| 50S ribosomal protein L28 [Bacteroides sp. D2]
 gi|293373980|ref|ZP_06620321.1| ribosomal protein L28 [Bacteroides ovatus SD CMC 3f]
 gi|299145598|ref|ZP_07038666.1| ribosomal protein L28 [Bacteroides sp. 3_1_23]
 gi|315918612|ref|ZP_07914852.1| conserved hypothetical protein [Bacteroides sp. D2]
 gi|149130958|gb|EDM22164.1| hypothetical protein BACCAC_00537 [Bacteroides caccae ATCC 43185]
 gi|156111804|gb|EDO13549.1| hypothetical protein BACOVA_00741 [Bacteroides ovatus ATCC 8483]
 gi|260620296|gb|EEX43167.1| ribosomal protein L28 [Bacteroides finegoldii DSM 17565]
 gi|292631056|gb|EFF49693.1| ribosomal protein L28 [Bacteroides ovatus SD CMC 3f]
 gi|298516089|gb|EFI39970.1| ribosomal protein L28 [Bacteroides sp. 3_1_23]
 gi|313692487|gb|EFS29322.1| conserved hypothetical protein [Bacteroides sp. D2]
          Length = 86

 Score = 42.0 bits (97), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 42/74 (56%), Gaps = 5/74 (6%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCA--LRS 58
          MS++C++T K  M GN VSH+  +T+R F  NL         +EQ   + +S CA  LR 
Sbjct: 1  MSKICQITGKKAMIGNNVSHSKRRTKRTFDLNLFNKKFY--YVEQDCWISLSICANGLRI 58

Query: 59 VERQGGLDRFLSNS 72
          + ++ GLD  L+ +
Sbjct: 59 INKK-GLDAALTEA 71


>gi|294101851|ref|YP_003553709.1| ribosomal protein L28 [Aminobacterium colombiense DSM 12261]
 gi|293616831|gb|ADE56985.1| ribosomal protein L28 [Aminobacterium colombiense DSM 12261]
          Length = 64

 Score = 42.0 bits (97), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 18/33 (54%), Positives = 24/33 (72%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNL 33
          M+RVCE   +  ++GN VSH+N  TRRR+L NL
Sbjct: 1  MARVCECCGRGPVTGNAVSHSNRHTRRRWLVNL 33


>gi|319902100|ref|YP_004161828.1| LSU ribosomal protein L28P [Bacteroides helcogenes P 36-108]
 gi|319417131|gb|ADV44242.1| LSU ribosomal protein L28P [Bacteroides helcogenes P 36-108]
          Length = 86

 Score = 42.0 bits (97), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 42/74 (56%), Gaps = 5/74 (6%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCA--LRS 58
          MS++C++T K  M GN VSH+  +T+R F  NL         +EQ   + +S CA  LR 
Sbjct: 1  MSKICQITGKKAMIGNNVSHSKRRTKRTFDLNLFNKKFY--YVEQDCWISLSICANGLRI 58

Query: 59 VERQGGLDRFLSNS 72
          + ++ GLD  L ++
Sbjct: 59 INKK-GLDAALKDA 71


>gi|322374036|ref|ZP_08048570.1| ribosomal protein L28 [Streptococcus sp. C150]
 gi|321277002|gb|EFX54073.1| ribosomal protein L28 [Streptococcus sp. C150]
          Length = 62

 Score = 42.0 bits (97), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 38/63 (60%), Gaps = 4/63 (6%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS-- 58
          M++VC  T +  +S N  SHA NKT+R   PNL ++T++ D   +K  +  S  AL+S  
Sbjct: 1  MAKVCYFTGRKTVSANNRSHAMNKTKRAVKPNLQKVTILVDGKPKK--VWASARALKSGK 58

Query: 59 VER 61
          VER
Sbjct: 59 VER 61


>gi|306820972|ref|ZP_07454592.1| 50S ribosomal protein L28 [Eubacterium yurii subsp. margaretiae
          ATCC 43715]
 gi|304551086|gb|EFM39057.1| 50S ribosomal protein L28 [Eubacterium yurii subsp. margaretiae
          ATCC 43715]
          Length = 63

 Score = 42.0 bits (97), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 29/49 (59%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQL 49
          M+ VCE+  K   SGN VSH+N  T+R F PNL  +  I D   ++ ++
Sbjct: 1  MAFVCEICGKGTTSGNNVSHSNRHTKRVFRPNLQSVKAIVDGTPRRVKV 49


>gi|313901536|ref|ZP_07834981.1| LSU ribosomal protein L28P [Thermaerobacter subterraneus DSM
          13965]
 gi|313468197|gb|EFR63666.1| LSU ribosomal protein L28P [Thermaerobacter subterraneus DSM
          13965]
          Length = 63

 Score = 42.0 bits (97), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 28/41 (68%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISD 41
          M+R CE+  K V  GN+VSH+N K+RR + PNL R+  ++ 
Sbjct: 1  MARRCEICGKGVDYGNQVSHSNRKSRRIWGPNLQRVRAVTP 41


>gi|237716495|ref|ZP_04546976.1| conserved hypothetical protein [Bacteroides sp. D1]
 gi|237720686|ref|ZP_04551167.1| conserved hypothetical protein [Bacteroides sp. 2_2_4]
 gi|262408093|ref|ZP_06084641.1| ribosomal protein L28 [Bacteroides sp. 2_1_22]
 gi|294645087|ref|ZP_06722813.1| ribosomal protein L28 [Bacteroides ovatus SD CC 2a]
 gi|294809487|ref|ZP_06768190.1| ribosomal protein L28 [Bacteroides xylanisolvens SD CC 1b]
 gi|298484169|ref|ZP_07002335.1| ribosomal protein L28 [Bacteroides sp. D22]
 gi|229444142|gb|EEO49933.1| conserved hypothetical protein [Bacteroides sp. D1]
 gi|229449521|gb|EEO55312.1| conserved hypothetical protein [Bacteroides sp. 2_2_4]
 gi|262354901|gb|EEZ03993.1| ribosomal protein L28 [Bacteroides sp. 2_1_22]
 gi|292639593|gb|EFF57885.1| ribosomal protein L28 [Bacteroides ovatus SD CC 2a]
 gi|294443305|gb|EFG12069.1| ribosomal protein L28 [Bacteroides xylanisolvens SD CC 1b]
 gi|295084180|emb|CBK65703.1| LSU ribosomal protein L28P [Bacteroides xylanisolvens XB1A]
 gi|298269673|gb|EFI11268.1| ribosomal protein L28 [Bacteroides sp. D22]
          Length = 86

 Score = 42.0 bits (97), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 42/74 (56%), Gaps = 5/74 (6%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCA--LRS 58
          MS++C++T K  M GN VSH+  +T+R F  NL         +EQ   + +S CA  LR 
Sbjct: 1  MSKICQITGKKAMIGNNVSHSKRRTKRTFDLNLFNKKFY--YVEQDCWISLSLCANGLRI 58

Query: 59 VERQGGLDRFLSNS 72
          + ++ GLD  L+ +
Sbjct: 59 INKK-GLDAALTEA 71


>gi|313203650|ref|YP_004042307.1| LSU ribosomal protein l28p [Paludibacter propionicigenes WB4]
 gi|312442966|gb|ADQ79322.1| LSU ribosomal protein L28P [Paludibacter propionicigenes WB4]
          Length = 79

 Score = 41.6 bits (96), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 33/63 (52%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS++C++T K  M GN VSH+  +T+R F  NL          +    L +S   LR++ 
Sbjct: 1  MSKICQITGKKAMVGNNVSHSKRRTKRTFDVNLFTKKFYWVEQDTWVSLNVSANGLRTIN 60

Query: 61 RQG 63
          + G
Sbjct: 61 KIG 63


>gi|153005375|ref|YP_001379700.1| 50S ribosomal protein L28 [Anaeromyxobacter sp. Fw109-5]
 gi|166226537|sp|A7HDC0|RL28_ANADF RecName: Full=50S ribosomal protein L28
 gi|152028948|gb|ABS26716.1| ribosomal protein L28 [Anaeromyxobacter sp. Fw109-5]
          Length = 73

 Score = 41.6 bits (96), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 18/33 (54%), Positives = 24/33 (72%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNL 33
          M+R C++  K  + GN VSHANNK++ R LPNL
Sbjct: 1  MARRCDICGKGPLVGNNVSHANNKSKTRSLPNL 33


>gi|224024939|ref|ZP_03643305.1| hypothetical protein BACCOPRO_01670 [Bacteroides coprophilus DSM
          18228]
 gi|224018175|gb|EEF76173.1| hypothetical protein BACCOPRO_01670 [Bacteroides coprophilus DSM
          18228]
          Length = 86

 Score = 41.6 bits (96), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 30/87 (34%), Positives = 47/87 (54%), Gaps = 6/87 (6%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCA--LRS 58
          MS++C++T K  M GN VSH+  +T+R F  NL   T     +EQ   + ++ CA  LR 
Sbjct: 1  MSKICQITGKKAMIGNNVSHSKRRTKRTFDVNL--FTKKFYYVEQDCWISLNICANGLRV 58

Query: 59 VERQGGLDRFLSNSKKENLSARMRTLR 85
          + ++ GLD  L N    N     +T++
Sbjct: 59 INKK-GLDAAL-NEAVANGYCDWKTIK 83


>gi|15615063|ref|NP_243366.1| 50S ribosomal protein L28 [Bacillus halodurans C-125]
 gi|14195133|sp|Q9K9Z4|RL28_BACHD RecName: Full=50S ribosomal protein L28
 gi|10175120|dbj|BAB06219.1| 50S ribosomal protein L28 [Bacillus halodurans C-125]
          Length = 62

 Score = 41.6 bits (96), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 25/63 (39%), Positives = 40/63 (63%), Gaps = 4/63 (6%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS-- 58
          M+R C +T +   SGNK SHA NKT+RR+  N+ ++ ++ D   ++  + +S  AL+S  
Sbjct: 1  MARKCYITGRQAKSGNKRSHAMNKTKRRWGANVQKVRILVDGKPKR--VYVSARALKSGK 58

Query: 59 VER 61
          VER
Sbjct: 59 VER 61


>gi|325297728|ref|YP_004257645.1| 50S ribosomal protein L28 [Bacteroides salanitronis DSM 18170]
 gi|324317281|gb|ADY35172.1| 50S ribosomal protein L28 [Bacteroides salanitronis DSM 18170]
          Length = 86

 Score = 41.6 bits (96), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 42/74 (56%), Gaps = 5/74 (6%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCA--LRS 58
          MS++C++T K  M GN VSH+  +T+R F  NL   T     +EQ   + +  CA  LR 
Sbjct: 1  MSKICQITGKKAMIGNNVSHSKRRTKRTFDVNL--FTKKFYYVEQDCWISLKICANGLRV 58

Query: 59 VERQGGLDRFLSNS 72
          + ++ GLD  L+ +
Sbjct: 59 INKK-GLDAALTEA 71


>gi|212542117|ref|XP_002151213.1| 50S ribosomal protein L24 [Penicillium marneffei ATCC 18224]
 gi|210066120|gb|EEA20213.1| 50S ribosomal protein L24 [Penicillium marneffei ATCC 18224]
          Length = 237

 Score = 41.6 bits (96), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 47/87 (54%), Gaps = 10/87 (11%)

Query: 15  GNKVSHANNK--TRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFLSNS 72
           GNK+S   NK  TRR + PN+    + S+ + +   +++++ ALR++ + GGLD +L + 
Sbjct: 76  GNKISKGRNKGKTRRSWKPNVRWKKMPSEALGEDVFVKLTRKALRTIRKCGGLDNYLLSD 135

Query: 73  KKENLSA--------RMRTLRSQILKK 91
           K   L          R R ++S  +KK
Sbjct: 136 KPSRLKELGLAGWKLRYRIMQSPAMKK 162


>gi|189461327|ref|ZP_03010112.1| hypothetical protein BACCOP_01977 [Bacteroides coprocola DSM
          17136]
 gi|189431856|gb|EDV00841.1| hypothetical protein BACCOP_01977 [Bacteroides coprocola DSM
          17136]
          Length = 86

 Score = 41.6 bits (96), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 43/74 (58%), Gaps = 5/74 (6%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCA--LRS 58
          MS++C++T K  M GN VSH+  +T+R F  NL   T     +EQ   + ++ CA  LR 
Sbjct: 1  MSKICQITGKKAMIGNNVSHSKRRTKRTFDVNL--FTKKFYYVEQDCWISLNICANGLRV 58

Query: 59 VERQGGLDRFLSNS 72
          + ++ GLD  L+ +
Sbjct: 59 INKK-GLDAALNEA 71


>gi|310659149|ref|YP_003936870.1| 50S ribosomal protein L28 [Clostridium sticklandii DSM 519]
 gi|308825927|emb|CBH21965.1| ribosomal protein L28 [Clostridium sticklandii]
          Length = 63

 Score = 41.6 bits (96), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 18/33 (54%), Positives = 24/33 (72%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNL 33
          M+RVCE+  K  +SGN VSH+N  T+R + PNL
Sbjct: 1  MARVCEVCGKGKVSGNNVSHSNRHTKRTWSPNL 33


>gi|170097237|ref|XP_001879838.1| predicted protein [Laccaria bicolor S238N-H82]
 gi|164645241|gb|EDR09489.1| predicted protein [Laccaria bicolor S238N-H82]
          Length = 192

 Score = 41.6 bits (96), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 16/58 (27%), Positives = 38/58 (65%)

Query: 15 GNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFLSNS 72
          GN V  + +K+RR +LPN+ +  + S  +    +++++  AL+++++ GGLD+++  +
Sbjct: 34 GNNVPFSKHKSRRTWLPNVQQKRIPSATLGMPIRVKLTTRALKTIKKHGGLDKYVEKT 91


>gi|251797730|ref|YP_003012461.1| ribosomal protein L28 [Paenibacillus sp. JDR-2]
 gi|247545356|gb|ACT02375.1| ribosomal protein L28 [Paenibacillus sp. JDR-2]
          Length = 62

 Score = 41.6 bits (96), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 37/58 (63%), Gaps = 2/58 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS 58
          MSR C +T K+  +GN VSHANNK RR +  N+ ++ ++ D   ++  + +S  AL+S
Sbjct: 1  MSRKCFITGKSPGTGNHVSHANNKNRRSWGVNVQKVRILVDGKPKR--VYVSTRALKS 56


>gi|150005786|ref|YP_001300530.1| 50S ribosomal protein L28 [Bacteroides vulgatus ATCC 8482]
 gi|212693208|ref|ZP_03301336.1| hypothetical protein BACDOR_02718 [Bacteroides dorei DSM 17855]
 gi|237709951|ref|ZP_04540432.1| 50S ribosomal protein L28 [Bacteroides sp. 9_1_42FAA]
 gi|237725384|ref|ZP_04555865.1| 50S ribosomal protein L28 [Bacteroides sp. D4]
 gi|254882033|ref|ZP_05254743.1| 50S ribosomal protein L28 [Bacteroides sp. 4_3_47FAA]
 gi|265753602|ref|ZP_06088957.1| 50S ribosomal protein L28 [Bacteroides sp. 3_1_33FAA]
 gi|294776164|ref|ZP_06741653.1| ribosomal protein L28 [Bacteroides vulgatus PC510]
 gi|319640959|ref|ZP_07995667.1| 50S ribosomal protein L28 [Bacteroides sp. 3_1_40A]
 gi|166226543|sp|A6L5E4|RL28_BACV8 RecName: Full=50S ribosomal protein L28
 gi|149934210|gb|ABR40908.1| 50S ribosomal protein L28 [Bacteroides vulgatus ATCC 8482]
 gi|212664313|gb|EEB24885.1| hypothetical protein BACDOR_02718 [Bacteroides dorei DSM 17855]
 gi|229436071|gb|EEO46148.1| 50S ribosomal protein L28 [Bacteroides dorei 5_1_36/D4]
 gi|229456044|gb|EEO61765.1| 50S ribosomal protein L28 [Bacteroides sp. 9_1_42FAA]
 gi|254834826|gb|EET15135.1| 50S ribosomal protein L28 [Bacteroides sp. 4_3_47FAA]
 gi|263235316|gb|EEZ20840.1| 50S ribosomal protein L28 [Bacteroides sp. 3_1_33FAA]
 gi|294449987|gb|EFG18498.1| ribosomal protein L28 [Bacteroides vulgatus PC510]
 gi|317387404|gb|EFV68275.1| 50S ribosomal protein L28 [Bacteroides sp. 3_1_40A]
          Length = 86

 Score = 41.6 bits (96), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 43/74 (58%), Gaps = 5/74 (6%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCA--LRS 58
          MS++C++T K  M GN VSH+  +T+R F  NL   T     +EQ   + ++ CA  LR 
Sbjct: 1  MSKICQITGKKAMIGNNVSHSKRRTKRTFDVNL--FTKKFYYVEQDCWISLNICANGLRV 58

Query: 59 VERQGGLDRFLSNS 72
          + ++ GLD  L+ +
Sbjct: 59 INKK-GLDAALNEA 71


>gi|150390534|ref|YP_001320583.1| ribosomal protein L28 [Alkaliphilus metalliredigens QYMF]
 gi|166987906|sp|A6TRV6|RL28_ALKMQ RecName: Full=50S ribosomal protein L28
 gi|149950396|gb|ABR48924.1| ribosomal protein L28 [Alkaliphilus metalliredigens QYMF]
          Length = 63

 Score = 41.6 bits (96), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 25/33 (75%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNL 33
          M+RVC++ +K  +SGN+VSH+N   RR + PNL
Sbjct: 1  MARVCDVCQKGKVSGNQVSHSNRHNRRTWTPNL 33


>gi|149194808|ref|ZP_01871902.1| 50S ribosomal protein L28 [Caminibacter mediatlanticus TB-2]
 gi|149134967|gb|EDM23449.1| 50S ribosomal protein L28 [Caminibacter mediatlanticus TB-2]
          Length = 61

 Score = 41.6 bits (96), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 32/49 (65%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQL 49
          M+R CE+  K    GN+VSH+N KTR +F PN+  + +  D ++++ ++
Sbjct: 1  MARKCEICGKGPQFGNRVSHSNRKTRHKFDPNIQHVRIEVDGVKKRIKI 49


>gi|213692825|ref|YP_002323411.1| ribosomal protein L28 [Bifidobacterium longum subsp. infantis
          ATCC 15697]
 gi|213524286|gb|ACJ53033.1| ribosomal protein L28 [Bifidobacterium longum subsp. infantis
          ATCC 15697]
 gi|320458995|dbj|BAJ69616.1| 50S ribosomal protein L28 [Bifidobacterium longum subsp. infantis
          ATCC 15697]
          Length = 78

 Score = 41.6 bits (96), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 35/63 (55%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS+ C++       GN+VSH++ KTRR F PNL         +++   L +S   +++++
Sbjct: 1  MSKTCQILGTRAGVGNRVSHSHRKTRRTFAPNLQSKRYWVPSLQRHVTLTVSAKGIKTID 60

Query: 61 RQG 63
          R G
Sbjct: 61 RIG 63


>gi|56964076|ref|YP_175807.1| 50S ribosomal protein L28 [Bacillus clausii KSM-K16]
 gi|67461332|sp|Q5WFL4|RL28_BACSK RecName: Full=50S ribosomal protein L28
 gi|56910319|dbj|BAD64846.1| 50S ribosomal protein L28 [Bacillus clausii KSM-K16]
          Length = 62

 Score = 41.6 bits (96), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 25/63 (39%), Positives = 40/63 (63%), Gaps = 4/63 (6%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS-- 58
          M+R C +T +   SGNK SHA NK++RRF  N+ ++ ++ D   ++  + +S  AL+S  
Sbjct: 1  MARECYITGRKARSGNKRSHAMNKSKRRFGANVQKVRILVDGKPKR--VYVSARALKSGK 58

Query: 59 VER 61
          VER
Sbjct: 59 VER 61


>gi|78779282|ref|YP_397394.1| 50S ribosomal protein L28 [Prochlorococcus marinus str. MIT 9312]
 gi|123554241|sp|Q31AY7|RL28_PROM9 RecName: Full=50S ribosomal protein L28
 gi|78712781|gb|ABB49958.1| LSU ribosomal protein L28P [Prochlorococcus marinus str. MIT
          9312]
          Length = 78

 Score = 41.6 bits (96), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 42/68 (61%), Gaps = 1/68 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVCELT     +G  VSH++ +T++    NL +  L  +  ++   ++IS  AL+SV+
Sbjct: 1  MSRVCELTGAKANNGMAVSHSHIRTKKLQQVNLQKRRLWWEEGKKWVNIKISTKALKSVQ 60

Query: 61 RQGGLDRF 68
          +  GLD+F
Sbjct: 61 KV-GLDKF 67


>gi|288553107|ref|YP_003425042.1| 50S ribosomal protein L28 [Bacillus pseudofirmus OF4]
 gi|288544267|gb|ADC48150.1| 50S ribosomal protein L28 [Bacillus pseudofirmus OF4]
          Length = 62

 Score = 41.6 bits (96), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 40/63 (63%), Gaps = 4/63 (6%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS-- 58
          M+R C +T K   SGNK SHA NKT+RR+  N+ ++ ++ D   ++  + +S  AL+S  
Sbjct: 1  MARKCAITGKQAKSGNKRSHALNKTKRRWGVNVQKVRILVDGKPKR--VYVSTRALKSGK 58

Query: 59 VER 61
          VER
Sbjct: 59 VER 61


>gi|320527289|ref|ZP_08028474.1| ribosomal protein L28 [Solobacterium moorei F0204]
 gi|320132313|gb|EFW24858.1| ribosomal protein L28 [Solobacterium moorei F0204]
          Length = 88

 Score = 41.6 bits (96), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 24/59 (40%), Positives = 38/59 (64%), Gaps = 2/59 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSV 59
          MSRVC ++ K  MSGN+ SH+   TRR++  NL ++ +I D   Q   ++IS  AL+++
Sbjct: 22 MSRVCAVSGKKAMSGNRRSHSLRATRRKWNVNLQKVHMIVDGKPQ--TVKISARALKTL 78


>gi|158320471|ref|YP_001512978.1| ribosomal protein L28 [Alkaliphilus oremlandii OhILAs]
 gi|166987907|sp|A8MH95|RL28_ALKOO RecName: Full=50S ribosomal protein L28
 gi|158140670|gb|ABW18982.1| ribosomal protein L28 [Alkaliphilus oremlandii OhILAs]
          Length = 63

 Score = 41.6 bits (96), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 20/41 (48%), Positives = 27/41 (65%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISD 41
          M+RVCE+  K  +SGN VSH+N   RR + PNL R+  I +
Sbjct: 1  MARVCEVCAKGKVSGNVVSHSNRHNRRTWEPNLRRVRAIVN 41


>gi|218282557|ref|ZP_03488807.1| hypothetical protein EUBIFOR_01389 [Eubacterium biforme DSM 3989]
 gi|218216544|gb|EEC90082.1| hypothetical protein EUBIFOR_01389 [Eubacterium biforme DSM 3989]
          Length = 63

 Score = 41.2 bits (95), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 41/65 (63%), Gaps = 2/65 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC ++ K  +SGNK SH+   +RR++  NL ++ ++ D   Q   +R+S   L++++
Sbjct: 1  MSRVCAVSGKGPLSGNKRSHSMRASRRKWNVNLQKVRVVVDGKPQ--TIRVSARTLKTLK 58

Query: 61 RQGGL 65
          +Q  +
Sbjct: 59 KQNAI 63


>gi|296128027|ref|YP_003635277.1| ribosomal protein L28 [Cellulomonas flavigena DSM 20109]
 gi|296019842|gb|ADG73078.1| ribosomal protein L28 [Cellulomonas flavigena DSM 20109]
          Length = 78

 Score = 41.2 bits (95), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 35/63 (55%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS  C++  K    G  VSH+  +T RRF+PN+ R       + +  +LR+S   ++ ++
Sbjct: 1  MSNHCQVLGKAPTFGRTVSHSGRRTPRRFVPNIQRRRYWVPSLGRHVRLRVSTDGIKVID 60

Query: 61 RQG 63
          R+G
Sbjct: 61 RRG 63


>gi|320186823|gb|EFW61543.1| LSU ribosomal protein L28p [Shigella flexneri CDC 796-83]
          Length = 66

 Score = 41.2 bits (95), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 31/51 (60%)

Query: 13 MSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQG 63
          M+GN  SHA N T+RRFLPNL       +  ++   LR+S   +R ++++G
Sbjct: 1  MTGNNRSHALNATKRRFLPNLHSHRFWVESEKRFVTLRVSAKGMRVIDKKG 51


>gi|313672663|ref|YP_004050774.1| LSU ribosomal protein l28p [Calditerrivibrio nitroreducens DSM
          19672]
 gi|312939419|gb|ADR18611.1| LSU ribosomal protein L28P [Calditerrivibrio nitroreducens DSM
          19672]
          Length = 63

 Score = 41.2 bits (95), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 17/40 (42%), Positives = 28/40 (70%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLIS 40
          M+R C++  K  M G+ +SHA+N TRR F PNL ++ +++
Sbjct: 1  MARRCDICGKGPMFGHNISHAHNVTRRVFYPNLHKVKVLN 40


>gi|291086415|ref|ZP_06355757.2| hypothetical protein CIT292_10430 [Citrobacter youngae ATCC
          29220]
 gi|291068198|gb|EFE06307.1| ribosomal protein L28 [Citrobacter youngae ATCC 29220]
          Length = 66

 Score = 41.2 bits (95), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 31/51 (60%)

Query: 13 MSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQG 63
          M+GN  SHA N T+RRFLPNL       +  ++   LR+S   +R ++++G
Sbjct: 1  MTGNNRSHALNATKRRFLPNLHSHRFWVESEKRFVTLRVSAKGMRVIDKKG 51


>gi|227883805|ref|ZP_04001610.1| ribosomal protein L28 [Escherichia coli 83972]
 gi|300815124|ref|ZP_07095349.1| ribosomal protein L28 [Escherichia coli MS 107-1]
 gi|300822407|ref|ZP_07102547.1| ribosomal protein L28 [Escherichia coli MS 119-7]
 gi|300898571|ref|ZP_07116902.1| ribosomal protein L28 [Escherichia coli MS 198-1]
 gi|300907678|ref|ZP_07125306.1| ribosomal protein L28 [Escherichia coli MS 84-1]
 gi|300919796|ref|ZP_07136271.1| ribosomal protein L28 [Escherichia coli MS 115-1]
 gi|300923421|ref|ZP_07139462.1| ribosomal protein L28 [Escherichia coli MS 182-1]
 gi|300927933|ref|ZP_07143492.1| ribosomal protein L28 [Escherichia coli MS 187-1]
 gi|300948029|ref|ZP_07162170.1| ribosomal protein L28 [Escherichia coli MS 116-1]
 gi|300954469|ref|ZP_07166919.1| ribosomal protein L28 [Escherichia coli MS 175-1]
 gi|300983483|ref|ZP_07176630.1| ribosomal protein L28 [Escherichia coli MS 200-1]
 gi|300984963|ref|ZP_07177215.1| ribosomal protein L28 [Escherichia coli MS 45-1]
 gi|301018966|ref|ZP_07183189.1| ribosomal protein L28 [Escherichia coli MS 69-1]
 gi|301028396|ref|ZP_07191642.1| ribosomal protein L28 [Escherichia coli MS 196-1]
 gi|301047426|ref|ZP_07194506.1| ribosomal protein L28 [Escherichia coli MS 185-1]
 gi|301303870|ref|ZP_07209989.1| ribosomal protein L28 [Escherichia coli MS 124-1]
 gi|301325319|ref|ZP_07218826.1| ribosomal protein L28 [Escherichia coli MS 78-1]
 gi|301644303|ref|ZP_07244305.1| ribosomal protein L28 [Escherichia coli MS 146-1]
 gi|309784386|ref|ZP_07679025.1| ribosomal protein L28 [Shigella dysenteriae 1617]
 gi|309797622|ref|ZP_07692010.1| ribosomal protein L28 [Escherichia coli MS 145-7]
 gi|312968022|ref|ZP_07782233.1| ribosomal protein L28 [Escherichia coli 2362-75]
 gi|312972078|ref|ZP_07786252.1| ribosomal protein L28 [Escherichia coli 1827-70]
 gi|329996934|ref|ZP_08302631.1| ribosomal protein L28 [Klebsiella sp. MS 92-3]
 gi|227839083|gb|EEJ49549.1| ribosomal protein L28 [Escherichia coli 83972]
 gi|299878507|gb|EFI86718.1| ribosomal protein L28 [Escherichia coli MS 196-1]
 gi|300300700|gb|EFJ57085.1| ribosomal protein L28 [Escherichia coli MS 185-1]
 gi|300306947|gb|EFJ61467.1| ribosomal protein L28 [Escherichia coli MS 200-1]
 gi|300318548|gb|EFJ68332.1| ribosomal protein L28 [Escherichia coli MS 175-1]
 gi|300357757|gb|EFJ73627.1| ribosomal protein L28 [Escherichia coli MS 198-1]
 gi|300399460|gb|EFJ82998.1| ribosomal protein L28 [Escherichia coli MS 69-1]
 gi|300400614|gb|EFJ84152.1| ribosomal protein L28 [Escherichia coli MS 84-1]
 gi|300408243|gb|EFJ91781.1| ribosomal protein L28 [Escherichia coli MS 45-1]
 gi|300413149|gb|EFJ96459.1| ribosomal protein L28 [Escherichia coli MS 115-1]
 gi|300420331|gb|EFK03642.1| ribosomal protein L28 [Escherichia coli MS 182-1]
 gi|300452424|gb|EFK16044.1| ribosomal protein L28 [Escherichia coli MS 116-1]
 gi|300464025|gb|EFK27518.1| ribosomal protein L28 [Escherichia coli MS 187-1]
 gi|300525054|gb|EFK46123.1| ribosomal protein L28 [Escherichia coli MS 119-7]
 gi|300532016|gb|EFK53078.1| ribosomal protein L28 [Escherichia coli MS 107-1]
 gi|300840833|gb|EFK68593.1| ribosomal protein L28 [Escherichia coli MS 124-1]
 gi|300847846|gb|EFK75606.1| ribosomal protein L28 [Escherichia coli MS 78-1]
 gi|301077341|gb|EFK92147.1| ribosomal protein L28 [Escherichia coli MS 146-1]
 gi|308118809|gb|EFO56071.1| ribosomal protein L28 [Escherichia coli MS 145-7]
 gi|308927893|gb|EFP73361.1| ribosomal protein L28 [Shigella dysenteriae 1617]
 gi|310334455|gb|EFQ00660.1| ribosomal protein L28 [Escherichia coli 1827-70]
 gi|312287281|gb|EFR15190.1| ribosomal protein L28 [Escherichia coli 2362-75]
 gi|315254023|gb|EFU33991.1| ribosomal protein L28 [Escherichia coli MS 85-1]
 gi|315285376|gb|EFU44821.1| ribosomal protein L28 [Escherichia coli MS 110-3]
 gi|315292974|gb|EFU52326.1| ribosomal protein L28 [Escherichia coli MS 153-1]
 gi|315297032|gb|EFU56312.1| ribosomal protein L28 [Escherichia coli MS 16-3]
 gi|320176304|gb|EFW51364.1| LSU ribosomal protein L28p [Shigella dysenteriae CDC 74-1112]
 gi|320179973|gb|EFW54915.1| LSU ribosomal protein L28p [Shigella boydii ATCC 9905]
 gi|320191312|gb|EFW65962.1| LSU ribosomal protein L28p [Escherichia coli O157:H7 str. EC1212]
 gi|320193856|gb|EFW68489.1| LSU ribosomal protein L28p [Escherichia coli WV_060327]
 gi|320201338|gb|EFW75919.1| LSU ribosomal protein L28p [Escherichia coli EC4100B]
 gi|320639544|gb|EFX09152.1| 50S ribosomal protein L28 [Escherichia coli O157:H7 str. G5101]
 gi|323155288|gb|EFZ41471.1| ribosomal protein L28 [Escherichia coli EPECa14]
 gi|323160755|gb|EFZ46691.1| ribosomal protein L28 [Escherichia coli E128010]
 gi|323166880|gb|EFZ52619.1| ribosomal protein L28 [Shigella sonnei 53G]
 gi|323179393|gb|EFZ64960.1| ribosomal protein L28 [Escherichia coli 1180]
 gi|323182665|gb|EFZ68068.1| ribosomal protein L28 [Escherichia coli 1357]
 gi|323189455|gb|EFZ74736.1| ribosomal protein L28 [Escherichia coli RN587/1]
 gi|324008142|gb|EGB77361.1| ribosomal protein L28 [Escherichia coli MS 57-2]
 gi|324012729|gb|EGB81948.1| ribosomal protein L28 [Escherichia coli MS 60-1]
 gi|324019746|gb|EGB88965.1| ribosomal protein L28 [Escherichia coli MS 117-3]
 gi|325499443|gb|EGC97302.1| 50S ribosomal protein L28 [Escherichia fergusonii ECD227]
 gi|326337364|gb|EGD61199.1| LSU ribosomal protein L28p [Escherichia coli O157:H7 str. 1044]
 gi|326339889|gb|EGD63696.1| LSU ribosomal protein L28p [Escherichia coli O157:H7 str. 1125]
 gi|327250763|gb|EGE62465.1| ribosomal protein L28 [Escherichia coli STEC_7v]
 gi|328539224|gb|EGF65253.1| ribosomal protein L28 [Klebsiella sp. MS 92-3]
 gi|330909699|gb|EGH38213.1| LSU ribosomal protein L28p [Escherichia coli AA86]
 gi|332084817|gb|EGI90000.1| ribosomal protein L28 [Shigella boydii 5216-82]
 gi|332345605|gb|AEE58939.1| ribosomal protein RpmB [Escherichia coli UMNK88]
 gi|332751259|gb|EGJ81662.1| ribosomal protein L28 [Shigella flexneri 2747-71]
 gi|332764161|gb|EGJ94398.1| ribosomal protein L28 [Shigella flexneri 2930-71]
 gi|332996138|gb|EGK15765.1| ribosomal protein L28 [Shigella flexneri VA-6]
 gi|332997030|gb|EGK16646.1| ribosomal protein L28 [Shigella flexneri K-218]
 gi|332997784|gb|EGK17395.1| ribosomal protein L28 [Shigella flexneri K-272]
 gi|333012844|gb|EGK32221.1| ribosomal protein L28 [Shigella flexneri K-304]
 gi|333013318|gb|EGK32690.1| ribosomal protein L28 [Shigella flexneri K-227]
          Length = 66

 Score = 41.2 bits (95), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 31/51 (60%)

Query: 13 MSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQG 63
          M+GN  SHA N T+RRFLPNL       +  ++   LR+S   +R ++++G
Sbjct: 1  MTGNNRSHALNATKRRFLPNLHSHRFWVESEKRFVTLRVSAKGMRVIDKKG 51


>gi|317051922|ref|YP_004113038.1| 50S ribosomal protein L28 [Desulfurispirillum indicum S5]
 gi|316947006|gb|ADU66482.1| ribosomal protein L28 [Desulfurispirillum indicum S5]
          Length = 61

 Score = 41.2 bits (95), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 19/33 (57%), Positives = 23/33 (69%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNL 33
          M+R CE+  K     N VSHANNKT++R LPNL
Sbjct: 1  MARRCEICGKQPQVNNNVSHANNKTKKRSLPNL 33


>gi|300939236|ref|ZP_07153916.1| ribosomal protein L28 [Escherichia coli MS 21-1]
 gi|300455878|gb|EFK19371.1| ribosomal protein L28 [Escherichia coli MS 21-1]
          Length = 66

 Score = 41.2 bits (95), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 31/51 (60%)

Query: 13 MSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQG 63
          M+GN  SHA N T+RRFLPNL       +  ++   LR+S   +R ++++G
Sbjct: 1  MTGNNRSHALNATKRRFLPNLHSHRFWVESEKRFVTLRVSAKGMRVIDKKG 51


>gi|269137425|ref|YP_003294125.1| ribosomal protein L28 [Edwardsiella tarda EIB202]
 gi|267983085|gb|ACY82914.1| ribosomal protein L28 [Edwardsiella tarda EIB202]
 gi|304557499|gb|ADM40163.1| LSU ribosomal protein L28p [Edwardsiella tarda FL6-60]
          Length = 66

 Score = 41.2 bits (95), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 31/51 (60%)

Query: 13 MSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQG 63
          M+GN  SHA N T+RRFLPNL       +  ++   LR+S   +R ++++G
Sbjct: 1  MTGNNRSHALNATKRRFLPNLHSHRFWVEGEKRFVTLRVSAKGMRVIDKKG 51


>gi|167755880|ref|ZP_02428007.1| hypothetical protein CLORAM_01397 [Clostridium ramosum DSM 1402]
 gi|237734848|ref|ZP_04565329.1| 50S ribosomal protein L28 [Mollicutes bacterium D7]
 gi|167704819|gb|EDS19398.1| hypothetical protein CLORAM_01397 [Clostridium ramosum DSM 1402]
 gi|229382176|gb|EEO32267.1| 50S ribosomal protein L28 [Coprobacillus sp. D7]
          Length = 61

 Score = 41.2 bits (95), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 38/61 (62%), Gaps = 2/61 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR C+++ K  MSGN  SHA N +RR++  NL + T++ D   +   +RIS   LR++ 
Sbjct: 1  MSRKCQISGKGPMSGNTRSHALNSSRRKWNVNLQKATILVD--GKPTTVRISARELRTLR 58

Query: 61 R 61
          +
Sbjct: 59 K 59


>gi|310287798|ref|YP_003939056.1| ribosomal protein L28 [Bifidobacterium bifidum S17]
 gi|309251734|gb|ADO53482.1| ribosomal protein L28 [Bifidobacterium bifidum S17]
          Length = 115

 Score = 41.2 bits (95), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 36/63 (57%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS+ C++      +GN+VSH++ KTRRRF PNL         + +   L +S   +++++
Sbjct: 18 MSKQCQILGTRASTGNRVSHSHRKTRRRFNPNLQTKRYWVPSLGRHVTLTVSVKGMKTID 77

Query: 61 RQG 63
          R G
Sbjct: 78 RIG 80


>gi|224283446|ref|ZP_03646768.1| ribosomal protein L28 [Bifidobacterium bifidum NCIMB 41171]
          Length = 115

 Score = 41.2 bits (95), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 36/63 (57%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS+ C++      +GN+VSH++ KTRRRF PNL         + +   L +S   +++++
Sbjct: 18 MSKQCQILGTRASTGNRVSHSHRKTRRRFNPNLQTKRYWVPSLGRHVTLTVSVKGMKTID 77

Query: 61 RQG 63
          R G
Sbjct: 78 RIG 80


>gi|315925834|ref|ZP_07922041.1| 50S ribosomal protein L28 [Pseudoramibacter alactolyticus ATCC
          23263]
 gi|315620943|gb|EFV00917.1| 50S ribosomal protein L28 [Pseudoramibacter alactolyticus ATCC
          23263]
          Length = 62

 Score = 41.2 bits (95), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 29/41 (70%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISD 41
          M++ C + KK+V+SGN VSH+N   +R + PNL +I ++ D
Sbjct: 1  MAKECFVCKKSVVSGNTVSHSNKHNKRMWKPNLQKIKILVD 41


>gi|311064682|ref|YP_003971407.1| 50S ribosomal protein L28P RpmB [Bifidobacterium bifidum PRL2010]
 gi|310867001|gb|ADP36370.1| RpmB LSU ribosomal protein L28P [Bifidobacterium bifidum PRL2010]
          Length = 98

 Score = 41.2 bits (95), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 36/63 (57%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS+ C++      +GN+VSH++ KTRRRF PNL         + +   L +S   +++++
Sbjct: 1  MSKQCQILGTRASTGNRVSHSHRKTRRRFNPNLQTKRYWVPSLGRHVTLTVSVKGMKTID 60

Query: 61 RQG 63
          R G
Sbjct: 61 RIG 63


>gi|255947924|ref|XP_002564729.1| Pc22g07040 [Penicillium chrysogenum Wisconsin 54-1255]
 gi|211591746|emb|CAP97992.1| Pc22g07040 [Penicillium chrysogenum Wisconsin 54-1255]
          Length = 216

 Score = 41.2 bits (95), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 45/81 (55%), Gaps = 5/81 (6%)

Query: 15  GNKVSHANN--KTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFLSNS 72
           GNK+S   N  KTRR + PN+ R  + S  + +   +++++ ALRS+ +  GLD +L + 
Sbjct: 75  GNKISKGRNEGKTRRSWKPNVRRKKIESKALGESVYIKVTRRALRSIYKAKGLDNYLLSD 134

Query: 73  KK---ENLSARMRTLRSQILK 90
           +    + L      LR QI++
Sbjct: 135 RPTRLKELGPFGWNLRHQIMQ 155


>gi|313140599|ref|ZP_07802792.1| 50S ribosomal protein L28-2 [Bifidobacterium bifidum NCIMB 41171]
 gi|313133109|gb|EFR50726.1| 50S ribosomal protein L28-2 [Bifidobacterium bifidum NCIMB 41171]
          Length = 98

 Score = 41.2 bits (95), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 36/63 (57%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS+ C++      +GN+VSH++ KTRRRF PNL         + +   L +S   +++++
Sbjct: 1  MSKQCQILGTRASTGNRVSHSHRKTRRRFNPNLQTKRYWVPSLGRHVTLTVSVKGMKTID 60

Query: 61 RQG 63
          R G
Sbjct: 61 RIG 63


>gi|258648345|ref|ZP_05735814.1| ribosomal protein L28 [Prevotella tannerae ATCC 51259]
 gi|260851510|gb|EEX71379.1| ribosomal protein L28 [Prevotella tannerae ATCC 51259]
          Length = 86

 Score = 41.2 bits (95), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 27/72 (37%), Positives = 38/72 (52%), Gaps = 1/72 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS++C+LT K  M GN VS +  +T+R F  NL          E    LRIS   LR + 
Sbjct: 1  MSKICQLTGKKAMIGNNVSKSKRRTKRSFDVNLFTKKFYYVEQECWVSLRISAAGLRLIN 60

Query: 61 RQGGLDRFLSNS 72
          +  GLD  L+++
Sbjct: 61 KV-GLDAALNSA 71


>gi|116205609|ref|XP_001228615.1| hypothetical protein CHGG_10688 [Chaetomium globosum CBS 148.51]
 gi|88176816|gb|EAQ84284.1| hypothetical protein CHGG_10688 [Chaetomium globosum CBS 148.51]
          Length = 254

 Score = 41.2 bits (95), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 27/80 (33%), Positives = 44/80 (55%), Gaps = 4/80 (5%)

Query: 15  GNKVSHANN-KTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFL---S 70
           GN VS  NN KTRR++ PN+    L S  +    + R++   LR+V++ GGLD +L   +
Sbjct: 88  GNNVSERNNIKTRRQWRPNVHHKRLWSASLGVFVRTRVTARVLRTVDKAGGLDEYLLGRT 147

Query: 71  NSKKENLSARMRTLRSQILK 90
             +  +L      LR +I++
Sbjct: 148 PQRVRDLGPWGWKLRWRIMQ 167


>gi|326383108|ref|ZP_08204797.1| ribosomal protein L28 [Gordonia neofelifaecis NRRL B-59395]
 gi|326198244|gb|EGD55429.1| ribosomal protein L28 [Gordonia neofelifaecis NRRL B-59395]
          Length = 78

 Score = 41.2 bits (95), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 36/63 (57%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+  C++T +    G +VSH++ +T R++ PNL R T     + +   LR+S   ++ ++
Sbjct: 1  MAARCQVTGRVPGFGRQVSHSHRRTSRQWRPNLFRKTYWVPSLSRNVTLRVSAKGIKVID 60

Query: 61 RQG 63
          R G
Sbjct: 61 RDG 63


>gi|118471258|ref|YP_890290.1| ribosomal protein L28 [Mycobacterium smegmatis str. MC2 155]
 gi|118172545|gb|ABK73441.1| ribosomal protein L28 [Mycobacterium smegmatis str. MC2 155]
          Length = 78

 Score = 40.8 bits (94), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 36/63 (57%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS  C++T +    GN VSH++ +T RR+ PN+   T       ++ +LR+S   ++ ++
Sbjct: 1  MSAHCQVTGRGPGFGNSVSHSHRRTPRRWDPNIQNKTYYLPSEGRRIRLRVSAKGIKVID 60

Query: 61 RQG 63
          R G
Sbjct: 61 RDG 63


>gi|293402253|ref|ZP_06646391.1| ribosomal protein L28 [Erysipelotrichaceae bacterium 5_2_54FAA]
 gi|291304360|gb|EFE45611.1| ribosomal protein L28 [Erysipelotrichaceae bacterium 5_2_54FAA]
          Length = 63

 Score = 40.8 bits (94), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 40/65 (61%), Gaps = 2/65 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS+VC +T K  +SGNK SH+   +RR +  NL ++ ++ D   Q   +RIS  AL++++
Sbjct: 1  MSKVCAITGKGPLSGNKRSHSMRASRRNWNVNLQKVKVVVDGKPQ--TIRISARALKTLK 58

Query: 61 RQGGL 65
           +  +
Sbjct: 59 NKNAI 63


>gi|134097360|ref|YP_001103021.1| 50S ribosomal protein L28 [Saccharopolyspora erythraea NRRL 2338]
 gi|291009081|ref|ZP_06567054.1| 50S ribosomal protein L28 [Saccharopolyspora erythraea NRRL 2338]
 gi|133909983|emb|CAM00095.1| 50S ribosomal protein L28 [Saccharopolyspora erythraea NRRL 2338]
          Length = 78

 Score = 40.8 bits (94), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 39/63 (61%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS  C++T K    G +VSH++ +T RR++PN+ R         +  +LR+S  A+++++
Sbjct: 1  MSVRCQVTGKKPGYGKQVSHSHVRTNRRWMPNVQRRRYWLPSEGRWVRLRLSAKAMKTID 60

Query: 61 RQG 63
          R+G
Sbjct: 61 RRG 63


>gi|116514995|ref|YP_802624.1| 50S ribosomal protein L28 [Buchnera aphidicola str. Cc (Cinara
          cedri)]
 gi|122285609|sp|Q058B8|RL28_BUCCC RecName: Full=50S ribosomal protein L28
 gi|116256849|gb|ABJ90531.1| 50S ribosomal protein L28 [Buchnera aphidicola str. Cc (Cinara
          cedri)]
          Length = 73

 Score = 40.8 bits (94), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 37/63 (58%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M ++C++TKK  M G   SHA N T+++F  N+   T      ++K ++RI+K  +R + 
Sbjct: 1  MPKICQITKKKSMLGQNRSHAMNATKKKFSLNIQYHTFWLPEKKKKIRIRITKKGIRMIN 60

Query: 61 RQG 63
          + G
Sbjct: 61 KFG 63


>gi|269792516|ref|YP_003317420.1| 50S ribosomal protein L28 [Thermanaerovibrio acidaminovorans DSM
          6589]
 gi|269100151|gb|ACZ19138.1| ribosomal protein L28 [Thermanaerovibrio acidaminovorans DSM
          6589]
          Length = 64

 Score = 40.8 bits (94), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 18/33 (54%), Positives = 23/33 (69%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNL 33
          MSRVC+   +   +GN VSH+N  TRRR+L NL
Sbjct: 1  MSRVCDCCGRGPQTGNAVSHSNRHTRRRWLINL 33


>gi|167957091|ref|ZP_02544165.1| hypothetical protein cdiviTM7_00351 [candidate division TM7
          single-cell isolate TM7c]
          Length = 68

 Score = 40.8 bits (94), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 38/63 (60%), Gaps = 2/63 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+  C+LT K    GN VS +  +T+R F PNL + T + D   QK  + +S  A+R+++
Sbjct: 1  MASRCDLTGKGKQYGNNVSFSLRRTKRVFKPNLQKKTFVVD--GQKITMTLSTQAIRTLK 58

Query: 61 RQG 63
          ++G
Sbjct: 59 KKG 61


>gi|312866259|ref|ZP_07726478.1| putative ribosomal protein L28 [Streptococcus downei F0415]
 gi|311098232|gb|EFQ56457.1| putative ribosomal protein L28 [Streptococcus downei F0415]
          Length = 62

 Score = 40.8 bits (94), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 37/63 (58%), Gaps = 4/63 (6%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS-- 58
          M++VC  T +   S N  SHA NKT+R   PNL ++T++ D   +K  +  S  AL+S  
Sbjct: 1  MAKVCYFTGRKTKSANNRSHAMNKTKRAVKPNLQKVTILVDGKPKK--VWASARALKSGK 58

Query: 59 VER 61
          VER
Sbjct: 59 VER 61


>gi|8928328|sp|O50656|RL28_SELRU RecName: Full=50S ribosomal protein L28
 gi|2897823|dbj|BAA24922.1| hypothetical protein [Selenomonas ruminantium]
 gi|28804805|dbj|BAC57939.1| ribosomal protein L28 [Selenomonas ruminantium]
          Length = 63

 Score = 40.8 bits (94), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 28/41 (68%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISD 41
          M+ VCE+  K  +SGN VSH++ KTRR + PN+ R+  + +
Sbjct: 1  MASVCEICAKGELSGNNVSHSHLKTRRTWKPNIQRVRAVVE 41


>gi|322384322|ref|ZP_08058020.1| 50S ribosomal protein L28-like protein [Paenibacillus larvae
          subsp. larvae B-3650]
 gi|321150824|gb|EFX44261.1| 50S ribosomal protein L28-like protein [Paenibacillus larvae
          subsp. larvae B-3650]
          Length = 62

 Score = 40.8 bits (94), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 37/58 (63%), Gaps = 2/58 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS 58
          MSR C +T ++  SGN VSHANNK +R +  N+ ++ ++ D   ++  + +S  AL+S
Sbjct: 1  MSRKCYVTGRSPKSGNHVSHANNKNKRSWGVNVQKVRILVDGKPKR--VYVSARALKS 56


>gi|161616808|ref|YP_001590773.1| hypothetical protein SPAB_04627 [Salmonella enterica subsp.
          enterica serovar Paratyphi B str. SPB7]
 gi|161366172|gb|ABX69940.1| hypothetical protein SPAB_04627 [Salmonella enterica subsp.
          enterica serovar Paratyphi B str. SPB7]
 gi|321226781|gb|EFX51831.1| LSU ribosomal protein L28p [Salmonella enterica subsp. enterica
          serovar Typhimurium str. TN061786]
 gi|322680941|gb|EFY76975.1| 50S ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Montevideo str. 413180]
 gi|323210479|gb|EFZ95365.1| 50S ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Montevideo str. 556152]
 gi|323257302|gb|EGA41001.1| 50S ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Montevideo str. IA_2010008283]
          Length = 66

 Score = 40.8 bits (94), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 31/51 (60%)

Query: 13 MSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQG 63
          M+GN  SHA N T+RRFLPNL       +  ++   LR+S   +R ++++G
Sbjct: 1  MTGNNRSHALNATKRRFLPNLHSHRFWVESEKRFVTLRVSAKGMRIIDKKG 51


>gi|317121765|ref|YP_004101768.1| 50S ribosomal protein L28P [Thermaerobacter marianensis DSM
          12885]
 gi|315591745|gb|ADU51041.1| LSU ribosomal protein L28P [Thermaerobacter marianensis DSM
          12885]
          Length = 65

 Score = 40.8 bits (94), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 28/41 (68%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISD 41
          M+R C +  K V  GN+VSH+N K+RR ++PNL R+  ++ 
Sbjct: 3  MARRCAICGKGVDYGNQVSHSNRKSRRIWVPNLQRVRAVTP 43


>gi|157413325|ref|YP_001484191.1| 50S ribosomal protein L28 [Prochlorococcus marinus str. MIT 9215]
 gi|166987914|sp|A8G4S4|RL28_PROM2 RecName: Full=50S ribosomal protein L28
 gi|157387900|gb|ABV50605.1| 50S ribosomal protein L28 [Prochlorococcus marinus str. MIT 9215]
          Length = 78

 Score = 40.8 bits (94), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 25/68 (36%), Positives = 42/68 (61%), Gaps = 1/68 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVCELT     +G  VSH++ +T++    NL +  L  +  ++   ++IS  AL+S++
Sbjct: 1  MSRVCELTGAKANNGMAVSHSHIRTKKLQQVNLQKRRLWWEEGKKWVNIKISTKALKSIQ 60

Query: 61 RQGGLDRF 68
          +  GLD+F
Sbjct: 61 KV-GLDKF 67


>gi|291166054|gb|EFE28100.1| 50S ribosomal protein L28 [Filifactor alocis ATCC 35896]
          Length = 62

 Score = 40.8 bits (94), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 23/33 (69%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNL 33
          M+RVC++  K  MSGN VSH+N   +R + PNL
Sbjct: 1  MARVCDVCGKGKMSGNAVSHSNRHNKRTWAPNL 33


>gi|260912087|ref|ZP_05918645.1| 50S ribosomal protein L28 [Prevotella sp. oral taxon 472 str.
          F0295]
 gi|288928193|ref|ZP_06422040.1| 50S ribosomal protein L28 [Prevotella sp. oral taxon 317 str.
          F0108]
 gi|260633785|gb|EEX51917.1| 50S ribosomal protein L28 [Prevotella sp. oral taxon 472 str.
          F0295]
 gi|288331027|gb|EFC69611.1| 50S ribosomal protein L28 [Prevotella sp. oral taxon 317 str.
          F0108]
          Length = 87

 Score = 40.8 bits (94), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 36/69 (52%), Gaps = 1/69 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS++C++T K  M GN VSH+ ++T+R F  NL               L+IS   LR + 
Sbjct: 1  MSKICQITGKKAMVGNNVSHSKHRTKRSFDVNLFSKKFYYVEEGCWISLKISAAGLRLIN 60

Query: 61 RQGGLDRFL 69
          +  GLD  L
Sbjct: 61 KV-GLDAAL 68


>gi|313890327|ref|ZP_07823959.1| ribosomal protein L28 [Streptococcus pseudoporcinus SPIN 20026]
 gi|332523121|ref|ZP_08399373.1| ribosomal protein L28 [Streptococcus porcinus str. Jelinkova 176]
 gi|313121313|gb|EFR44420.1| ribosomal protein L28 [Streptococcus pseudoporcinus SPIN 20026]
 gi|332314385|gb|EGJ27370.1| ribosomal protein L28 [Streptococcus porcinus str. Jelinkova 176]
          Length = 62

 Score = 40.8 bits (94), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 25/63 (39%), Positives = 39/63 (61%), Gaps = 4/63 (6%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS-- 58
          M++VC  T +  +SGN  SHA N+T+R   PNL ++T++ +   +K  +  S  AL+S  
Sbjct: 1  MAKVCYFTGRKTVSGNNRSHAMNQTKRTVKPNLQKVTIMVNGKPKK--VWASARALKSGQ 58

Query: 59 VER 61
          VER
Sbjct: 59 VER 61


>gi|50955925|ref|YP_063213.1| 50S ribosomal protein L28 [Leifsonia xyli subsp. xyli str.
          CTCB07]
 gi|67461387|sp|Q6ABY4|RL28_LEIXX RecName: Full=50S ribosomal protein L28
 gi|50952407|gb|AAT90108.1| 50S ribosomal protein L28 [Leifsonia xyli subsp. xyli str.
          CTCB07]
          Length = 78

 Score = 40.8 bits (94), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 37/63 (58%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+ VC++T  T   G+ +SH++ +T+RRF PN+ + T     + +   L +S   ++ ++
Sbjct: 1  MAAVCQVTGATPGFGHSISHSHRRTKRRFDPNIQKKTYYVPSLRRNVTLTLSAKGIKVID 60

Query: 61 RQG 63
           +G
Sbjct: 61 ARG 63


>gi|126696295|ref|YP_001091181.1| 50S ribosomal protein L28 [Prochlorococcus marinus str. MIT 9301]
 gi|166226598|sp|A3PCV5|RL28_PROM0 RecName: Full=50S ribosomal protein L28
 gi|126543338|gb|ABO17580.1| 50S ribosomal protein L28 [Prochlorococcus marinus str. MIT 9301]
          Length = 78

 Score = 40.8 bits (94), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 25/68 (36%), Positives = 42/68 (61%), Gaps = 1/68 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVCELT     +G  VSH++ +T++    NL +  L  +  ++   ++IS  AL+S++
Sbjct: 1  MSRVCELTGAKANNGMAVSHSHIRTKKLQQVNLQKRRLWWEEGKKWVNIKISTKALKSIQ 60

Query: 61 RQGGLDRF 68
          +  GLD+F
Sbjct: 61 KV-GLDKF 67


>gi|294155875|ref|YP_003560259.1| 50S ribosomal protein L28 [Mycoplasma crocodyli MP145]
 gi|291600100|gb|ADE19596.1| 50S ribosomal protein L28 [Mycoplasma crocodyli MP145]
          Length = 63

 Score = 40.8 bits (94), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 25/63 (39%), Positives = 39/63 (61%), Gaps = 2/63 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRV  LT +   +GNK SHA N T+R+F  NL +I L  D   Q+  +R+S   +++++
Sbjct: 1  MSRVDVLTGRGPQTGNKRSHALNATKRKFNVNLQKIKLNLD--GQRVTVRVSAKTIKTLK 58

Query: 61 RQG 63
           +G
Sbjct: 59 TKG 61


>gi|309776524|ref|ZP_07671505.1| ribosomal protein L28 [Erysipelotrichaceae bacterium 3_1_53]
 gi|308915701|gb|EFP61460.1| ribosomal protein L28 [Erysipelotrichaceae bacterium 3_1_53]
          Length = 63

 Score = 40.8 bits (94), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 38/60 (63%), Gaps = 2/60 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS+VC +T K  +SGNK SH+   +RR +  NL ++ ++ D   Q   +RIS  AL++++
Sbjct: 1  MSKVCAITGKGPLSGNKRSHSMRASRRNWNVNLQKVKVVVDGKPQ--TIRISARALKTLK 58


>gi|302342676|ref|YP_003807205.1| ribosomal protein L28 [Desulfarculus baarsii DSM 2075]
 gi|301639289|gb|ADK84611.1| ribosomal protein L28 [Desulfarculus baarsii DSM 2075]
          Length = 63

 Score = 40.8 bits (94), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 18/33 (54%), Positives = 22/33 (66%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNL 33
          MS+VC    K    G  +SHA+NKT+RRF PNL
Sbjct: 1  MSQVCAFCGKKPQVGYNISHAHNKTKRRFNPNL 33


>gi|311743542|ref|ZP_07717348.1| 50S ribosomal protein L28 [Aeromicrobium marinum DSM 15272]
 gi|311312672|gb|EFQ82583.1| 50S ribosomal protein L28 [Aeromicrobium marinum DSM 15272]
          Length = 90

 Score = 40.8 bits (94), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 26/84 (30%), Positives = 46/84 (54%), Gaps = 6/84 (7%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC +T      G+ VSH++ +T+RRF  N+ R    +  + +   L +S   +++V+
Sbjct: 13 MSRVCPVTGAQPGFGHHVSHSHRRTKRRFDVNIQRKRYWAPTLGRHVTLTLSARGIKTVD 72

Query: 61 RQGGLDRFLSNSKKENLSARMRTL 84
           Q G+D  ++     +L+AR  T 
Sbjct: 73 -QRGIDAVVA-----DLAARGVTF 90


>gi|169609064|ref|XP_001797951.1| hypothetical protein SNOG_07617 [Phaeosphaeria nodorum SN15]
 gi|111063963|gb|EAT85083.1| hypothetical protein SNOG_07617 [Phaeosphaeria nodorum SN15]
          Length = 470

 Score = 40.8 bits (94), Expect = 0.069,   Method: Composition-based stats.
 Identities = 24/64 (37%), Positives = 38/64 (59%), Gaps = 1/64 (1%)

Query: 15  GNKVSH-ANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFLSNSK 73
           GN VS     KTRR + PN+    L S  +++K +LRI+   L++++R+GGLD +L    
Sbjct: 92  GNNVSEKTETKTRRDWKPNVLSKGLYSVALKKKIKLRITSRVLKTMDREGGLDEYLLKDN 151

Query: 74  KENL 77
           +  L
Sbjct: 152 EHRL 155


>gi|91070560|gb|ABE11464.1| 50S ribosomal protein L28 [uncultured Prochlorococcus marinus
          clone HOT0M-7B6]
          Length = 78

 Score = 40.8 bits (94), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 25/68 (36%), Positives = 42/68 (61%), Gaps = 1/68 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVCELT     +G  VSH++ +T++    NL +  L  +  ++   ++IS  AL+S++
Sbjct: 1  MSRVCELTGAKANNGMAVSHSHIRTKKLQQVNLQKRRLWWEEGKKWVNIKISTKALKSIQ 60

Query: 61 RQGGLDRF 68
          +  GLD+F
Sbjct: 61 KV-GLDKF 67


>gi|14195139|sp|Q9MSA0|RK28_GALSU RecName: Full=50S ribosomal protein L28, chloroplastic
          Length = 68

 Score = 40.4 bits (93), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 43/69 (62%), Gaps = 1/69 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+R C+L  KT  + NKVSH+N+K++R    NL +  + S + ++  +LRIS   ++ + 
Sbjct: 1  MTRKCQLLFKTSNTANKVSHSNHKSKRLQFVNLQKKKVWSSLKKKWIKLRISTKMIKILN 60

Query: 61 RQGGLDRFL 69
          ++  +D FL
Sbjct: 61 KK-NIDYFL 68


>gi|308178360|ref|YP_003917766.1| 50S ribosomal protein L28 [Arthrobacter arilaitensis Re117]
 gi|307745823|emb|CBT76795.1| 50S ribosomal protein L28 [Arthrobacter arilaitensis Re117]
          Length = 78

 Score = 40.4 bits (93), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 19/71 (26%), Positives = 42/71 (59%), Gaps = 1/71 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+ VC++T  T   G+ +SH++ + +RRF PN+ + T     + +K  L +S   ++ ++
Sbjct: 1  MAAVCQVTGTTPAFGHSISHSHRRNKRRFDPNIQKKTYYVPSLRRKVTLTLSVKGIKVID 60

Query: 61 RQGGLDRFLSN 71
           + G+D  +++
Sbjct: 61 AR-GIDAVIAD 70


>gi|8925948|gb|AAF81680.1|AF233069_3 50S ribosomal protein [Galdieria sulphuraria]
          Length = 72

 Score = 40.4 bits (93), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 43/69 (62%), Gaps = 1/69 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+R C+L  KT  + NKVSH+N+K++R    NL +  + S + ++  +LRIS   ++ + 
Sbjct: 5  MTRKCQLLFKTSNTANKVSHSNHKSKRLQFVNLQKKKVWSSLKKKWIKLRISTKMIKILN 64

Query: 61 RQGGLDRFL 69
          ++  +D FL
Sbjct: 65 KK-NIDYFL 72


>gi|323358133|ref|YP_004224529.1| ribosomal protein L28 [Microbacterium testaceum StLB037]
 gi|323274504|dbj|BAJ74649.1| ribosomal protein L28 [Microbacterium testaceum StLB037]
          Length = 78

 Score = 40.4 bits (93), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 17/63 (26%), Positives = 37/63 (58%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+ VC++T      G+ +SH++ +T+RRF PN+ + T     + +  +L +S   ++ ++
Sbjct: 1  MAAVCQVTGAVPGFGHNISHSHRRTKRRFDPNVQKKTYFVPSLGRNIKLNVSAKGIKVID 60

Query: 61 RQG 63
           +G
Sbjct: 61 ARG 63


>gi|66812698|ref|XP_640528.1| hypothetical protein DDB_G0281601 [Dictyostelium discoideum AX4]
 gi|60468559|gb|EAL66562.1| hypothetical protein DDB_G0281601 [Dictyostelium discoideum AX4]
          Length = 142

 Score = 40.4 bits (93), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 16/72 (22%), Positives = 43/72 (59%)

Query: 10 KTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFL 69
          K ++  ++ S +  KTRR + PN+   T  SD+++   ++ ++   +R +++ G  D ++
Sbjct: 28 KDIIFSDQSSFSTRKTRRTWKPNVQTKTYHSDVLDSNIRVSLTTYTIRCIDKAGSFDNYI 87

Query: 70 SNSKKENLSARM 81
           ++K ++L++ +
Sbjct: 88 IHTKDKDLASEL 99


>gi|226502588|ref|NP_001148032.1| LOC100281641 [Zea mays]
 gi|195615378|gb|ACG29519.1| 50S ribosomal protein L28 [Zea mays]
          Length = 141

 Score = 40.4 bits (93), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 36/61 (59%)

Query: 3   RVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQ 62
           RVC  T K     NKVS +N+KT+++   NL    L  +  ++  +LR+S  AL+++E+ 
Sbjct: 66  RVCPFTDKKTNRANKVSFSNHKTKKQQFVNLQYKKLWWEAGKRFVKLRLSTKALKTIEKH 125

Query: 63  G 63
           G
Sbjct: 126 G 126


>gi|308234574|ref|ZP_07665311.1| ribosomal protein L28 [Atopobium vaginae DSM 15829]
 gi|328944363|ref|ZP_08241826.1| 50S ribosomal protein L28 [Atopobium vaginae DSM 15829]
 gi|327491078|gb|EGF22854.1| 50S ribosomal protein L28 [Atopobium vaginae DSM 15829]
          Length = 66

 Score = 40.4 bits (93), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 27/41 (65%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISD 41
          MS+VC++  K  ++G  +SH++    R+F PN+ R+T+  D
Sbjct: 1  MSKVCDICGKHAVAGRSISHSHRTVNRKFKPNIQRVTVFED 41


>gi|282859677|ref|ZP_06268779.1| ribosomal protein L28 [Prevotella bivia JCVIHMP010]
 gi|282587595|gb|EFB92798.1| ribosomal protein L28 [Prevotella bivia JCVIHMP010]
          Length = 87

 Score = 40.4 bits (93), Expect = 0.083,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 33/63 (52%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS++C++T K    GN VSH+ ++T+R F  NL          E    L+IS   LR + 
Sbjct: 1  MSKICQITGKKAQLGNNVSHSKHRTKRSFDVNLFSKKFYYVEEECWISLKISAAGLRLIN 60

Query: 61 RQG 63
          + G
Sbjct: 61 KVG 63


>gi|189200168|ref|XP_001936421.1| 50S ribosomal protein L24 [Pyrenophora tritici-repentis Pt-1C-BFP]
 gi|187983520|gb|EDU49008.1| 50S ribosomal protein L24 [Pyrenophora tritici-repentis Pt-1C-BFP]
          Length = 488

 Score = 40.4 bits (93), Expect = 0.084,   Method: Composition-based stats.
 Identities = 23/61 (37%), Positives = 39/61 (63%), Gaps = 1/61 (1%)

Query: 10  KTVMSGNKVSH-ANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRF 68
           K +  GN VS     KTRR + PN+ + +L S  +++K +L ++K  L+ ++R+GGLD +
Sbjct: 91  KRIRFGNNVSKKTETKTRRNWKPNVLQKSLYSVALKKKIKLVLAKHILKIIDREGGLDEY 150

Query: 69  L 69
           L
Sbjct: 151 L 151


>gi|242034375|ref|XP_002464582.1| hypothetical protein SORBIDRAFT_01g021250 [Sorghum bicolor]
 gi|241918436|gb|EER91580.1| hypothetical protein SORBIDRAFT_01g021250 [Sorghum bicolor]
          Length = 145

 Score = 40.4 bits (93), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 36/61 (59%)

Query: 3   RVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQ 62
           RVC  T K     NKVS +N+KT+++   NL    L  +  ++  +LR+S  AL+++E+ 
Sbjct: 70  RVCPFTDKKTNRANKVSFSNHKTKKQQFVNLQYKKLWWEAGKRFVKLRLSTKALKTIEKH 129

Query: 63  G 63
           G
Sbjct: 130 G 130


>gi|240047798|ref|YP_002961186.1| 50S ribosomal protein L28 [Mycoplasma conjunctivae HRC/581]
 gi|239985370|emb|CAT05383.1| 50S ribosomal protein L28 [Mycoplasma conjunctivae]
          Length = 64

 Score = 40.4 bits (93), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 40/63 (63%), Gaps = 1/63 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+R  +LT K  +SGN  SHA N T+R+F  NL ++ +I+    QK +L++S    +++ 
Sbjct: 1  MARRDDLTFKGPLSGNNRSHALNATKRKFNLNLQKV-VITTSSGQKIKLKVSAKTKKTLR 59

Query: 61 RQG 63
          +QG
Sbjct: 60 KQG 62


>gi|195628336|gb|ACG35998.1| 50S ribosomal protein L28 [Zea mays]
          Length = 141

 Score = 40.4 bits (93), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 38/64 (59%), Gaps = 1/64 (1%)

Query: 3   RVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQ 62
           RVC  T K     NKVS +N+KT+++   NL    L  +  ++  +LR+S  AL+++E+ 
Sbjct: 66  RVCPFTGKKTNRANKVSFSNHKTKKQQFVNLQYKKLWWEAGKRFVKLRLSTKALKTIEKH 125

Query: 63  GGLD 66
            GLD
Sbjct: 126 -GLD 128


>gi|226493229|ref|NP_001149595.1| 50S ribosomal protein L28 [Zea mays]
 gi|223948777|gb|ACN28472.1| unknown [Zea mays]
          Length = 141

 Score = 40.4 bits (93), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 38/64 (59%), Gaps = 1/64 (1%)

Query: 3   RVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQ 62
           RVC  T K     NKVS +N+KT+++   NL    L  +  ++  +LR+S  AL+++E+ 
Sbjct: 66  RVCPFTGKKTNRANKVSFSNHKTKKQQFVNLQYKKLWWEAGKRFVKLRLSTKALKTIEKH 125

Query: 63  GGLD 66
            GLD
Sbjct: 126 -GLD 128


>gi|198274632|ref|ZP_03207164.1| hypothetical protein BACPLE_00784 [Bacteroides plebeius DSM
          17135]
 gi|198272079|gb|EDY96348.1| hypothetical protein BACPLE_00784 [Bacteroides plebeius DSM
          17135]
          Length = 86

 Score = 40.0 bits (92), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 43/74 (58%), Gaps = 5/74 (6%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCA--LRS 58
          MS++C++T K  + GN VSH+  +T+R F  NL   T     +EQ   + ++ CA  LR 
Sbjct: 1  MSKICQITGKKALIGNNVSHSKRRTKRTFDVNL--FTKKFYYVEQDCWISLNICANGLRV 58

Query: 59 VERQGGLDRFLSNS 72
          + ++ GLD  L+ +
Sbjct: 59 INKK-GLDAALNEA 71


>gi|157364509|ref|YP_001471276.1| ribosomal protein L28 [Thermotoga lettingae TMO]
 gi|166987917|sp|A8F7S8|RL28_THELT RecName: Full=50S ribosomal protein L28
 gi|157315113|gb|ABV34212.1| ribosomal protein L28 [Thermotoga lettingae TMO]
          Length = 65

 Score = 40.0 bits (92), Expect = 0.098,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 28/41 (68%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISD 41
          M++ CE+  K  ++G  VSH+N  TRR F PNL +I +I++
Sbjct: 1  MAKRCEICGKGPVAGKNVSHSNRHTRRMFRPNLQKIRVITE 41


>gi|24378640|ref|NP_720595.1| 50S ribosomal protein L28 [Streptococcus mutans UA159]
 gi|290579636|ref|YP_003484028.1| 50S ribosomal protein L28 [Streptococcus mutans NN2025]
 gi|67461523|sp|Q8DWE1|RL28_STRMU RecName: Full=50S ribosomal protein L28
 gi|24376498|gb|AAN57901.1|AE014863_9 50S ribosomal protein L28 [Streptococcus mutans UA159]
 gi|254996535|dbj|BAH87136.1| 50S ribosomal protein L28 [Streptococcus mutans NN2025]
          Length = 62

 Score = 40.0 bits (92), Expect = 0.099,   Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 38/63 (60%), Gaps = 4/63 (6%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS-- 58
          M++VC  T +  +S N  SHA NKT+R   PNL ++T++ D   +K  +  S  AL+S  
Sbjct: 1  MAKVCYFTGRKTVSANNRSHAMNKTKRVAKPNLQKVTVLIDGKPKK--VWASARALKSGK 58

Query: 59 VER 61
          VER
Sbjct: 59 VER 61


>gi|328955655|ref|YP_004372988.1| LSU ribosomal protein L28P [Coriobacterium glomerans PW2]
 gi|328455979|gb|AEB07173.1| LSU ribosomal protein L28P [Coriobacterium glomerans PW2]
          Length = 62

 Score = 40.0 bits (92), Expect = 0.100,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 31/49 (63%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQL 49
          MS+VCE+  K  ++G  +SH++  T R+F PN+ R+ ++ D   +K  +
Sbjct: 1  MSKVCEICGKHPVAGRSISHSHRVTNRKFRPNIQRVHVVMDGHRRKMNV 49


>gi|253575784|ref|ZP_04853119.1| 50S ribosomal protein L28 [Paenibacillus sp. oral taxon 786 str.
          D14]
 gi|251844827|gb|EES72840.1| 50S ribosomal protein L28 [Paenibacillus sp. oral taxon 786 str.
          D14]
          Length = 62

 Score = 40.0 bits (92), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS 58
          M+R C +T K   SGN VSHANN+ RR +  N+ ++ ++ D   ++  + +S  AL+S
Sbjct: 1  MARKCYVTGKKPGSGNHVSHANNRNRRSWGVNVQKVRILVDGKPKR--VYVSTRALKS 56


>gi|15829167|ref|NP_326527.1| 50S ribosomal protein L28 [Mycoplasma pulmonis UAB CTIP]
 gi|20139641|sp|Q98PM6|RL28_MYCPU RecName: Full=50S ribosomal protein L28
 gi|14090111|emb|CAC13869.1| 50S RIBOSOMAL PROTEIN L28 [Mycoplasma pulmonis]
          Length = 63

 Score = 40.0 bits (92), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 24/62 (38%), Positives = 38/62 (61%), Gaps = 2/62 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR  +LT K  M GN  SHA N TRRRF  NL +++++  +  +K  L++S    +++ 
Sbjct: 1  MSRRDDLTGKGPMFGNNRSHALNATRRRFNLNLQKVSVV--VNGRKVNLKVSAKTAKTLR 58

Query: 61 RQ 62
          R+
Sbjct: 59 RK 60


>gi|224373597|ref|YP_002607969.1| ribosomal protein L28 [Nautilia profundicola AmH]
 gi|254801370|sp|B9L6I1|RL28_NAUPA RecName: Full=50S ribosomal protein L28
 gi|223589830|gb|ACM93566.1| ribosomal protein L28 [Nautilia profundicola AmH]
          Length = 61

 Score = 40.0 bits (92), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 23/33 (69%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNL 33
          M+R CE+  K    GN+VSH+N KTR +F PN+
Sbjct: 1  MARKCEICGKGPQFGNRVSHSNRKTRHKFNPNI 33


>gi|319937597|ref|ZP_08012002.1| 50S ribosomal protein L28 [Coprobacillus sp. 29_1]
 gi|319807437|gb|EFW04046.1| 50S ribosomal protein L28 [Coprobacillus sp. 29_1]
          Length = 61

 Score = 40.0 bits (92), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 39/61 (63%), Gaps = 2/61 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+R CE++ K  MSGN  SHA N +RR++  NL + T++ +   +K  ++IS   LRS+ 
Sbjct: 1  MARKCEVSGKGPMSGNTRSHALNASRRKWNVNLQKATILVNGKPKK--VKISARELRSLR 58

Query: 61 R 61
          +
Sbjct: 59 K 59


>gi|51892497|ref|YP_075188.1| 50S ribosomal protein L28 [Symbiobacterium thermophilum IAM
          14863]
 gi|67461381|sp|Q67PP9|RL28_SYMTH RecName: Full=50S ribosomal protein L28
 gi|51856186|dbj|BAD40344.1| 50S ribosomal protein L28 [Symbiobacterium thermophilum IAM
          14863]
          Length = 63

 Score = 40.0 bits (92), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 26/41 (63%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISD 41
          M+R CE+  K V  G+ VSHA NKT+R + PN+  +  + D
Sbjct: 1  MARRCEVCNKGVSHGHNVSHAENKTKRTWSPNVQTVRAVVD 41


>gi|222099405|ref|YP_002533973.1| 50S ribosomal protein L28 [Thermotoga neapolitana DSM 4359]
 gi|221571795|gb|ACM22607.1| 50S ribosomal protein L28 [Thermotoga neapolitana DSM 4359]
          Length = 72

 Score = 40.0 bits (92), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 26/39 (66%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLI 39
          M++ CE+  K   SGN VSH+N KT R F PNL ++ ++
Sbjct: 3  MAKRCEVCGKAPRSGNNVSHSNKKTGRWFRPNLQKVRVV 41


>gi|139439773|ref|ZP_01773164.1| Hypothetical protein COLAER_02195 [Collinsella aerofaciens ATCC
          25986]
 gi|133774923|gb|EBA38743.1| Hypothetical protein COLAER_02195 [Collinsella aerofaciens ATCC
          25986]
          Length = 78

 Score = 40.0 bits (92), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 28/41 (68%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISD 41
          MS+VCE+  K  ++G  +SH++  T R+F PN+ R+ ++ D
Sbjct: 17 MSKVCEVCGKHPVAGRSISHSHRVTNRKFRPNIQRVYVVVD 57


>gi|168025860|ref|XP_001765451.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162683301|gb|EDQ69712.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 108

 Score = 40.0 bits (92), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 45/79 (56%), Gaps = 2/79 (2%)

Query: 12 VMSGNKVSH-ANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFLS 70
          +  GN+VS    NK+RR + PN+    + S  +++  ++ I+  ALR +++ GGLD +L 
Sbjct: 18 IQFGNQVSEDGGNKSRRTWKPNVQTKRIFSLGLDRYIKMNITMHALRCIDKAGGLDEYLL 77

Query: 71 NSKKENLSARM-RTLRSQI 88
           + +  L   + R  R++I
Sbjct: 78 TTPEHKLDNDLAREWRTRI 96


>gi|291278738|ref|YP_003495573.1| 50S ribosomal protein L28 [Deferribacter desulfuricans SSM1]
 gi|290753440|dbj|BAI79817.1| 50S ribosomal protein L28 [Deferribacter desulfuricans SSM1]
          Length = 62

 Score = 40.0 bits (92), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 28/41 (68%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISD 41
          M+R C++  K  M G+ +SHA+N +RR F PN+ ++ +I +
Sbjct: 1  MARRCDICGKGPMFGHTISHAHNVSRRVFYPNVHKVRVIEN 41


>gi|239945969|ref|ZP_04697906.1| putative 50S ribosomal protein L28 [Streptomyces roseosporus NRRL
          15998]
 gi|239992438|ref|ZP_04713102.1| putative 50S ribosomal protein L28 [Streptomyces roseosporus NRRL
          11379]
 gi|291449424|ref|ZP_06588814.1| 50S ribosomal protein L28 [Streptomyces roseosporus NRRL 15998]
 gi|291352371|gb|EFE79275.1| 50S ribosomal protein L28 [Streptomyces roseosporus NRRL 15998]
          Length = 78

 Score = 40.0 bits (92), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 36/63 (57%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS  C+LT      GNK+SH++++T RRF PN+ R         +  +L +S  A+R+V+
Sbjct: 1  MSAHCQLTGSKPGFGNKISHSHHRTSRRFDPNIQRKRYWLPGEGRYVRLTLSVRAIRTVD 60

Query: 61 RQG 63
            G
Sbjct: 61 SIG 63


>gi|212702573|ref|ZP_03310701.1| hypothetical protein DESPIG_00597 [Desulfovibrio piger ATCC
          29098]
 gi|212674014|gb|EEB34497.1| hypothetical protein DESPIG_00597 [Desulfovibrio piger ATCC
          29098]
          Length = 104

 Score = 40.0 bits (92), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 19/36 (52%), Positives = 24/36 (66%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRI 36
          MS+ C+   K    GN VSH+N KT+RRF PNL R+
Sbjct: 35 MSKECDFCGKKPQVGNLVSHSNIKTKRRFNPNLQRV 70


>gi|169350116|ref|ZP_02867054.1| hypothetical protein CLOSPI_00858 [Clostridium spiroforme DSM
          1552]
 gi|169293329|gb|EDS75462.1| hypothetical protein CLOSPI_00858 [Clostridium spiroforme DSM
          1552]
          Length = 61

 Score = 40.0 bits (92), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 38/61 (62%), Gaps = 2/61 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR C+++ K  MSGN  SHA N +RR++  NL + T++ D   +   ++IS   LR++ 
Sbjct: 1  MSRKCQISGKGPMSGNTRSHALNSSRRKWNVNLQKATILVD--GKPTTVKISARELRTLR 58

Query: 61 R 61
          +
Sbjct: 59 K 59


>gi|296140972|ref|YP_003648215.1| ribosomal protein L28 [Tsukamurella paurometabola DSM 20162]
 gi|296029106|gb|ADG79876.1| ribosomal protein L28 [Tsukamurella paurometabola DSM 20162]
          Length = 78

 Score = 39.7 bits (91), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 20/76 (26%), Positives = 44/76 (57%), Gaps = 1/76 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS  C++T +    G +VSH++ +T RR+ PN+ R       + +   LR+S   +++++
Sbjct: 1  MSAHCQVTGRAPGFGKRVSHSHVRTSRRWDPNIQRRRYYVPSLGRTVVLRVSAKGIKTID 60

Query: 61 RQGGLDRFLSNSKKEN 76
          R+ G+D  +++ ++  
Sbjct: 61 RR-GIDAVVADIQRRG 75


>gi|303326851|ref|ZP_07357293.1| ribosomal protein L28 [Desulfovibrio sp. 3_1_syn3]
 gi|302862839|gb|EFL85771.1| ribosomal protein L28 [Desulfovibrio sp. 3_1_syn3]
          Length = 78

 Score = 39.7 bits (91), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 19/36 (52%), Positives = 24/36 (66%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRI 36
          MS+ C+   K    GN VSH+N KT+RRF PNL R+
Sbjct: 10 MSKECDFCGKKPQVGNLVSHSNIKTKRRFNPNLQRV 45


>gi|146296253|ref|YP_001180024.1| ribosomal protein L28 [Caldicellulosiruptor saccharolyticus DSM
          8903]
 gi|145409829|gb|ABP66833.1| LSU ribosomal protein L28P [Caldicellulosiruptor saccharolyticus
          DSM 8903]
          Length = 75

 Score = 39.7 bits (91), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 18/35 (51%), Positives = 25/35 (71%)

Query: 5  CELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLI 39
          CE+  K V  GNKVSH+N K+RR + PN+ +I +I
Sbjct: 18 CEICNKKVSFGNKVSHSNKKSRRTWKPNVKKIRVI 52


>gi|317129251|ref|YP_004095533.1| ribosomal protein L28 [Bacillus cellulosilyticus DSM 2522]
 gi|315474199|gb|ADU30802.1| ribosomal protein L28 [Bacillus cellulosilyticus DSM 2522]
          Length = 62

 Score = 39.7 bits (91), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 39/63 (61%), Gaps = 4/63 (6%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS-- 58
          MSR C +T K   SGNK SHA N T+RR+  N+ ++ ++ D   +  ++ +S  AL+S  
Sbjct: 1  MSRKCVITGKGPRSGNKRSHALNATKRRWGANVQKVRIMVD--GKPKRVYVSARALKSGK 58

Query: 59 VER 61
          VER
Sbjct: 59 VER 61


>gi|116782045|gb|ABK22346.1| unknown [Picea sitchensis]
          Length = 148

 Score = 39.7 bits (91), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 41/65 (63%), Gaps = 1/65 (1%)

Query: 2   SRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVER 61
           SRVC LT K   + NKVS +N+KT++    NL    +  +  ++  +LRIS  AL+++E+
Sbjct: 72  SRVCPLTGKRANNANKVSFSNHKTKKLQGVNLQYKRIWWEAGKRFVKLRISTKALKTIEK 131

Query: 62  QGGLD 66
           + GLD
Sbjct: 132 K-GLD 135


>gi|168025999|ref|XP_001765520.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162683158|gb|EDQ69570.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 129

 Score = 39.7 bits (91), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 24/62 (38%), Positives = 38/62 (61%)

Query: 2   SRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVER 61
           SR C+LT K   +G KVS +N++T+    PNL    L  +  ++  +LRIS  AL+++E+
Sbjct: 53  SRRCDLTGKKANNGYKVSFSNHRTKHLQQPNLQYKRLWWEEGKRFVKLRISTKALKTIEK 112

Query: 62  QG 63
            G
Sbjct: 113 NG 114


>gi|68536621|ref|YP_251326.1| 50S ribosomal protein L28 [Corynebacterium jeikeium K411]
 gi|260577822|ref|ZP_05845756.1| 50S ribosomal protein L28 [Corynebacterium jeikeium ATCC 43734]
 gi|123650515|sp|Q4JTZ9|RL28_CORJK RecName: Full=50S ribosomal protein L28
 gi|68264220|emb|CAI37708.1| 50S ribosomal protein L28 [Corynebacterium jeikeium K411]
 gi|258604049|gb|EEW17292.1| 50S ribosomal protein L28 [Corynebacterium jeikeium ATCC 43734]
          Length = 78

 Score = 39.7 bits (91), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 34/63 (53%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS  C++T +    G  VSH++ +T RR+ PN+ R T       +   L +S   L++++
Sbjct: 1  MSAYCQVTGRKPSFGKSVSHSHRRTNRRWNPNIQRRTFYLPSEGRSITLNVSTKGLKTID 60

Query: 61 RQG 63
          R G
Sbjct: 61 RDG 63


>gi|257784666|ref|YP_003179883.1| 50S ribosomal protein L28 [Atopobium parvulum DSM 20469]
 gi|257473173|gb|ACV51292.1| ribosomal protein L28 [Atopobium parvulum DSM 20469]
          Length = 62

 Score = 39.7 bits (91), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 32/54 (59%), Gaps = 1/54 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKC 54
          MS+VC+   K  ++G  +SH++    R F PN+ R+T++ D   +K  +  S+C
Sbjct: 1  MSKVCDFCGKHAVAGRSISHSHRTVARTFKPNIQRVTVVVDGQRKKMNV-CSRC 53


>gi|116793346|gb|ABK26715.1| unknown [Picea sitchensis]
          Length = 148

 Score = 39.7 bits (91), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 41/65 (63%), Gaps = 1/65 (1%)

Query: 2   SRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVER 61
           SRVC LT K   + NKVS +N+KT++    NL    +  +  ++  +LRIS  AL+++E+
Sbjct: 72  SRVCPLTGKRANNANKVSFSNHKTKKLQGVNLQYKRIWWEAGKRFVKLRISTKALKTIEK 131

Query: 62  QGGLD 66
           + GLD
Sbjct: 132 K-GLD 135


>gi|315640128|ref|ZP_07895250.1| 50S ribosomal protein L28 [Enterococcus italicus DSM 15952]
 gi|315484105|gb|EFU74579.1| 50S ribosomal protein L28 [Enterococcus italicus DSM 15952]
          Length = 62

 Score = 39.7 bits (91), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 25/63 (39%), Positives = 37/63 (58%), Gaps = 4/63 (6%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS-- 58
          M++VC  T +   SGN  SHA N T+R   PNL ++ ++ D   +K  + +S  AL+S  
Sbjct: 1  MAKVCYFTGRKTSSGNNRSHAMNSTKRTVKPNLQKVRVMIDGTPKK--VWVSARALKSGK 58

Query: 59 VER 61
          VER
Sbjct: 59 VER 61


>gi|302527617|ref|ZP_07279959.1| ribosomal protein L28 [Streptomyces sp. AA4]
 gi|302436512|gb|EFL08328.1| ribosomal protein L28 [Streptomyces sp. AA4]
          Length = 78

 Score = 39.7 bits (91), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 19/71 (26%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS VC++T +    G +VSH++ +T RR+ PNL         + +  +L++S   +++++
Sbjct: 1  MSAVCQVTGRKPGYGKQVSHSHRRTSRRWEPNLQTRRYYVPSLGRTVRLKVSAKGMKTID 60

Query: 61 RQGGLDRFLSN 71
          ++ G+D  +++
Sbjct: 61 KR-GIDAVVAD 70


>gi|221194542|ref|ZP_03567599.1| ribosomal protein L28 [Atopobium rimae ATCC 49626]
 gi|221185446|gb|EEE17836.1| ribosomal protein L28 [Atopobium rimae ATCC 49626]
          Length = 62

 Score = 39.7 bits (91), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 29/49 (59%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQL 49
          MS+VC+   K  ++G  +SH++    R F PN+ R+T++ D   +K  +
Sbjct: 1  MSKVCDFCGKHAVAGRSISHSHRTVTRTFKPNIQRVTVVVDGQRKKMNV 49


>gi|302823364|ref|XP_002993335.1| hypothetical protein SELMODRAFT_136927 [Selaginella
          moellendorffii]
 gi|300138844|gb|EFJ05597.1| hypothetical protein SELMODRAFT_136927 [Selaginella
          moellendorffii]
          Length = 77

 Score = 39.7 bits (91), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 39/61 (63%)

Query: 3  RVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQ 62
          RVCELT K   +  K+S+++ +TR++  PNL    L  +  ++  +LRI   AL++++++
Sbjct: 1  RVCELTGKKYNNARKISYSHIRTRKKQQPNLQYKRLWWEAGQRFVRLRICTQALKTIDKK 60

Query: 63 G 63
          G
Sbjct: 61 G 61


>gi|258653985|ref|YP_003203141.1| 50S ribosomal protein L28 [Nakamurella multipartita DSM 44233]
 gi|258557210|gb|ACV80152.1| ribosomal protein L28 [Nakamurella multipartita DSM 44233]
          Length = 78

 Score = 39.7 bits (91), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 34/63 (53%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS  C++T      G  VSH++ +T RR+ PNL         + +  +LR+S   LR ++
Sbjct: 1  MSARCQVTGAEPGFGKSVSHSHQRTNRRWEPNLQHRRFYVPSLRRTVRLRVSTKGLRIID 60

Query: 61 RQG 63
          R+G
Sbjct: 61 RRG 63


>gi|260887368|ref|ZP_05898631.1| ribosomal protein L28 [Selenomonas sputigena ATCC 35185]
 gi|330838657|ref|YP_004413237.1| ribosomal protein L28 [Selenomonas sputigena ATCC 35185]
 gi|260862906|gb|EEX77406.1| ribosomal protein L28 [Selenomonas sputigena ATCC 35185]
 gi|329746421|gb|AEB99777.1| ribosomal protein L28 [Selenomonas sputigena ATCC 35185]
          Length = 63

 Score = 39.7 bits (91), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 27/63 (42%), Positives = 40/63 (63%), Gaps = 4/63 (6%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS-- 58
          M+ VCE+  K  MSG  VSH++ KT+R++ PN+ R+  I +  E K+    ++C LRS  
Sbjct: 1  MASVCEICAKGEMSGMNVSHSHLKTKRKWKPNIQRVRAIVN-GETKHVNVCTRC-LRSGK 58

Query: 59 VER 61
          VER
Sbjct: 59 VER 61


>gi|325567342|ref|ZP_08144009.1| 50S ribosomal protein L28 [Enterococcus casseliflavus ATCC 12755]
 gi|325158775|gb|EGC70921.1| 50S ribosomal protein L28 [Enterococcus casseliflavus ATCC 12755]
          Length = 62

 Score = 39.3 bits (90), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 25/63 (39%), Positives = 37/63 (58%), Gaps = 4/63 (6%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS-- 58
          M++VC  T +   SGN  SHA N T+R   PNL ++ ++ D   +K  + +S  AL+S  
Sbjct: 1  MAKVCYFTGRKTASGNNRSHAMNATKRTVKPNLQKVRVMIDGKPKK--VWVSTRALKSGK 58

Query: 59 VER 61
          VER
Sbjct: 59 VER 61


>gi|254777316|ref|ZP_05218832.1| ribosomal protein L28 [Mycobacterium avium subsp. avium ATCC
          25291]
          Length = 78

 Score = 39.3 bits (90), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 36/63 (57%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS  C++T +    GN VSH++ +T RR+ PN+   T       ++ +LR+S   ++ ++
Sbjct: 1  MSAHCQVTGRRPSFGNAVSHSHRRTPRRWSPNIQLKTYYLPSEGRRVRLRVSAKGIKVID 60

Query: 61 RQG 63
          R G
Sbjct: 61 RDG 63


>gi|118464773|ref|YP_883997.1| ribosomal protein L28 [Mycobacterium avium 104]
 gi|118166060|gb|ABK66957.1| ribosomal protein L28 [Mycobacterium avium 104]
          Length = 78

 Score = 39.3 bits (90), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 36/63 (57%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS  C++T +    GN VSH++ +T RR+ PN+   T       ++ +LR+S   ++ ++
Sbjct: 1  MSADCQVTGRRPSFGNAVSHSHRRTPRRWSPNIQLKTYYLPSEGRRIRLRVSAKGIKVID 60

Query: 61 RQG 63
          R G
Sbjct: 61 RDG 63


>gi|195941297|ref|ZP_03086679.1| 50S ribosomal protein L28 [Borrelia burgdorferi 80a]
          Length = 92

 Score = 39.3 bits (90), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 37/82 (45%), Gaps = 14/82 (17%)

Query: 1  MSRVCELTKKTVMSGNKVS-------------HANNKTRRRFLPNLCRITLISDIMEQKY 47
          M+R CE+T K  M GN V              H   KT+R F  NL         + +  
Sbjct: 1  MARKCEITGKKTMFGNNVPRKGLAKKKGGAGQHIGVKTKRTFKVNLINKKFFIPNLGRSV 60

Query: 48 QLRISKCALRSVERQGGLDRFL 69
           +R+S  ALRS+ +  GLD FL
Sbjct: 61 SIRVSANALRSISKI-GLDTFL 81


>gi|320105672|ref|YP_004181262.1| 50S ribosomal protein L28 [Terriglobus saanensis SP1PR4]
 gi|319924193|gb|ADV81268.1| ribosomal protein L28 [Terriglobus saanensis SP1PR4]
          Length = 70

 Score = 39.3 bits (90), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 23/33 (69%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNL 33
          M++VC+   K    GN +SHA+N T+RR+ PNL
Sbjct: 1  MAQVCQYCGKGPQFGNNISHAHNVTKRRWNPNL 33


>gi|269123074|ref|YP_003305651.1| 50S ribosomal protein L28 [Streptobacillus moniliformis DSM
          12112]
 gi|268314400|gb|ACZ00774.1| ribosomal protein L28 [Streptobacillus moniliformis DSM 12112]
          Length = 87

 Score = 39.3 bits (90), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 37/58 (63%), Gaps = 2/58 (3%)

Query: 3  RVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          ++CE+  K V  GN VSH+N  T+R + PNL  + L+ D  E K  +R+S  A+++++
Sbjct: 2  QICEVFGKKVGHGNLVSHSNRATKRIWRPNLQTMKLMLDGKEVK--VRVSTKAMKTLK 57


>gi|168050997|ref|XP_001777943.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162670703|gb|EDQ57267.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 76

 Score = 39.3 bits (90), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 37/61 (60%)

Query: 3  RVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQ 62
          R C+LT K   +G KVS +N++T+    PNL    L  +  ++  +LRIS  AL+++E+ 
Sbjct: 1  RRCDLTGKKANNGYKVSFSNHRTKHLQQPNLQYKRLWWEEGKRFVKLRISTKALKTIEKN 60

Query: 63 G 63
          G
Sbjct: 61 G 61


>gi|257866564|ref|ZP_05646217.1| ribosomal protein L28 [Enterococcus casseliflavus EC30]
 gi|257870550|ref|ZP_05650203.1| ribosomal protein L28 [Enterococcus gallinarum EG2]
 gi|257872920|ref|ZP_05652573.1| ribosomal protein L28 [Enterococcus casseliflavus EC10]
 gi|257876168|ref|ZP_05655821.1| ribosomal protein L28 [Enterococcus casseliflavus EC20]
 gi|257800522|gb|EEV29550.1| ribosomal protein L28 [Enterococcus casseliflavus EC30]
 gi|257804714|gb|EEV33536.1| ribosomal protein L28 [Enterococcus gallinarum EG2]
 gi|257807084|gb|EEV35906.1| ribosomal protein L28 [Enterococcus casseliflavus EC10]
 gi|257810334|gb|EEV39154.1| ribosomal protein L28 [Enterococcus casseliflavus EC20]
          Length = 62

 Score = 39.3 bits (90), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 25/63 (39%), Positives = 37/63 (58%), Gaps = 4/63 (6%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS-- 58
          M++VC  T +   SGN  SHA N T+R   PNL ++ ++ D   +K  + +S  AL+S  
Sbjct: 1  MAKVCYFTGRKTTSGNNRSHAMNATKRTVKPNLQKVRVMIDGKPKK--VWVSTRALKSGK 58

Query: 59 VER 61
          VER
Sbjct: 59 VER 61


>gi|307564684|ref|ZP_07627214.1| 50S ribosomal protein L28 [Prevotella amnii CRIS 21A-A]
 gi|307346612|gb|EFN91919.1| 50S ribosomal protein L28 [Prevotella amnii CRIS 21A-A]
          Length = 87

 Score = 39.3 bits (90), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 33/63 (52%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS++C++T K    GN VSH+ ++T+R F  NL          +    L+IS   LR + 
Sbjct: 1  MSKICQITGKKAQIGNNVSHSKHRTKRSFDVNLFSKKFYYVEEDCWISLKISAAGLRLIN 60

Query: 61 RQG 63
          + G
Sbjct: 61 KVG 63


>gi|307717950|ref|YP_003873482.1| 50S ribosomal protein L28 [Spirochaeta thermophila DSM 6192]
 gi|306531675|gb|ADN01209.1| 50S ribosomal protein L28 [Spirochaeta thermophila DSM 6192]
          Length = 63

 Score = 39.3 bits (90), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 27/41 (65%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISD 41
          M+R CE+  K   SG  VSHA+N+++R F PN+ +I ++  
Sbjct: 1  MARRCEICGKQTRSGFTVSHAHNRSKRTFKPNIQKIQIVDG 41


>gi|257878757|ref|ZP_05658410.1| ribosomal protein L28 [Enterococcus faecium 1,230,933]
 gi|257881399|ref|ZP_05661052.1| ribosomal protein L28 [Enterococcus faecium 1,231,502]
 gi|257885666|ref|ZP_05665319.1| ribosomal protein L28 [Enterococcus faecium 1,231,501]
 gi|257887989|ref|ZP_05667642.1| ribosomal protein L28 [Enterococcus faecium 1,141,733]
 gi|257890616|ref|ZP_05670269.1| ribosomal protein L28 [Enterococcus faecium 1,231,410]
 gi|257893207|ref|ZP_05672860.1| ribosomal protein L28 [Enterococcus faecium 1,231,408]
 gi|257896392|ref|ZP_05676045.1| ribosomal protein L28 [Enterococcus faecium Com12]
 gi|257899367|ref|ZP_05679020.1| ribosomal protein L28 [Enterococcus faecium Com15]
 gi|258615176|ref|ZP_05712946.1| 50S ribosomal protein L28 [Enterococcus faecium DO]
 gi|260558326|ref|ZP_05830522.1| ribosomal protein L28 [Enterococcus faecium C68]
 gi|261207031|ref|ZP_05921720.1| ribosomal protein L28 [Enterococcus faecium TC 6]
 gi|289565335|ref|ZP_06445785.1| 50S ribosomal protein L28 [Enterococcus faecium D344SRF]
 gi|293379478|ref|ZP_06625622.1| ribosomal protein L28 [Enterococcus faecium PC4.1]
 gi|293556806|ref|ZP_06675367.1| ribosomal protein L28 [Enterococcus faecium E1039]
 gi|293562979|ref|ZP_06677446.1| ribosomal protein L28 [Enterococcus faecium E1162]
 gi|293567892|ref|ZP_06679233.1| ribosomal protein L28 [Enterococcus faecium E1071]
 gi|293570716|ref|ZP_06681766.1| ribosomal protein L28 [Enterococcus faecium E980]
 gi|294615355|ref|ZP_06695228.1| ribosomal protein L28 [Enterococcus faecium E1636]
 gi|294618526|ref|ZP_06698088.1| ribosomal protein L28 [Enterococcus faecium E1679]
 gi|294622010|ref|ZP_06701154.1| ribosomal protein L28 [Enterococcus faecium U0317]
 gi|257812985|gb|EEV41743.1| ribosomal protein L28 [Enterococcus faecium 1,230,933]
 gi|257817057|gb|EEV44385.1| ribosomal protein L28 [Enterococcus faecium 1,231,502]
 gi|257821522|gb|EEV48652.1| ribosomal protein L28 [Enterococcus faecium 1,231,501]
 gi|257824043|gb|EEV50975.1| ribosomal protein L28 [Enterococcus faecium 1,141,733]
 gi|257826976|gb|EEV53602.1| ribosomal protein L28 [Enterococcus faecium 1,231,410]
 gi|257829586|gb|EEV56193.1| ribosomal protein L28 [Enterococcus faecium 1,231,408]
 gi|257832957|gb|EEV59378.1| ribosomal protein L28 [Enterococcus faecium Com12]
 gi|257837279|gb|EEV62353.1| ribosomal protein L28 [Enterococcus faecium Com15]
 gi|260075500|gb|EEW63806.1| ribosomal protein L28 [Enterococcus faecium C68]
 gi|260078659|gb|EEW66361.1| ribosomal protein L28 [Enterococcus faecium TC 6]
 gi|289162825|gb|EFD10675.1| 50S ribosomal protein L28 [Enterococcus faecium D344SRF]
 gi|291589477|gb|EFF21284.1| ribosomal protein L28 [Enterococcus faecium E1071]
 gi|291591729|gb|EFF23365.1| ribosomal protein L28 [Enterococcus faecium E1636]
 gi|291595226|gb|EFF26557.1| ribosomal protein L28 [Enterococcus faecium E1679]
 gi|291598437|gb|EFF29510.1| ribosomal protein L28 [Enterococcus faecium U0317]
 gi|291600890|gb|EFF31181.1| ribosomal protein L28 [Enterococcus faecium E1039]
 gi|291605105|gb|EFF34572.1| ribosomal protein L28 [Enterococcus faecium E1162]
 gi|291609188|gb|EFF38460.1| ribosomal protein L28 [Enterococcus faecium E980]
 gi|292642001|gb|EFF60167.1| ribosomal protein L28 [Enterococcus faecium PC4.1]
          Length = 62

 Score = 39.3 bits (90), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 25/63 (39%), Positives = 37/63 (58%), Gaps = 4/63 (6%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS-- 58
          M++VC  T +   SGN  SHA N T+R   PNL ++ ++ D   +K  + +S  AL+S  
Sbjct: 1  MAKVCYFTGRKTKSGNNRSHAMNSTKRTVKPNLQKVRVMVDGKPKK--VWVSTRALKSGK 58

Query: 59 VER 61
          VER
Sbjct: 59 VER 61


>gi|315187552|gb|EFU21308.1| LSU ribosomal protein L28P [Spirochaeta thermophila DSM 6578]
          Length = 63

 Score = 39.3 bits (90), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 27/41 (65%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISD 41
          M+R CE+  K   SG  VSHA+N+++R F PN+ +I ++  
Sbjct: 1  MARRCEICGKQTRSGFTVSHAHNRSKRTFKPNIQKIQIVDG 41


>gi|322437257|ref|YP_004219469.1| ribosomal protein L28 [Acidobacterium sp. MP5ACTX9]
 gi|321164984|gb|ADW70689.1| ribosomal protein L28 [Acidobacterium sp. MP5ACTX9]
          Length = 63

 Score = 39.3 bits (90), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 19/33 (57%), Positives = 22/33 (66%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNL 33
          M+  C+L  K    GN VSHANNKTRRR+  NL
Sbjct: 1  MAAKCDLCGKGPQFGNNVSHANNKTRRRWNVNL 33


>gi|256372290|ref|YP_003110114.1| ribosomal protein L28 [Acidimicrobium ferrooxidans DSM 10331]
 gi|256008874|gb|ACU54441.1| ribosomal protein L28 [Acidimicrobium ferrooxidans DSM 10331]
          Length = 62

 Score = 39.3 bits (90), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 28/41 (68%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISD 41
          M+ VCE+  K    G K+SH++ +T+RRFLPN+ R+ ++  
Sbjct: 1  MASVCEICGKGPRVGMKLSHSHRRTKRRFLPNVQRVRVLEG 41


>gi|225552377|ref|ZP_03773317.1| ribosomal protein L28 [Borrelia sp. SV1]
 gi|225371375|gb|EEH00805.1| ribosomal protein L28 [Borrelia sp. SV1]
          Length = 92

 Score = 39.3 bits (90), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 37/82 (45%), Gaps = 14/82 (17%)

Query: 1  MSRVCELTKKTVMSGNKVS-------------HANNKTRRRFLPNLCRITLISDIMEQKY 47
          MSR CE+T K  M GN V              H   KT+R F  NL         + +  
Sbjct: 1  MSRKCEITGKKTMFGNNVPRKGLAKKKGGAGQHIGVKTKRTFKVNLINKKFFIPNLGRSV 60

Query: 48 QLRISKCALRSVERQGGLDRFL 69
           +++S  ALRS+ +  GLD FL
Sbjct: 61 SIKVSANALRSISKI-GLDAFL 81


>gi|333030358|ref|ZP_08458419.1| 50S ribosomal protein L28 [Bacteroides coprosuis DSM 18011]
 gi|332740955|gb|EGJ71437.1| 50S ribosomal protein L28 [Bacteroides coprosuis DSM 18011]
          Length = 86

 Score = 39.3 bits (90), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 35/69 (50%), Gaps = 1/69 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS++C++T K  M GN VSH+  +T++ F  NL               L IS   LR++ 
Sbjct: 1  MSKICQITGKKAMVGNNVSHSKRRTKKTFDVNLFNKKFYYVEQGCWISLSISAAGLRTIN 60

Query: 61 RQGGLDRFL 69
          +  GLD  L
Sbjct: 61 KI-GLDAAL 68


>gi|123968492|ref|YP_001009350.1| 50S ribosomal protein L28 [Prochlorococcus marinus str. AS9601]
 gi|166226602|sp|A2BR32|RL28_PROMS RecName: Full=50S ribosomal protein L28
 gi|123198602|gb|ABM70243.1| 50S ribosomal protein L28 [Prochlorococcus marinus str. AS9601]
          Length = 78

 Score = 39.3 bits (90), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 41/68 (60%), Gaps = 1/68 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT     +G  VSH++ +T++    NL +  L  +  ++   ++IS  AL+S++
Sbjct: 1  MSRACELTGAKANNGMAVSHSHIRTKKLQQVNLQKRRLWWEEGKKWVNIKISTKALKSIQ 60

Query: 61 RQGGLDRF 68
          +  GLD+F
Sbjct: 61 KV-GLDKF 67


>gi|400992|sp|P30956|RK28_TOBAC RecName: Full=50S ribosomal protein L28, chloroplastic; AltName:
           Full=CL28; Flags: Precursor
 gi|279656|pir||R5NT28 ribosomal protein L28 precursor, chloroplast - tobacco
 gi|189096147|pdb|3BBO|Y Chain Y, Homology Model For The Spinach Chloroplast 50s Subunit
           Fitted To 9.4a Cryo-Em Map Of The 70s Chlororibosome
 gi|20016|emb|CAA48211.1| ribosomal protein CL28 [Nicotiana tabacum]
          Length = 151

 Score = 39.3 bits (90), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 38/64 (59%), Gaps = 1/64 (1%)

Query: 3   RVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQ 62
           R+C  T K     NKVSH+N+KT++    NL    +  +  ++  +LR+S  A++++E+ 
Sbjct: 76  RICPFTGKKSNRANKVSHSNHKTKKLQFVNLQYKRIWWEAGKRYVKLRLSTKAIKTIEKN 135

Query: 63  GGLD 66
            GLD
Sbjct: 136 -GLD 138


>gi|218888189|ref|YP_002437510.1| 50S ribosomal protein L28 [Desulfovibrio vulgaris str. 'Miyazaki
          F']
 gi|226732826|sp|B8DJG5|RL28_DESVM RecName: Full=50S ribosomal protein L28
 gi|218759143|gb|ACL10042.1| ribosomal protein L28 [Desulfovibrio vulgaris str. 'Miyazaki F']
          Length = 69

 Score = 39.3 bits (90), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 23/33 (69%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNL 33
          MS+ C++  K    G+ VSH+N KT+RRF PNL
Sbjct: 1  MSKQCDVCGKKAQVGHHVSHSNIKTKRRFEPNL 33


>gi|149278718|ref|ZP_01884854.1| 50S ribosomal protein L28 [Pedobacter sp. BAL39]
 gi|149230713|gb|EDM36096.1| 50S ribosomal protein L28 [Pedobacter sp. BAL39]
          Length = 67

 Score = 39.3 bits (90), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 39/62 (62%), Gaps = 7/62 (11%)

Query: 13 MSGNKVSHANNKTRRRFLPNL-CRITLISDIMEQKY-QLRISKCALRSVERQG---GLDR 67
          M+G  VSH+N KT+R+F PNL  +   I D  E ++  L++S  A++++ + G    ++R
Sbjct: 3  MTGFNVSHSNVKTKRKFYPNLQLQKFYIPD--EDRWITLKVSTSAIKTINKIGITEAINR 60

Query: 68 FL 69
          F+
Sbjct: 61 FM 62


>gi|224531933|ref|ZP_03672565.1| ribosomal protein L28 [Borrelia valaisiana VS116]
 gi|224511398|gb|EEF81804.1| ribosomal protein L28 [Borrelia valaisiana VS116]
          Length = 92

 Score = 39.3 bits (90), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 37/82 (45%), Gaps = 14/82 (17%)

Query: 1  MSRVCELTKKTVMSGNKVS-------------HANNKTRRRFLPNLCRITLISDIMEQKY 47
          M+R CE+T K  M GN V              H   KT+R F  NL         + +  
Sbjct: 1  MARKCEITGKKTMFGNNVPRKGLAKKKGGAGQHIGVKTKRTFKVNLINKKFFIPNLGRSI 60

Query: 48 QLRISKCALRSVERQGGLDRFL 69
           +++S  ALRS+ +  GLD FL
Sbjct: 61 NIKVSANALRSISKM-GLDAFL 81


>gi|308190261|ref|YP_003923192.1| 50S ribosomal protein L28 [Mycoplasma fermentans JER]
 gi|319777630|ref|YP_004137281.1| 50S ribosomal protein l28 [Mycoplasma fermentans M64]
 gi|307625003|gb|ADN69308.1| 50S ribosomal protein L28 [Mycoplasma fermentans JER]
 gi|318038705|gb|ADV34904.1| 50S ribosomal protein L28 [Mycoplasma fermentans M64]
          Length = 66

 Score = 39.3 bits (90), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 39/63 (61%), Gaps = 2/63 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR  +LT K  M GN  SHA N ++R+F  NL ++T+  ++  +K  LR+S    ++++
Sbjct: 1  MSRRDQLTGKGPMVGNIRSHAMNASKRKFNVNLQKVTM--NVNGKKVTLRVSAKTAKTLK 58

Query: 61 RQG 63
           +G
Sbjct: 59 NKG 61


>gi|238809981|dbj|BAH69771.1| hypothetical protein [Mycoplasma fermentans PG18]
          Length = 73

 Score = 39.3 bits (90), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 39/63 (61%), Gaps = 2/63 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR  +LT K  M GN  SHA N ++R+F  NL ++T+  ++  +K  LR+S    ++++
Sbjct: 8  MSRRDQLTGKGPMVGNIRSHAMNASKRKFNVNLQKVTM--NVNGKKVTLRVSAKTAKTLK 65

Query: 61 RQG 63
           +G
Sbjct: 66 NKG 68


>gi|325191225|emb|CCA26012.1| conserved hypothetical protein [Albugo laibachii Nc14]
          Length = 140

 Score = 39.3 bits (90), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 47/83 (56%), Gaps = 1/83 (1%)

Query: 15  GNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFL-SNSK 73
           GN VSH+  +TRR +  N     L S+ +++   L ++   LR +++ GGLD +L S S 
Sbjct: 43  GNNVSHSKRRTRRSWKVNHQWKHLYSEALDEMIGLNVTTHTLRCIDKIGGLDNYLQSISD 102

Query: 74  KENLSARMRTLRSQILKKMSEKS 96
           ++ L  +    +++I++ +  ++
Sbjct: 103 EQELGVKGLKAKNRIVEALKAQT 125


>gi|322709867|gb|EFZ01442.1| 50S ribosomal protein L24 [Metarhizium anisopliae ARSEF 23]
          Length = 292

 Score = 39.3 bits (90), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 5/71 (7%)

Query: 15  GNKVSH-ANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFLSNSK 73
           GN V+   NNK+RR + PN+   T  S  +  + + R++   L+++ R+GG++ +L  SK
Sbjct: 108 GNNVAEKHNNKSRRFWRPNVHVKTFFSPSLGARVKTRLTLRVLKTIRREGGIENYLLKSK 167

Query: 74  KENLSARMRTL 84
                AR+R L
Sbjct: 168 ----PARIREL 174


>gi|312621545|ref|YP_004023158.1| 50S ribosomal protein L28 [Caldicellulosiruptor kronotskyensis
          2002]
 gi|312202012|gb|ADQ45339.1| ribosomal protein L28 [Caldicellulosiruptor kronotskyensis 2002]
          Length = 62

 Score = 39.3 bits (90), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 17/35 (48%), Positives = 25/35 (71%)

Query: 5  CELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLI 39
          CE+  K V  GNKVSH+N K+RR + PN+ +I ++
Sbjct: 4  CEVCGKKVAFGNKVSHSNKKSRRTWKPNVKKIKVL 38


>gi|255327425|ref|ZP_05368499.1| ribosomal protein L28 [Rothia mucilaginosa ATCC 25296]
 gi|283458733|ref|YP_003363371.1| 50S ribosomal protein L28 [Rothia mucilaginosa DY-18]
 gi|300743694|ref|ZP_07072714.1| ribosomal protein L28 [Rothia dentocariosa M567]
 gi|311112945|ref|YP_003984167.1| 50S ribosomal protein L28 [Rothia dentocariosa ATCC 17931]
 gi|255295705|gb|EET75048.1| ribosomal protein L28 [Rothia mucilaginosa ATCC 25296]
 gi|283134786|dbj|BAI65551.1| ribosomal protein L28 [Rothia mucilaginosa DY-18]
 gi|300380055|gb|EFJ76618.1| ribosomal protein L28 [Rothia dentocariosa M567]
 gi|310944439|gb|ADP40733.1| 50S ribosomal protein L28 [Rothia dentocariosa ATCC 17931]
          Length = 78

 Score = 39.3 bits (90), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 17/63 (26%), Positives = 36/63 (57%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+ VC++T      G+ +SH++ + +RRF PN+ + T     + +K  L +S   ++ ++
Sbjct: 1  MAAVCQVTGAVPGFGHSISHSHRRNKRRFDPNVQKKTYWVPSLRRKVTLNVSAKGIKVID 60

Query: 61 RQG 63
           +G
Sbjct: 61 ARG 63


>gi|227550753|ref|ZP_03980802.1| 50S ribosomal protein L28 [Enterococcus faecium TX1330]
 gi|314937642|ref|ZP_07844968.1| ribosomal protein L28 [Enterococcus faecium TX0133a04]
 gi|314942859|ref|ZP_07849672.1| ribosomal protein L28 [Enterococcus faecium TX0133C]
 gi|314948005|ref|ZP_07851409.1| ribosomal protein L28 [Enterococcus faecium TX0082]
 gi|314950923|ref|ZP_07853992.1| ribosomal protein L28 [Enterococcus faecium TX0133A]
 gi|314991429|ref|ZP_07856906.1| ribosomal protein L28 [Enterococcus faecium TX0133B]
 gi|314995050|ref|ZP_07860170.1| ribosomal protein L28 [Enterococcus faecium TX0133a01]
 gi|227180071|gb|EEI61043.1| 50S ribosomal protein L28 [Enterococcus faecium TX1330]
 gi|313590776|gb|EFR69621.1| ribosomal protein L28 [Enterococcus faecium TX0133a01]
 gi|313593909|gb|EFR72754.1| ribosomal protein L28 [Enterococcus faecium TX0133B]
 gi|313596932|gb|EFR75777.1| ribosomal protein L28 [Enterococcus faecium TX0133A]
 gi|313598331|gb|EFR77176.1| ribosomal protein L28 [Enterococcus faecium TX0133C]
 gi|313643019|gb|EFS07599.1| ribosomal protein L28 [Enterococcus faecium TX0133a04]
 gi|313645603|gb|EFS10183.1| ribosomal protein L28 [Enterococcus faecium TX0082]
          Length = 73

 Score = 39.3 bits (90), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 25/63 (39%), Positives = 37/63 (58%), Gaps = 4/63 (6%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS-- 58
          M++VC  T +   SGN  SHA N T+R   PNL ++ ++ D   +K  + +S  AL+S  
Sbjct: 12 MAKVCYFTGRKTKSGNNRSHAMNSTKRTVKPNLQKVRVMVDGKPKK--VWVSTRALKSGK 69

Query: 59 VER 61
          VER
Sbjct: 70 VER 72


>gi|219685441|ref|ZP_03540259.1| ribosomal protein L28 [Borrelia garinii Far04]
 gi|219672997|gb|EED30018.1| ribosomal protein L28 [Borrelia garinii Far04]
          Length = 92

 Score = 38.9 bits (89), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 38/82 (46%), Gaps = 14/82 (17%)

Query: 1  MSRVCELTKKTVMSGNKVS-------------HANNKTRRRFLPNLCRITLISDIMEQKY 47
          M+R CE+T K  M GN V              H   KT+R F  NL         + +  
Sbjct: 1  MARKCEITGKKTMFGNNVPRKGLAKKKGGAGQHIGVKTKRTFKVNLINKKFFIPDLGRSI 60

Query: 48 QLRISKCALRSVERQGGLDRFL 69
          ++++S  ALRS+ +  GLD FL
Sbjct: 61 KIKVSANALRSISKI-GLDAFL 81


>gi|312897746|ref|ZP_07757162.1| ribosomal protein L28 [Megasphaera micronuciformis F0359]
 gi|310621130|gb|EFQ04674.1| ribosomal protein L28 [Megasphaera micronuciformis F0359]
          Length = 63

 Score = 38.9 bits (89), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 26/41 (63%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISD 41
          M+  CE+  K  MSG  VSH++ KT+R + PN+ R+  I D
Sbjct: 1  MANYCEICGKGTMSGMNVSHSHLKTKRTWKPNIQRVRAIVD 41


>gi|302540597|ref|ZP_07292939.1| ribosomal protein L28 [Streptomyces hygroscopicus ATCC 53653]
 gi|302458215|gb|EFL21308.1| ribosomal protein L28 [Streptomyces himastatinicus ATCC 53653]
          Length = 78

 Score = 38.9 bits (89), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 36/63 (57%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS  C+LT +    GN VSH++ +T+RRF PN+ R         +  +L +S  A+++V+
Sbjct: 1  MSAHCQLTGRRPGFGNHVSHSHRRTKRRFDPNIQRKRYWLPSEGRHVRLTLSARAVKTVD 60

Query: 61 RQG 63
            G
Sbjct: 61 SIG 63


>gi|322693338|gb|EFY85202.1| 50S ribosomal protein L24 [Metarhizium acridum CQMa 102]
          Length = 292

 Score = 38.9 bits (89), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 5/71 (7%)

Query: 15  GNKVSH-ANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFLSNSK 73
           GN V+   NNK+RR + PN+   T  S  +  + + R++   L+++ R+GG++ +L  SK
Sbjct: 108 GNNVAEKHNNKSRRFWRPNVHVKTFFSPSLGARVKTRLTLRVLKTIRREGGIENYLLKSK 167

Query: 74  KENLSARMRTL 84
                AR+R L
Sbjct: 168 ----PARIREL 174


>gi|258514449|ref|YP_003190671.1| 50S ribosomal protein L28 [Desulfotomaculum acetoxidans DSM 771]
 gi|257778154|gb|ACV62048.1| ribosomal protein L28 [Desulfotomaculum acetoxidans DSM 771]
          Length = 63

 Score = 38.9 bits (89), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 29/41 (70%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISD 41
          M+R C++  K V++G KVSH++ +T+R + PNL R+  I +
Sbjct: 1  MARKCDICGKGVVTGMKVSHSHIRTKRTWAPNLQRVKAIVN 41


>gi|226227377|ref|YP_002761483.1| 50S ribosomal protein L28 [Gemmatimonas aurantiaca T-27]
 gi|226090568|dbj|BAH39013.1| 50S ribosomal protein L28 [Gemmatimonas aurantiaca T-27]
          Length = 73

 Score = 38.9 bits (89), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 18/29 (62%), Positives = 19/29 (65%)

Query: 5  CELTKKTVMSGNKVSHANNKTRRRFLPNL 33
          C    K V  GN VSHANNKTRR + PNL
Sbjct: 8  CYHCDKGVAFGNNVSHANNKTRRTWKPNL 36


>gi|222530165|ref|YP_002574047.1| 50S ribosomal protein L28 [Caldicellulosiruptor bescii DSM 6725]
 gi|302872595|ref|YP_003841231.1| ribosomal protein L28 [Caldicellulosiruptor obsidiansis OB47]
 gi|312126797|ref|YP_003991671.1| 50S ribosomal protein L28 [Caldicellulosiruptor hydrothermalis
          108]
 gi|312135879|ref|YP_004003217.1| 50S ribosomal protein L28 [Caldicellulosiruptor owensensis OL]
 gi|312792619|ref|YP_004025542.1| 50S ribosomal protein L28 [Caldicellulosiruptor kristjanssonii
          177R1B]
 gi|312877946|ref|ZP_07737889.1| ribosomal protein L28 [Caldicellulosiruptor lactoaceticus 6A]
 gi|254801496|sp|B9MM51|RL28_ANATD RecName: Full=50S ribosomal protein L28
 gi|222457012|gb|ACM61274.1| ribosomal protein L28 [Caldicellulosiruptor bescii DSM 6725]
 gi|302575454|gb|ADL43245.1| ribosomal protein L28 [Caldicellulosiruptor obsidiansis OB47]
 gi|311775930|gb|ADQ05417.1| ribosomal protein L28 [Caldicellulosiruptor owensensis OL]
 gi|311776816|gb|ADQ06302.1| ribosomal protein L28 [Caldicellulosiruptor hydrothermalis 108]
 gi|311795296|gb|EFR11682.1| ribosomal protein L28 [Caldicellulosiruptor lactoaceticus 6A]
 gi|312179759|gb|ADQ39929.1| ribosomal protein L28 [Caldicellulosiruptor kristjanssonii
          177R1B]
          Length = 62

 Score = 38.9 bits (89), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 17/35 (48%), Positives = 25/35 (71%)

Query: 5  CELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLI 39
          CE+  K V  GNKVSH+N K+RR + PN+ +I ++
Sbjct: 4  CEVCGKKVAFGNKVSHSNKKSRRTWKPNVKKIKVL 38


>gi|71894090|ref|YP_278198.1| 50S ribosomal protein L28 [Mycoplasma synoviae 53]
 gi|123644523|sp|Q4A6Y4|RL28_MYCS5 RecName: Full=50S ribosomal protein L28
 gi|71850878|gb|AAZ43487.1| 50S ribosomal protein L28 [Mycoplasma synoviae 53]
          Length = 63

 Score = 38.9 bits (89), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 25/63 (39%), Positives = 34/63 (53%), Gaps = 2/63 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRV        MSGN  SHA N +RR+F  NL ++ +  D    K  LRIS   L++  
Sbjct: 1  MSRVDWFRGVGPMSGNTRSHAMNASRRKFNVNLQKVRV--DFGSGKRTLRISTKTLKTWR 58

Query: 61 RQG 63
          ++G
Sbjct: 59 KKG 61


>gi|308069667|ref|YP_003871272.1| 50S ribosomal protein L28 [Paenibacillus polymyxa E681]
 gi|305858946|gb|ADM70734.1| 50S ribosomal protein L28 [Paenibacillus polymyxa E681]
          Length = 62

 Score = 38.9 bits (89), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 27/41 (65%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISD 41
          MSR C +T K   SGN VSHANN+ RR +  N+ ++ ++ +
Sbjct: 1  MSRKCSVTGKKPGSGNHVSHANNRNRRTWGVNVQKVRILVN 41


>gi|325676326|ref|ZP_08156005.1| 50S ribosomal protein L28 [Rhodococcus equi ATCC 33707]
 gi|325552887|gb|EGD22570.1| 50S ribosomal protein L28 [Rhodococcus equi ATCC 33707]
          Length = 78

 Score = 38.9 bits (89), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 35/63 (55%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS  C++T +    G  VSH++ +T RR+ PN+   T       ++  LR++   +R+++
Sbjct: 1  MSAHCQVTGRRPGFGRSVSHSHRRTNRRWNPNIQTKTYFLPGEGRRITLRVTPKGIRTID 60

Query: 61 RQG 63
          R G
Sbjct: 61 RDG 63


>gi|328948867|ref|YP_004366204.1| 50S ribosomal protein L28 [Treponema succinifaciens DSM 2489]
 gi|328449191|gb|AEB14907.1| 50S ribosomal protein L28 [Treponema succinifaciens DSM 2489]
          Length = 76

 Score = 38.9 bits (89), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 25/36 (69%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRI 36
          MSR C++  K  M GN+VS + N TRR++ PNL +I
Sbjct: 1  MSRSCDVCGKHSMHGNRVSKSYNHTRRQWKPNLLKI 36


>gi|227824766|ref|ZP_03989598.1| 50S ribosomal protein L28 [Acidaminococcus sp. D21]
 gi|226905265|gb|EEH91183.1| 50S ribosomal protein L28 [Acidaminococcus sp. D21]
          Length = 63

 Score = 38.9 bits (89), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 27/41 (65%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISD 41
          M+ +C++ KK  +SGN VSH+N   +R + PN+ ++  + D
Sbjct: 1  MACICDICKKGELSGNNVSHSNRHVKRSWKPNIQKVKAVVD 41


>gi|295835223|ref|ZP_06822156.1| ribosomal protein L28 [Streptomyces sp. SPB74]
 gi|197698184|gb|EDY45117.1| ribosomal protein L28 [Streptomyces sp. SPB74]
          Length = 78

 Score = 38.9 bits (89), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 18/35 (51%), Positives = 23/35 (65%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCR 35
          MS  C+LT      GNKVSH++ +T RRF PN+ R
Sbjct: 1  MSAHCQLTGSKPAFGNKVSHSHRRTPRRFDPNIQR 35


>gi|51598608|ref|YP_072796.1| 50S ribosomal protein L28 [Borrelia garinii PBi]
 gi|67461376|sp|Q661R7|RL28_BORGA RecName: Full=50S ribosomal protein L28
 gi|51573179|gb|AAU07204.1| ribosomal protein L28 [Borrelia garinii PBi]
          Length = 92

 Score = 38.5 bits (88), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 37/82 (45%), Gaps = 14/82 (17%)

Query: 1  MSRVCELTKKTVMSGNKVS-------------HANNKTRRRFLPNLCRITLISDIMEQKY 47
          M+R CE+T K  M GN V              H   KT+R F  NL         + +  
Sbjct: 1  MARKCEITGKKTMFGNNVPRKGLAKKKGGAGQHIGVKTKRTFKVNLINKKFFIPELGRSI 60

Query: 48 QLRISKCALRSVERQGGLDRFL 69
           +++S  ALRS+ +  GLD FL
Sbjct: 61 NIKVSANALRSISKV-GLDAFL 81


>gi|319442734|ref|ZP_07991890.1| 50S ribosomal protein L28 [Corynebacterium variabile DSM 44702]
          Length = 78

 Score = 38.5 bits (88), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 34/63 (53%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS  C++T +    G  VSH++ +T RR+ PN+ R +       +   L +S   L++++
Sbjct: 1  MSAYCQVTGRKPGFGKSVSHSHRRTNRRWNPNIQRRSFYVPSEGRTITLNVSTKGLKTID 60

Query: 61 RQG 63
          R G
Sbjct: 61 RDG 63


>gi|317486856|ref|ZP_07945668.1| ribosomal protein L28 [Bilophila wadsworthia 3_1_6]
 gi|316921895|gb|EFV43169.1| ribosomal protein L28 [Bilophila wadsworthia 3_1_6]
          Length = 73

 Score = 38.5 bits (88), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 18/33 (54%), Positives = 22/33 (66%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNL 33
          MS+ CE   K   +GN VSH+N KT+R F PNL
Sbjct: 5  MSKQCEFCGKKPQTGNYVSHSNIKTKRVFNPNL 37


>gi|332685786|ref|YP_004455560.1| 50S ribosomal protein L28p [Melissococcus plutonius ATCC 35311]
 gi|332369795|dbj|BAK20751.1| LSU ribosomal protein L28p [Melissococcus plutonius ATCC 35311]
          Length = 62

 Score = 38.5 bits (88), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 37/63 (58%), Gaps = 4/63 (6%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS-- 58
          M++VC  T +   SGN  SHA N T+R   PNL ++ ++ D   +K  + +S  AL+S  
Sbjct: 1  MAKVCYFTGRKTRSGNNRSHAMNATKRTVKPNLQKVRVLVDGKPKK--VWVSTRALKSGK 58

Query: 59 VER 61
          +ER
Sbjct: 59 IER 61


>gi|257452933|ref|ZP_05618232.1| 50S ribosomal protein L28P [Fusobacterium sp. 3_1_5R]
 gi|257462528|ref|ZP_05626939.1| 50S ribosomal protein L28P [Fusobacterium sp. D12]
 gi|257466688|ref|ZP_05630999.1| 50S ribosomal protein L28P [Fusobacterium gonidiaformans ATCC
          25563]
 gi|315917840|ref|ZP_07914080.1| LSU ribosomal protein L28P [Fusobacterium gonidiaformans ATCC
          25563]
 gi|317059474|ref|ZP_07923959.1| LSU ribosomal protein L28P [Fusobacterium sp. 3_1_5R]
 gi|317060182|ref|ZP_07924667.1| LSU ribosomal protein L28P [Fusobacterium sp. D12]
 gi|313685150|gb|EFS21985.1| LSU ribosomal protein L28P [Fusobacterium sp. 3_1_5R]
 gi|313685858|gb|EFS22693.1| LSU ribosomal protein L28P [Fusobacterium sp. D12]
 gi|313691715|gb|EFS28550.1| LSU ribosomal protein L28P [Fusobacterium gonidiaformans ATCC
          25563]
          Length = 85

 Score = 38.5 bits (88), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 31/51 (60%), Gaps = 4/51 (7%)

Query: 5  CELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCA 55
          CE+T   ++SGNK+SH++  TRR + PNL     ++ I+     ++I  C+
Sbjct: 4  CEITGTGIISGNKISHSHRLTRRVWKPNL----QVTTILVNGNPIKIKVCS 50


>gi|216264106|ref|ZP_03436100.1| ribosomal protein L28 [Borrelia afzelii ACA-1]
 gi|219684562|ref|ZP_03539505.1| ribosomal protein L28 [Borrelia garinii PBr]
 gi|215980150|gb|EEC20972.1| ribosomal protein L28 [Borrelia afzelii ACA-1]
 gi|219671924|gb|EED28978.1| ribosomal protein L28 [Borrelia garinii PBr]
          Length = 92

 Score = 38.5 bits (88), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 37/82 (45%), Gaps = 14/82 (17%)

Query: 1  MSRVCELTKKTVMSGNKVS-------------HANNKTRRRFLPNLCRITLISDIMEQKY 47
          M+R CE+T K  M GN V              H   KT+R F  NL         + +  
Sbjct: 1  MARKCEITGKKTMFGNNVPRKGLAKKKGGAGQHIGVKTKRTFKVNLINKKFFIPDLGRSI 60

Query: 48 QLRISKCALRSVERQGGLDRFL 69
           +++S  ALRS+ +  GLD FL
Sbjct: 61 NIKVSANALRSISKI-GLDAFL 81


>gi|115461559|ref|NP_001054379.1| Os05g0101400 [Oryza sativa Japonica Group]
 gi|57863893|gb|AAG03094.2|AC073405_10 putative ribosomal protein L28 [Oryza sativa Japonica Group]
 gi|57863847|gb|AAW56888.1| unknown protein [Oryza sativa Japonica Group]
 gi|113577930|dbj|BAF16293.1| Os05g0101400 [Oryza sativa Japonica Group]
 gi|215695247|dbj|BAG90438.1| unnamed protein product [Oryza sativa Japonica Group]
 gi|222629862|gb|EEE61994.1| hypothetical protein OsJ_16775 [Oryza sativa Japonica Group]
          Length = 137

 Score = 38.5 bits (88), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 36/61 (59%)

Query: 3   RVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQ 62
           R+C  T K     NKVS +N+KT+++   NL    L  +  ++  +LR+S  AL+++E+ 
Sbjct: 62  RICPFTDKKTNRANKVSFSNHKTKKQQFVNLQYKKLWWEEGKRFVKLRLSTKALKTIEKH 121

Query: 63  G 63
           G
Sbjct: 122 G 122


>gi|269796915|ref|YP_003316370.1| 50S ribosomal protein L28P [Sanguibacter keddieii DSM 10542]
 gi|269099100|gb|ACZ23536.1| LSU ribosomal protein L28P [Sanguibacter keddieii DSM 10542]
          Length = 78

 Score = 38.5 bits (88), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 36/63 (57%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS VC++       G+ +SH++ +T+RRF PN+ +       + +   LR+S   L++++
Sbjct: 1  MSAVCQVLGTQPGFGHTISHSHVRTKRRFNPNIQKKRFWVPSLGRHVTLRVSARGLKTID 60

Query: 61 RQG 63
          + G
Sbjct: 61 KLG 63


>gi|29377572|ref|NP_816726.1| 50S ribosomal protein L28 [Enterococcus faecalis V583]
 gi|227517277|ref|ZP_03947326.1| 50S ribosomal protein L28 [Enterococcus faecalis TX0104]
 gi|227554536|ref|ZP_03984583.1| 50S ribosomal protein L28 [Enterococcus faecalis HH22]
 gi|229547459|ref|ZP_04436184.1| 50S ribosomal protein L28 [Enterococcus faecalis TX1322]
 gi|229548028|ref|ZP_04436753.1| 50S ribosomal protein L28 [Enterococcus faecalis ATCC 29200]
 gi|255970692|ref|ZP_05421278.1| ribosomal protein L28 [Enterococcus faecalis T1]
 gi|255974272|ref|ZP_05424858.1| ribosomal protein L28 [Enterococcus faecalis T2]
 gi|256618130|ref|ZP_05474976.1| ribosomal protein L28 [Enterococcus faecalis ATCC 4200]
 gi|256761059|ref|ZP_05501639.1| ribosomal protein L28 [Enterococcus faecalis T3]
 gi|256854787|ref|ZP_05560151.1| ribosomal protein L28 [Enterococcus faecalis T8]
 gi|256958393|ref|ZP_05562564.1| ribosomal protein L28 [Enterococcus faecalis DS5]
 gi|256960462|ref|ZP_05564633.1| 50S ribosomal protein L28 [Enterococcus faecalis Merz96]
 gi|256962955|ref|ZP_05567126.1| 50S ribosomal protein L28 [Enterococcus faecalis HIP11704]
 gi|257078297|ref|ZP_05572658.1| 50S ribosomal protein L28 [Enterococcus faecalis JH1]
 gi|257080485|ref|ZP_05574846.1| 50S ribosomal protein L28 [Enterococcus faecalis E1Sol]
 gi|257083210|ref|ZP_05577571.1| 50S ribosomal protein L28 [Enterococcus faecalis Fly1]
 gi|257088227|ref|ZP_05582588.1| ribosomal protein L28 [Enterococcus faecalis D6]
 gi|257091358|ref|ZP_05585719.1| 50S ribosomal protein L28 [Enterococcus faecalis CH188]
 gi|257417241|ref|ZP_05594235.1| ribosomal protein L28 [Enterococcus faecalis AR01/DG]
 gi|257417960|ref|ZP_05594954.1| 50S ribosomal protein L28 [Enterococcus faecalis T11]
 gi|257420438|ref|ZP_05597428.1| 50S ribosomal protein L28 [Enterococcus faecalis X98]
 gi|293385120|ref|ZP_06630946.1| ribosomal protein L28 [Enterococcus faecalis R712]
 gi|293389093|ref|ZP_06633565.1| ribosomal protein L28 [Enterococcus faecalis S613]
 gi|294779987|ref|ZP_06745367.1| ribosomal protein L28 [Enterococcus faecalis PC1.1]
 gi|300861457|ref|ZP_07107541.1| ribosomal protein L28 [Enterococcus faecalis TUSoD Ef11]
 gi|307270569|ref|ZP_07551867.1| ribosomal protein L28 [Enterococcus faecalis TX4248]
 gi|307273615|ref|ZP_07554843.1| ribosomal protein L28 [Enterococcus faecalis TX0855]
 gi|307276663|ref|ZP_07557781.1| ribosomal protein L28 [Enterococcus faecalis TX2134]
 gi|307284859|ref|ZP_07565015.1| ribosomal protein L28 [Enterococcus faecalis TX0860]
 gi|307288881|ref|ZP_07568854.1| ribosomal protein L28 [Enterococcus faecalis TX0109]
 gi|307292133|ref|ZP_07571999.1| ribosomal protein L28 [Enterococcus faecalis TX0411]
 gi|312902134|ref|ZP_07761394.1| ribosomal protein L28 [Enterococcus faecalis TX0470]
 gi|312905422|ref|ZP_07764536.1| ribosomal protein L28 [Enterococcus faecalis TX0635]
 gi|312906696|ref|ZP_07765696.1| ribosomal protein L28 [Enterococcus faecalis DAPTO 512]
 gi|312910842|ref|ZP_07769678.1| ribosomal protein L28 [Enterococcus faecalis DAPTO 516]
 gi|312953211|ref|ZP_07772057.1| ribosomal protein L28 [Enterococcus faecalis TX0102]
 gi|67461513|sp|Q82ZE4|RL28_ENTFA RecName: Full=50S ribosomal protein L28
 gi|29345039|gb|AAO82796.1| ribosomal protein L28 [Enterococcus faecalis V583]
 gi|227075284|gb|EEI13247.1| 50S ribosomal protein L28 [Enterococcus faecalis TX0104]
 gi|227176334|gb|EEI57306.1| 50S ribosomal protein L28 [Enterococcus faecalis HH22]
 gi|229306904|gb|EEN72900.1| 50S ribosomal protein L28 [Enterococcus faecalis ATCC 29200]
 gi|229307491|gb|EEN73478.1| 50S ribosomal protein L28 [Enterococcus faecalis TX1322]
 gi|255961710|gb|EET94186.1| ribosomal protein L28 [Enterococcus faecalis T1]
 gi|255967144|gb|EET97766.1| ribosomal protein L28 [Enterococcus faecalis T2]
 gi|256597657|gb|EEU16833.1| ribosomal protein L28 [Enterococcus faecalis ATCC 4200]
 gi|256682310|gb|EEU22005.1| ribosomal protein L28 [Enterococcus faecalis T3]
 gi|256710347|gb|EEU25391.1| ribosomal protein L28 [Enterococcus faecalis T8]
 gi|256948889|gb|EEU65521.1| ribosomal protein L28 [Enterococcus faecalis DS5]
 gi|256950958|gb|EEU67590.1| 50S ribosomal protein L28 [Enterococcus faecalis Merz96]
 gi|256953451|gb|EEU70083.1| 50S ribosomal protein L28 [Enterococcus faecalis HIP11704]
 gi|256986327|gb|EEU73629.1| 50S ribosomal protein L28 [Enterococcus faecalis JH1]
 gi|256988515|gb|EEU75817.1| 50S ribosomal protein L28 [Enterococcus faecalis E1Sol]
 gi|256991240|gb|EEU78542.1| 50S ribosomal protein L28 [Enterococcus faecalis Fly1]
 gi|256996257|gb|EEU83559.1| ribosomal protein L28 [Enterococcus faecalis D6]
 gi|257000170|gb|EEU86690.1| 50S ribosomal protein L28 [Enterococcus faecalis CH188]
 gi|257159069|gb|EEU89029.1| ribosomal protein L28 [Enterococcus faecalis ARO1/DG]
 gi|257159788|gb|EEU89748.1| 50S ribosomal protein L28 [Enterococcus faecalis T11]
 gi|257162262|gb|EEU92222.1| 50S ribosomal protein L28 [Enterococcus faecalis X98]
 gi|291077597|gb|EFE14961.1| ribosomal protein L28 [Enterococcus faecalis R712]
 gi|291081561|gb|EFE18524.1| ribosomal protein L28 [Enterococcus faecalis S613]
 gi|294452968|gb|EFG21390.1| ribosomal protein L28 [Enterococcus faecalis PC1.1]
 gi|295114427|emb|CBL33064.1| LSU ribosomal protein L28P [Enterococcus sp. 7L76]
 gi|300848918|gb|EFK76671.1| ribosomal protein L28 [Enterococcus faecalis TUSoD Ef11]
 gi|306496786|gb|EFM66337.1| ribosomal protein L28 [Enterococcus faecalis TX0411]
 gi|306500153|gb|EFM69497.1| ribosomal protein L28 [Enterococcus faecalis TX0109]
 gi|306503118|gb|EFM72375.1| ribosomal protein L28 [Enterococcus faecalis TX0860]
 gi|306506773|gb|EFM75925.1| ribosomal protein L28 [Enterococcus faecalis TX2134]
 gi|306509628|gb|EFM78670.1| ribosomal protein L28 [Enterococcus faecalis TX0855]
 gi|306513150|gb|EFM81784.1| ribosomal protein L28 [Enterococcus faecalis TX4248]
 gi|310627344|gb|EFQ10627.1| ribosomal protein L28 [Enterococcus faecalis DAPTO 512]
 gi|310628828|gb|EFQ12111.1| ribosomal protein L28 [Enterococcus faecalis TX0102]
 gi|310631151|gb|EFQ14434.1| ribosomal protein L28 [Enterococcus faecalis TX0635]
 gi|311288865|gb|EFQ67421.1| ribosomal protein L28 [Enterococcus faecalis DAPTO 516]
 gi|311290798|gb|EFQ69354.1| ribosomal protein L28 [Enterococcus faecalis TX0470]
 gi|315026437|gb|EFT38369.1| ribosomal protein L28 [Enterococcus faecalis TX2137]
 gi|315028361|gb|EFT40293.1| ribosomal protein L28 [Enterococcus faecalis TX4000]
 gi|315031801|gb|EFT43733.1| ribosomal protein L28 [Enterococcus faecalis TX0017]
 gi|315034817|gb|EFT46749.1| ribosomal protein L28 [Enterococcus faecalis TX0027]
 gi|315144153|gb|EFT88169.1| ribosomal protein L28 [Enterococcus faecalis TX2141]
 gi|315146590|gb|EFT90606.1| ribosomal protein L28 [Enterococcus faecalis TX4244]
 gi|315150893|gb|EFT94909.1| ribosomal protein L28 [Enterococcus faecalis TX0012]
 gi|315152780|gb|EFT96796.1| ribosomal protein L28 [Enterococcus faecalis TX0031]
 gi|315154701|gb|EFT98717.1| ribosomal protein L28 [Enterococcus faecalis TX0043]
 gi|315159385|gb|EFU03402.1| ribosomal protein L28 [Enterococcus faecalis TX0312]
 gi|315161208|gb|EFU05225.1| ribosomal protein L28 [Enterococcus faecalis TX0645]
 gi|315164408|gb|EFU08425.1| ribosomal protein L28 [Enterococcus faecalis TX1302]
 gi|315167216|gb|EFU11233.1| ribosomal protein L28 [Enterococcus faecalis TX1341]
 gi|315171206|gb|EFU15223.1| ribosomal protein L28 [Enterococcus faecalis TX1342]
 gi|315172955|gb|EFU16972.1| ribosomal protein L28 [Enterococcus faecalis TX1346]
 gi|315573264|gb|EFU85455.1| ribosomal protein L28 [Enterococcus faecalis TX0309B]
 gi|315577124|gb|EFU89315.1| ribosomal protein L28 [Enterococcus faecalis TX0630]
 gi|315581162|gb|EFU93353.1| ribosomal protein L28 [Enterococcus faecalis TX0309A]
 gi|323479044|gb|ADX78483.1| ribosomal protein L28 [Enterococcus faecalis 62]
 gi|327536233|gb|AEA95067.1| 50S ribosomal protein L28 [Enterococcus faecalis OG1RF]
 gi|329576766|gb|EGG58259.1| ribosomal protein L28 [Enterococcus faecalis TX1467]
          Length = 62

 Score = 38.5 bits (88), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 37/63 (58%), Gaps = 4/63 (6%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS-- 58
          M++VC  T +   SGN  SHA N T+R   PNL ++ ++ D   +K  + +S  AL+S  
Sbjct: 1  MAKVCYFTGRKTSSGNNRSHAMNSTKRTVKPNLQKVRVLIDGKPKK--VWVSTRALKSGK 58

Query: 59 VER 61
          +ER
Sbjct: 59 IER 61


>gi|46579622|ref|YP_010430.1| 50S ribosomal protein L28 [Desulfovibrio vulgaris str.
          Hildenborough]
 gi|120602890|ref|YP_967290.1| 50S ribosomal protein L28 [Desulfovibrio vulgaris DP4]
 gi|67461458|sp|Q72CS2|RL28_DESVH RecName: Full=50S ribosomal protein L28
 gi|166226569|sp|A1VEJ7|RL28_DESVV RecName: Full=50S ribosomal protein L28
 gi|46449037|gb|AAS95689.1| ribosomal protein L28 [Desulfovibrio vulgaris str. Hildenborough]
 gi|120563119|gb|ABM28863.1| LSU ribosomal protein L28P [Desulfovibrio vulgaris DP4]
 gi|311233426|gb|ADP86280.1| ribosomal protein L28 [Desulfovibrio vulgaris RCH1]
          Length = 69

 Score = 38.5 bits (88), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 22/33 (66%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNL 33
          M + CE+  K    G+ VSH+N KT+RRF PNL
Sbjct: 1  MGKQCEVCGKKPQVGHHVSHSNIKTKRRFEPNL 33


>gi|218195912|gb|EEC78339.1| hypothetical protein OsI_18082 [Oryza sativa Indica Group]
          Length = 213

 Score = 38.5 bits (88), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 36/62 (58%)

Query: 2   SRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVER 61
            R+C  T K     NKVS +N+KT+++   NL    L  +  ++  +LR+S  AL+++E+
Sbjct: 137 GRICPFTDKKTNRANKVSFSNHKTKKQQFVNLQYKKLWWEEGKRFVKLRLSTKALKTIEK 196

Query: 62  QG 63
            G
Sbjct: 197 HG 198


>gi|111115174|ref|YP_709792.1| 50S ribosomal protein L28 [Borrelia afzelii PKo]
 gi|122956384|sp|Q0SNG2|RL28_BORAP RecName: Full=50S ribosomal protein L28
 gi|110890448|gb|ABH01616.1| ribosomal protein L28 [Borrelia afzelii PKo]
          Length = 92

 Score = 38.5 bits (88), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 37/82 (45%), Gaps = 14/82 (17%)

Query: 1  MSRVCELTKKTVMSGNKVS-------------HANNKTRRRFLPNLCRITLISDIMEQKY 47
          M+R CE+T K  M GN V              H   KT+R F  NL         + +  
Sbjct: 1  MARKCEITGKKTMFGNNVPRKGLAKKKGGARQHIGVKTKRTFKVNLINKKFFIPDLGRSI 60

Query: 48 QLRISKCALRSVERQGGLDRFL 69
           +++S  ALRS+ +  GLD FL
Sbjct: 61 NIKVSANALRSISKI-GLDAFL 81


>gi|90414933|ref|ZP_01222897.1| putative ribosomal protein L28 [Photobacterium profundum 3TCK]
 gi|90323989|gb|EAS40585.1| putative ribosomal protein L28 [Photobacterium profundum 3TCK]
          Length = 68

 Score = 38.5 bits (88), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 32/51 (62%)

Query: 13 MSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQG 63
          ++GN  SHA N T+RRFLPNL       +  ++  +LR++   +R ++++G
Sbjct: 3  VTGNNRSHARNATKRRFLPNLQTHRFWVESEKRFVKLRLTAKGMRIIDKKG 53


>gi|15594695|ref|NP_212484.1| 50S ribosomal protein L28 [Borrelia burgdorferi B31]
 gi|218249319|ref|YP_002374870.1| ribosomal protein L28 [Borrelia burgdorferi ZS7]
 gi|221217814|ref|ZP_03589282.1| ribosomal protein L28 [Borrelia burgdorferi 72a]
 gi|223889036|ref|ZP_03623627.1| ribosomal protein L28 [Borrelia burgdorferi 64b]
 gi|224533135|ref|ZP_03673735.1| ribosomal protein L28 [Borrelia burgdorferi WI91-23]
 gi|225549021|ref|ZP_03769996.1| ribosomal protein L28 [Borrelia burgdorferi 94a]
 gi|225550155|ref|ZP_03771115.1| ribosomal protein L28 [Borrelia burgdorferi 118a]
 gi|226320431|ref|ZP_03795998.1| ribosomal protein L28 [Borrelia burgdorferi 29805]
 gi|226321667|ref|ZP_03797193.1| ribosomal protein L28 [Borrelia burgdorferi Bol26]
 gi|3914732|sp|O51325|RL28_BORBU RecName: Full=50S ribosomal protein L28
 gi|226738035|sp|B7J1S5|RL28_BORBZ RecName: Full=50S ribosomal protein L28
 gi|2688254|gb|AAC66732.1| ribosomal protein L28 (rpmB) [Borrelia burgdorferi B31]
 gi|218164507|gb|ACK74568.1| ribosomal protein L28 [Borrelia burgdorferi ZS7]
 gi|221192491|gb|EEE18710.1| ribosomal protein L28 [Borrelia burgdorferi 72a]
 gi|223885852|gb|EEF56951.1| ribosomal protein L28 [Borrelia burgdorferi 64b]
 gi|224511862|gb|EEF82263.1| ribosomal protein L28 [Borrelia burgdorferi WI91-23]
 gi|225369267|gb|EEG98720.1| ribosomal protein L28 [Borrelia burgdorferi 118a]
 gi|225370247|gb|EEG99685.1| ribosomal protein L28 [Borrelia burgdorferi 94a]
 gi|226232856|gb|EEH31609.1| ribosomal protein L28 [Borrelia burgdorferi Bol26]
 gi|226234184|gb|EEH32898.1| ribosomal protein L28 [Borrelia burgdorferi 29805]
 gi|312148522|gb|ADQ31181.1| ribosomal protein L28 [Borrelia burgdorferi JD1]
 gi|312149317|gb|ADQ29388.1| ribosomal protein L28 [Borrelia burgdorferi N40]
          Length = 92

 Score = 38.5 bits (88), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 37/82 (45%), Gaps = 14/82 (17%)

Query: 1  MSRVCELTKKTVMSGNKVS-------------HANNKTRRRFLPNLCRITLISDIMEQKY 47
          M+R CE+T K  M GN V              H   KT+R F  NL         + +  
Sbjct: 1  MARKCEITGKKTMFGNNVPRKGLAKKKGGAGQHIGVKTKRTFKVNLINKKFFIPNLGRSV 60

Query: 48 QLRISKCALRSVERQGGLDRFL 69
           +++S  ALRS+ +  GLD FL
Sbjct: 61 SIKVSANALRSISKI-GLDAFL 81


>gi|237745230|ref|ZP_04575711.1| LSU ribosomal protein L28P [Fusobacterium sp. 7_1]
 gi|256026665|ref|ZP_05440499.1| 50S ribosomal protein L28P [Fusobacterium sp. D11]
 gi|260495477|ref|ZP_05815603.1| ribosomal protein L28 [Fusobacterium sp. 3_1_33]
 gi|289764663|ref|ZP_06524041.1| LSU ribosomal protein L28P [Fusobacterium sp. D11]
 gi|229432459|gb|EEO42671.1| LSU ribosomal protein L28P [Fusobacterium sp. 7_1]
 gi|260197014|gb|EEW94535.1| ribosomal protein L28 [Fusobacterium sp. 3_1_33]
 gi|289716218|gb|EFD80230.1| LSU ribosomal protein L28P [Fusobacterium sp. D11]
          Length = 85

 Score = 38.1 bits (87), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 26/37 (70%)

Query: 5  CELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISD 41
          CE+T   ++SGNK+SH++  TRR + PNL   TL+ +
Sbjct: 4  CEITGTGLISGNKISHSHRLTRRVWKPNLQVTTLLVN 40


>gi|309386056|gb|ADO66946.1| 50S ribosomal protein L28 [Enterococcus faecium]
          Length = 64

 Score = 38.1 bits (87), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 28/47 (59%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKY 47
          M++VC  T +   SGN  SHA N T+R   PNL ++ ++ D   +K+
Sbjct: 12 MAKVCYFTGRKTKSGNNRSHAMNSTKRTVKPNLQKVRVMVDGKPKKF 58


>gi|83589771|ref|YP_429780.1| 50S ribosomal protein L28P [Moorella thermoacetica ATCC 39073]
 gi|123524717|sp|Q2RK02|RL28_MOOTA RecName: Full=50S ribosomal protein L28
 gi|83572685|gb|ABC19237.1| LSU ribosomal protein L28P [Moorella thermoacetica ATCC 39073]
          Length = 62

 Score = 38.1 bits (87), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 26/37 (70%)

Query: 5  CELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISD 41
          C +  K  ++GN+VSH+N KT+R + PNL R+ L+ +
Sbjct: 4  CSICGKRAVTGNQVSHSNIKTKRTWAPNLQRVKLLVN 40


>gi|310798120|gb|EFQ33013.1| ribosomal L28 family protein [Glomerella graminicola M1.001]
          Length = 256

 Score = 38.1 bits (87), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 41/71 (57%), Gaps = 5/71 (7%)

Query: 15  GNKVSHANNK-TRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFLSNSK 73
           G+ VS  + + T R + PN+ R  L S+ +    + R++   LR+V R+GG+D +++ +K
Sbjct: 81  GHNVSEKHGQVTPRTWRPNVHRKRLWSEALGAWVRARLTTRVLRTVRREGGIDAYVTKAK 140

Query: 74  KENLSARMRTL 84
                AR+R L
Sbjct: 141 P----ARVREL 147


>gi|296083696|emb|CBI23685.3| unnamed protein product [Vitis vinifera]
          Length = 118

 Score = 38.1 bits (87), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 35/61 (57%)

Query: 3   RVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQ 62
           RVC  T K     NKVS +N+KT++    NL    +  +  ++  +LR+S  AL+++E+ 
Sbjct: 43  RVCPFTGKKANKANKVSFSNHKTKKLQFVNLQYKKIWWEAGKRYVKLRLSTKALKTIEKN 102

Query: 63  G 63
           G
Sbjct: 103 G 103


>gi|332981573|ref|YP_004463014.1| 50S ribosomal protein L28P [Mahella australiensis 50-1 BON]
 gi|332699251|gb|AEE96192.1| LSU ribosomal protein L28P [Mahella australiensis 50-1 BON]
          Length = 63

 Score = 38.1 bits (87), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 28/41 (68%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISD 41
          MS+ C +  K+V  GN +SH++ ++ RR+ PNL R+ ++ +
Sbjct: 1  MSKECAICHKSVAYGNAISHSHRRSNRRWEPNLRRVRIVVN 41


>gi|167535430|ref|XP_001749389.1| hypothetical protein [Monosiga brevicollis MX1]
 gi|163772255|gb|EDQ85910.1| predicted protein [Monosiga brevicollis MX1]
          Length = 140

 Score = 38.1 bits (87), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 17/67 (25%), Positives = 42/67 (62%), Gaps = 1/67 (1%)

Query: 31  PNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFLSNSKKENLSARMRT-LRSQIL 89
           PN+      SDI+++  +++++  A+R +++ GG D ++  ++ E L + +   LR ++L
Sbjct: 53  PNVFEKRYYSDILKRYTKVKVTTKAIRCIDKAGGFDNYILMTQPEKLDSELGMKLRVEML 112

Query: 90  KKMSEKS 96
           +KM+ ++
Sbjct: 113 QKMARRA 119


>gi|320012235|gb|ADW07085.1| ribosomal protein L28 [Streptomyces flavogriseus ATCC 33331]
          Length = 78

 Score = 38.1 bits (87), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 35/63 (55%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS  C+LT      GNK+SH++ +T RRF PN+ R         +  +L +S  A+R+++
Sbjct: 1  MSAHCQLTGSRPGFGNKISHSHRRTPRRFDPNVQRKRYWLPGEGRYVRLTLSARAVRTID 60

Query: 61 RQG 63
            G
Sbjct: 61 AIG 63


>gi|255724426|ref|XP_002547142.1| conserved hypothetical protein [Candida tropicalis MYA-3404]
 gi|240135033|gb|EER34587.1| conserved hypothetical protein [Candida tropicalis MYA-3404]
          Length = 266

 Score = 38.1 bits (87), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 44/85 (51%), Gaps = 3/85 (3%)

Query: 14  SGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFLSNSK 73
           S  K S   NKT R   PN     L S+ + +K +L+++   L+++ ++GGLD +L  S 
Sbjct: 101 SSKKCSEFLNKTLRSHKPNAVWTKLWSETLNKKLRLKVAVKVLKTISKEGGLDAYLLKST 160

Query: 74  K---ENLSARMRTLRSQILKKMSEK 95
               + +  +   LR ++L+   +K
Sbjct: 161 PGRIKTMGLKAWQLRYELLQAQEQK 185


>gi|25027499|ref|NP_737553.1| 50S ribosomal protein L28 [Corynebacterium efficiens YS-314]
 gi|67461532|sp|Q8FR24|RL28_COREF RecName: Full=50S ribosomal protein L28
 gi|23492781|dbj|BAC17753.1| putative 50S ribosomal protein L28 [Corynebacterium efficiens
          YS-314]
          Length = 78

 Score = 38.1 bits (87), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 33/63 (52%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS  C++T +    G  VSH++ +T RR+ PN+ R       M +   L +S   L+ ++
Sbjct: 1  MSAHCQVTGRQPSFGKSVSHSHRRTSRRWNPNVQRRKFFVPSMGRTITLTVSTKGLKVID 60

Query: 61 RQG 63
          R G
Sbjct: 61 RDG 63


>gi|289613675|emb|CBI59423.1| unnamed protein product [Sordaria macrospora]
          Length = 266

 Score = 38.1 bits (87), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 41/71 (57%), Gaps = 5/71 (7%)

Query: 15  GNKVSHANN-KTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFLSNSK 73
           GN VS  N  KTRR++ PN+ +  L S  +    + R++   LR++++ GGLD +L   K
Sbjct: 99  GNNVSKRNEIKTRRKWRPNVQQKRLWSKSLGVFVRTRVTTRVLRTIDKVGGLDEYLLGHK 158

Query: 74  KENLSARMRTL 84
               +AR++ L
Sbjct: 159 ----AARVKEL 165


>gi|166235356|pdb|2JZ6|A Chain A, Solution Structure Of 50s Ribosomal Protein L28 From
          Thermotoga Maritima. Northeast Structural Genomics
          Consortium Target Vr97
          Length = 77

 Score = 38.1 bits (87), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 26/39 (66%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLI 39
          M++ CE+  K   SGN VSH++ K+ R F PNL ++ ++
Sbjct: 6  MAKRCEVCGKAPRSGNTVSHSDKKSERWFRPNLQKVRVV 44


>gi|302335850|ref|YP_003801057.1| ribosomal protein L28 [Olsenella uli DSM 7084]
 gi|301319690|gb|ADK68177.1| ribosomal protein L28 [Olsenella uli DSM 7084]
          Length = 66

 Score = 38.1 bits (87), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 27/41 (65%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISD 41
          MS+VC++  K  ++G  +SH++    R+F PN+ R+T+  +
Sbjct: 1  MSKVCDICGKHAVAGRSISHSHRTVTRKFKPNIQRVTVFEN 41


>gi|255575833|ref|XP_002528814.1| 50S ribosomal protein L28, chloroplast precursor, putative [Ricinus
           communis]
 gi|223531726|gb|EEF33548.1| 50S ribosomal protein L28, chloroplast precursor, putative [Ricinus
           communis]
          Length = 143

 Score = 38.1 bits (87), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 37/64 (57%), Gaps = 1/64 (1%)

Query: 3   RVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQ 62
           RVC  T K     NKVS +N+KT++    NL    +  +  ++  +LR+S  AL+++E+ 
Sbjct: 68  RVCPFTGKKANRANKVSFSNHKTKKLQFVNLQYKKIWWEAGKRYVKLRLSTKALKTIEKN 127

Query: 63  GGLD 66
            GLD
Sbjct: 128 -GLD 130


>gi|226365090|ref|YP_002782873.1| 50S ribosomal protein L28 [Rhodococcus opacus B4]
 gi|226243580|dbj|BAH53928.1| 50S ribosomal protein L28 [Rhodococcus opacus B4]
          Length = 78

 Score = 38.1 bits (87), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 36/63 (57%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS  C++T +    G  VSH++ +T RR+ PN+ + T +     ++  L +S   +++V+
Sbjct: 1  MSAHCQVTGRKPGFGKSVSHSHKRTNRRWDPNIQKKTYLLPSEGRRITLTLSAKGIKTVD 60

Query: 61 RQG 63
          R G
Sbjct: 61 RDG 63


>gi|261405806|ref|YP_003242047.1| 50S ribosomal protein L28 [Paenibacillus sp. Y412MC10]
 gi|315646184|ref|ZP_07899304.1| ribosomal protein L28 [Paenibacillus vortex V453]
 gi|261282269|gb|ACX64240.1| ribosomal protein L28 [Paenibacillus sp. Y412MC10]
 gi|315278383|gb|EFU41699.1| ribosomal protein L28 [Paenibacillus vortex V453]
          Length = 62

 Score = 38.1 bits (87), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 35/58 (60%), Gaps = 2/58 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS 58
          M+R C +T K   SGN VSHANN  +R +  N+ ++ ++ D   ++  + +S  AL+S
Sbjct: 1  MARKCYVTGKKPSSGNHVSHANNHNKRSWGVNVQKVRILVDGKPKR--VYVSTRALKS 56


>gi|225433211|ref|XP_002285387.1| PREDICTED: hypothetical protein [Vitis vinifera]
          Length = 146

 Score = 38.1 bits (87), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 35/61 (57%)

Query: 3   RVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQ 62
           RVC  T K     NKVS +N+KT++    NL    +  +  ++  +LR+S  AL+++E+ 
Sbjct: 71  RVCPFTGKKANKANKVSFSNHKTKKLQFVNLQYKKIWWEAGKRYVKLRLSTKALKTIEKN 130

Query: 63  G 63
           G
Sbjct: 131 G 131


>gi|148242482|ref|YP_001227639.1| 50S ribosomal protein L28 [Synechococcus sp. RCC307]
 gi|166228168|sp|A5GTS7|RL28_SYNR3 RecName: Full=50S ribosomal protein L28
 gi|147850792|emb|CAK28286.1| 50S ribosomal protein L28 [Synechococcus sp. RCC307]
          Length = 78

 Score = 38.1 bits (87), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 39/63 (61%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC+L+ K   +G  VSH++ +T++    NL +  L      +  +LR+S  ALR+++
Sbjct: 1  MSRVCQLSGKRANNGMAVSHSHVRTKKLQQVNLQQRRLWWAEGNRWVKLRVSTSALRTIQ 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|148269805|ref|YP_001244265.1| 50S ribosomal protein L28 [Thermotoga petrophila RKU-1]
 gi|147735349|gb|ABQ46689.1| LSU ribosomal protein L28P [Thermotoga petrophila RKU-1]
          Length = 86

 Score = 38.1 bits (87), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 26/39 (66%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLI 39
          M++ CE+  K   SGN VSH++ K+ R F PNL ++ ++
Sbjct: 17 MAKRCEVCGKAPRSGNTVSHSDKKSGRWFRPNLQKVRVV 55


>gi|320594142|gb|EFX06545.1| 50S ribosomal protein l24 [Grosmannia clavigera kw1407]
          Length = 268

 Score = 38.1 bits (87), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 35/69 (50%), Gaps = 5/69 (7%)

Query: 15  GNKVSHAN-----NKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFL 69
           GN VS         K RR++ PN+    L S  +    + RIS   LR+V++ GGLD +L
Sbjct: 104 GNTVSRQTEIINPQKNRRKWRPNIQEKRLWSASLSAPIRTRISTRVLRTVDKVGGLDEYL 163

Query: 70  SNSKKENLS 78
             SK   ++
Sbjct: 164 LGSKPARIA 172


>gi|88854442|ref|ZP_01129109.1| 50S ribosomal protein L28 [marine actinobacterium PHSC20C1]
 gi|88816250|gb|EAR26105.1| 50S ribosomal protein L28 [marine actinobacterium PHSC20C1]
          Length = 78

 Score = 38.1 bits (87), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 16/63 (25%), Positives = 36/63 (57%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+  C++T      G+ +SH++ +T+RRF PN+ + T     + +   L++S   ++ ++
Sbjct: 1  MAATCQVTGAIPGFGHSISHSHRRTKRRFDPNIQKKTYFVPSLRRNVTLQLSAKGIKVID 60

Query: 61 RQG 63
           +G
Sbjct: 61 ARG 63


>gi|226307890|ref|YP_002767850.1| 50S ribosomal protein L28 [Rhodococcus erythropolis PR4]
 gi|226187007|dbj|BAH35111.1| 50S ribosomal protein L28 [Rhodococcus erythropolis PR4]
          Length = 78

 Score = 38.1 bits (87), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 36/63 (57%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS  C++T +    G  VSH++ ++ RR+ PN+ R T +     ++  L +S   +++++
Sbjct: 1  MSAHCQVTGRVPGFGKSVSHSHKRSNRRWNPNIQRKTYVLPSEGRRITLTLSTKGIKTID 60

Query: 61 RQG 63
          R G
Sbjct: 61 RDG 63


>gi|326505850|dbj|BAJ91164.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gi|326527411|dbj|BAK07980.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 136

 Score = 38.1 bits (87), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 38/64 (59%), Gaps = 1/64 (1%)

Query: 3   RVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQ 62
           R+C   +K     NKVS +N+KT+++   NL    L  +  ++  +LR+S  AL+++E+ 
Sbjct: 61  RICPFLEKKTNRANKVSFSNHKTKKQQFVNLQYKKLWWEAGKRYVKLRLSTKALKTIEKH 120

Query: 63  GGLD 66
            GLD
Sbjct: 121 -GLD 123


>gi|253581407|ref|ZP_04858633.1| ribosomal protein L28 [Fusobacterium varium ATCC 27725]
 gi|257470806|ref|ZP_05634896.1| 50S ribosomal protein L28P [Fusobacterium ulcerans ATCC 49185]
 gi|317065010|ref|ZP_07929495.1| LSU ribosomal protein L28P [Fusobacterium ulcerans ATCC 49185]
 gi|251836771|gb|EES65305.1| ribosomal protein L28 [Fusobacterium varium ATCC 27725]
 gi|313690686|gb|EFS27521.1| LSU ribosomal protein L28P [Fusobacterium ulcerans ATCC 49185]
          Length = 85

 Score = 38.1 bits (87), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 26/37 (70%)

Query: 5  CELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISD 41
          CE+T   ++SGN++SH++  TRR + PNL   T++ +
Sbjct: 4  CEITGTGIISGNQISHSHRLTRRVWKPNLQVTTIVVN 40


>gi|94987268|ref|YP_595201.1| 50S ribosomal protein L28 [Lawsonia intracellularis PHE/MN1-00]
 gi|166226584|sp|Q1MQ47|RL28_LAWIP RecName: Full=50S ribosomal protein L28
 gi|94731517|emb|CAJ54880.1| ribosomal protein L28 [Lawsonia intracellularis PHE/MN1-00]
          Length = 69

 Score = 38.1 bits (87), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 23/33 (69%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNL 33
          M++ CE+  K  + GN VSH+N KT+R F PNL
Sbjct: 1  MAKQCEICGKKPLVGNYVSHSNIKTKRVFNPNL 33


>gi|85110139|ref|XP_963282.1| hypothetical protein NCU08410 [Neurospora crassa OR74A]
 gi|164423992|ref|XP_001728109.1| hypothetical protein NCU10866 [Neurospora crassa OR74A]
 gi|28924956|gb|EAA34046.1| conserved hypothetical protein [Neurospora crassa OR74A]
 gi|157070322|gb|EDO65018.1| conserved hypothetical protein [Neurospora crassa OR74A]
          Length = 274

 Score = 38.1 bits (87), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 41/71 (57%), Gaps = 5/71 (7%)

Query: 15  GNKVSHANN-KTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFLSNSK 73
           GN VS  N  KTRR++ PN+ +  L S  +    + R++   LR++++ GGLD +L   K
Sbjct: 104 GNNVSKRNEIKTRRKWRPNVQQKRLWSKSLGVFVRTRVTTRVLRTIDKVGGLDEYLLGHK 163

Query: 74  KENLSARMRTL 84
               +AR++ L
Sbjct: 164 ----AARVKEL 170


>gi|194476650|ref|YP_002048829.1| 50S ribosomal protein L28 [Paulinella chromatophora]
 gi|171191657|gb|ACB42619.1| 50S ribosomal protein L28 [Paulinella chromatophora]
          Length = 78

 Score = 38.1 bits (87), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 38/63 (60%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC+LT K   +G  VSH++ +T++    NL    L      +  +LRIS  ALR+++
Sbjct: 1  MSRVCQLTGKRANNGMAVSHSHIRTKKLQQVNLQARRLWWTEGNRWIKLRISTRALRTIQ 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|314967206|gb|EFT11305.1| ribosomal protein L28 [Propionibacterium acnes HL082PA2]
          Length = 105

 Score = 37.7 bits (86), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 35/63 (55%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR C++       GN VSH+   T+RR+ PN+ +       + +K  L ++  A++ ++
Sbjct: 1  MSRRCQVRGTKPEFGNNVSHSQRHTKRRWNPNIQKKRYWVPSLGRKVTLTLTPKAIKEID 60

Query: 61 RQG 63
          R+G
Sbjct: 61 RRG 63


>gi|30021946|ref|NP_833577.1| 50S ribosomal protein L28 [Bacillus cereus ATCC 14579]
 gi|42782950|ref|NP_980197.1| 50S ribosomal protein L28 [Bacillus cereus ATCC 10987]
 gi|49478419|ref|YP_037919.1| 50S ribosomal protein L28 [Bacillus thuringiensis serovar
          konkukian str. 97-27]
 gi|52141630|ref|YP_085199.1| 50S ribosomal protein L28 [Bacillus cereus E33L]
 gi|118479080|ref|YP_896231.1| 50S ribosomal protein L28 [Bacillus thuringiensis str. Al Hakam]
 gi|163941596|ref|YP_001646480.1| 50S ribosomal protein L28 [Bacillus weihenstephanensis KBAB4]
 gi|196035826|ref|ZP_03103228.1| ribosomal protein L28 [Bacillus cereus W]
 gi|196038841|ref|ZP_03106149.1| ribosomal protein L28 [Bacillus cereus NVH0597-99]
 gi|196047440|ref|ZP_03114652.1| ribosomal protein L28 [Bacillus cereus 03BB108]
 gi|206971109|ref|ZP_03232060.1| 50S ribosomal protein L28 [Bacillus cereus AH1134]
 gi|206976773|ref|ZP_03237677.1| 50S ribosomal protein L28 [Bacillus cereus H3081.97]
 gi|217961278|ref|YP_002339846.1| 50S ribosomal protein L28 [Bacillus cereus AH187]
 gi|218234080|ref|YP_002368659.1| 50S ribosomal protein L28 [Bacillus cereus B4264]
 gi|218899011|ref|YP_002447422.1| ribosomal protein L28 [Bacillus cereus G9842]
 gi|218904988|ref|YP_002452822.1| ribosomal protein L28 [Bacillus cereus AH820]
 gi|222097303|ref|YP_002531360.1| 50S ribosomal protein l28 [Bacillus cereus Q1]
 gi|225865839|ref|YP_002751217.1| 50S ribosomal protein L28 [Bacillus cereus 03BB102]
 gi|228902362|ref|ZP_04066518.1| 50S ribosomal protein L28 [Bacillus thuringiensis IBL 4222]
 gi|228909683|ref|ZP_04073506.1| 50S ribosomal protein L28 [Bacillus thuringiensis IBL 200]
 gi|228916495|ref|ZP_04080061.1| 50S ribosomal protein L28 [Bacillus thuringiensis serovar
          pulsiensis BGSC 4CC1]
 gi|228922612|ref|ZP_04085912.1| 50S ribosomal protein L28 [Bacillus thuringiensis serovar
          huazhongensis BGSC 4BD1]
 gi|228928906|ref|ZP_04091938.1| 50S ribosomal protein L28 [Bacillus thuringiensis serovar
          pondicheriensis BGSC 4BA1]
 gi|228935172|ref|ZP_04097999.1| 50S ribosomal protein L28 [Bacillus thuringiensis serovar
          andalousiensis BGSC 4AW1]
 gi|228940946|ref|ZP_04103505.1| 50S ribosomal protein L28 [Bacillus thuringiensis serovar
          berliner ATCC 10792]
 gi|228947577|ref|ZP_04109867.1| 50S ribosomal protein L28 [Bacillus thuringiensis serovar
          monterrey BGSC 4AJ1]
 gi|228954135|ref|ZP_04116163.1| 50S ribosomal protein L28 [Bacillus thuringiensis serovar
          kurstaki str. T03a001]
 gi|228960074|ref|ZP_04121738.1| 50S ribosomal protein L28 [Bacillus thuringiensis serovar
          pakistani str. T13001]
 gi|228966807|ref|ZP_04127851.1| 50S ribosomal protein L28 [Bacillus thuringiensis serovar sotto
          str. T04001]
 gi|228973875|ref|ZP_04134451.1| 50S ribosomal protein L28 [Bacillus thuringiensis serovar
          thuringiensis str. T01001]
 gi|228980465|ref|ZP_04140775.1| 50S ribosomal protein L28 [Bacillus thuringiensis Bt407]
 gi|228987001|ref|ZP_04147127.1| 50S ribosomal protein L28 [Bacillus thuringiensis serovar
          tochigiensis BGSC 4Y1]
 gi|228992586|ref|ZP_04152513.1| 50S ribosomal protein L28 [Bacillus pseudomycoides DSM 12442]
 gi|228998634|ref|ZP_04158221.1| 50S ribosomal protein L28 [Bacillus mycoides Rock3-17]
 gi|229013042|ref|ZP_04170207.1| 50S ribosomal protein L28 [Bacillus mycoides DSM 2048]
 gi|229019055|ref|ZP_04175894.1| 50S ribosomal protein L28 [Bacillus cereus AH1273]
 gi|229025300|ref|ZP_04181719.1| 50S ribosomal protein L28 [Bacillus cereus AH1272]
 gi|229031488|ref|ZP_04187488.1| 50S ribosomal protein L28 [Bacillus cereus AH1271]
 gi|229047545|ref|ZP_04193135.1| 50S ribosomal protein L28 [Bacillus cereus AH676]
 gi|229061461|ref|ZP_04198806.1| 50S ribosomal protein L28 [Bacillus cereus AH603]
 gi|229071356|ref|ZP_04204579.1| 50S ribosomal protein L28 [Bacillus cereus F65185]
 gi|229081113|ref|ZP_04213623.1| 50S ribosomal protein L28 [Bacillus cereus Rock4-2]
 gi|229086411|ref|ZP_04218587.1| 50S ribosomal protein L28 [Bacillus cereus Rock3-44]
 gi|229092901|ref|ZP_04224035.1| 50S ribosomal protein L28 [Bacillus cereus Rock3-42]
 gi|229098327|ref|ZP_04229274.1| 50S ribosomal protein L28 [Bacillus cereus Rock3-29]
 gi|229104420|ref|ZP_04235089.1| 50S ribosomal protein L28 [Bacillus cereus Rock3-28]
 gi|229111329|ref|ZP_04240882.1| 50S ribosomal protein L28 [Bacillus cereus Rock1-15]
 gi|229117344|ref|ZP_04246722.1| 50S ribosomal protein L28 [Bacillus cereus Rock1-3]
 gi|229123372|ref|ZP_04252576.1| 50S ribosomal protein L28 [Bacillus cereus 95/8201]
 gi|229129134|ref|ZP_04258107.1| 50S ribosomal protein L28 [Bacillus cereus BDRD-Cer4]
 gi|229134666|ref|ZP_04263475.1| 50S ribosomal protein L28 [Bacillus cereus BDRD-ST196]
 gi|229140504|ref|ZP_04269059.1| 50S ribosomal protein L28 [Bacillus cereus BDRD-ST26]
 gi|229146429|ref|ZP_04274800.1| 50S ribosomal protein L28 [Bacillus cereus BDRD-ST24]
 gi|229152057|ref|ZP_04280252.1| 50S ribosomal protein L28 [Bacillus cereus m1550]
 gi|229157434|ref|ZP_04285512.1| 50S ribosomal protein L28 [Bacillus cereus ATCC 4342]
 gi|229162794|ref|ZP_04290751.1| 50S ribosomal protein L28 [Bacillus cereus R309803]
 gi|229168598|ref|ZP_04296321.1| 50S ribosomal protein L28 [Bacillus cereus AH621]
 gi|229174524|ref|ZP_04302056.1| 50S ribosomal protein L28 [Bacillus cereus MM3]
 gi|229180134|ref|ZP_04307478.1| 50S ribosomal protein L28 [Bacillus cereus 172560W]
 gi|229186098|ref|ZP_04313267.1| 50S ribosomal protein L28 [Bacillus cereus BGSC 6E1]
 gi|229192027|ref|ZP_04318997.1| 50S ribosomal protein L28 [Bacillus cereus ATCC 10876]
 gi|229197969|ref|ZP_04324683.1| 50S ribosomal protein L28 [Bacillus cereus m1293]
 gi|296504353|ref|YP_003666053.1| 50S ribosomal protein L28 [Bacillus thuringiensis BMB171]
 gi|301055349|ref|YP_003793560.1| 50S ribosomal protein L28 [Bacillus anthracis CI]
 gi|67461362|sp|Q636G8|RL28_BACCZ RecName: Full=50S ribosomal protein L28
 gi|67461413|sp|Q6HEV7|RL28_BACHK RecName: Full=50S ribosomal protein L28
 gi|67461469|sp|Q732L2|RL28_BACC1 RecName: Full=50S ribosomal protein L28
 gi|67461510|sp|Q819U9|RL28_BACCR RecName: Full=50S ribosomal protein L28
 gi|166226542|sp|A0RHN1|RL28_BACAH RecName: Full=50S ribosomal protein L28
 gi|226738028|sp|B7JJU5|RL28_BACC0 RecName: Full=50S ribosomal protein L28
 gi|226738029|sp|B7IUL7|RL28_BACC2 RecName: Full=50S ribosomal protein L28
 gi|226738030|sp|B7HDY1|RL28_BACC4 RecName: Full=50S ribosomal protein L28
 gi|226738031|sp|B7HLJ1|RL28_BACC7 RecName: Full=50S ribosomal protein L28
 gi|226738032|sp|A9VT96|RL28_BACWK RecName: Full=50S ribosomal protein L28
 gi|254801500|sp|C1EP82|RL28_BACC3 RecName: Full=50S ribosomal protein L28
 gi|254801501|sp|B9IVE7|RL28_BACCQ RecName: Full=50S ribosomal protein L28
 gi|29897502|gb|AAP10778.1| LSU ribosomal protein L28P [Bacillus cereus ATCC 14579]
 gi|42738877|gb|AAS42805.1| ribosomal protein L28 [Bacillus cereus ATCC 10987]
 gi|49329975|gb|AAT60621.1| ribosomal protein L28 (50S ribosomal protein L28) [Bacillus
          thuringiensis serovar konkukian str. 97-27]
 gi|51975099|gb|AAU16649.1| ribosomal protein L28 (50S ribosomal protein L28) [Bacillus
          cereus E33L]
 gi|118418305|gb|ABK86724.1| LSU ribosomal protein L28P [Bacillus thuringiensis str. Al Hakam]
 gi|163863793|gb|ABY44852.1| ribosomal protein L28 [Bacillus weihenstephanensis KBAB4]
 gi|195991475|gb|EDX55441.1| ribosomal protein L28 [Bacillus cereus W]
 gi|196021748|gb|EDX60443.1| ribosomal protein L28 [Bacillus cereus 03BB108]
 gi|196030564|gb|EDX69163.1| ribosomal protein L28 [Bacillus cereus NVH0597-99]
 gi|206733881|gb|EDZ51052.1| 50S ribosomal protein L28 [Bacillus cereus AH1134]
 gi|206745083|gb|EDZ56486.1| 50S ribosomal protein L28 [Bacillus cereus H3081.97]
 gi|217067055|gb|ACJ81305.1| ribosomal protein L28 [Bacillus cereus AH187]
 gi|218162037|gb|ACK62029.1| ribosomal protein L28 [Bacillus cereus B4264]
 gi|218536430|gb|ACK88828.1| ribosomal protein L28 [Bacillus cereus AH820]
 gi|218542153|gb|ACK94547.1| ribosomal protein L28 [Bacillus cereus G9842]
 gi|221241361|gb|ACM14071.1| ribosomal protein L28 (50S ribosomal protein L28) [Bacillus
          cereus Q1]
 gi|225790030|gb|ACO30247.1| 50S ribosomal protein L28 [Bacillus cereus 03BB102]
 gi|228585448|gb|EEK43552.1| 50S ribosomal protein L28 [Bacillus cereus m1293]
 gi|228591578|gb|EEK49427.1| 50S ribosomal protein L28 [Bacillus cereus ATCC 10876]
 gi|228597274|gb|EEK54925.1| 50S ribosomal protein L28 [Bacillus cereus BGSC 6E1]
 gi|228603343|gb|EEK60820.1| 50S ribosomal protein L28 [Bacillus cereus 172560W]
 gi|228609084|gb|EEK66374.1| 50S ribosomal protein L28 [Bacillus cereus MM3]
 gi|228615004|gb|EEK72106.1| 50S ribosomal protein L28 [Bacillus cereus AH621]
 gi|228620676|gb|EEK77545.1| 50S ribosomal protein L28 [Bacillus cereus R309803]
 gi|228626161|gb|EEK82910.1| 50S ribosomal protein L28 [Bacillus cereus ATCC 4342]
 gi|228631406|gb|EEK88040.1| 50S ribosomal protein L28 [Bacillus cereus m1550]
 gi|228637062|gb|EEK93521.1| 50S ribosomal protein L28 [Bacillus cereus BDRD-ST24]
 gi|228643065|gb|EEK99341.1| 50S ribosomal protein L28 [Bacillus cereus BDRD-ST26]
 gi|228648712|gb|EEL04738.1| 50S ribosomal protein L28 [Bacillus cereus BDRD-ST196]
 gi|228654371|gb|EEL10236.1| 50S ribosomal protein L28 [Bacillus cereus BDRD-Cer4]
 gi|228660148|gb|EEL15784.1| 50S ribosomal protein L28 [Bacillus cereus 95/8201]
 gi|228666244|gb|EEL21708.1| 50S ribosomal protein L28 [Bacillus cereus Rock1-3]
 gi|228672105|gb|EEL27396.1| 50S ribosomal protein L28 [Bacillus cereus Rock1-15]
 gi|228679118|gb|EEL33326.1| 50S ribosomal protein L28 [Bacillus cereus Rock3-28]
 gi|228685225|gb|EEL39156.1| 50S ribosomal protein L28 [Bacillus cereus Rock3-29]
 gi|228690523|gb|EEL44306.1| 50S ribosomal protein L28 [Bacillus cereus Rock3-42]
 gi|228696927|gb|EEL49736.1| 50S ribosomal protein L28 [Bacillus cereus Rock3-44]
 gi|228702157|gb|EEL54633.1| 50S ribosomal protein L28 [Bacillus cereus Rock4-2]
 gi|228711810|gb|EEL63762.1| 50S ribosomal protein L28 [Bacillus cereus F65185]
 gi|228717884|gb|EEL69532.1| 50S ribosomal protein L28 [Bacillus cereus AH603]
 gi|228723792|gb|EEL75147.1| 50S ribosomal protein L28 [Bacillus cereus AH676]
 gi|228729777|gb|EEL80757.1| 50S ribosomal protein L28 [Bacillus cereus AH1271]
 gi|228735991|gb|EEL86567.1| 50S ribosomal protein L28 [Bacillus cereus AH1272]
 gi|228742242|gb|EEL92403.1| 50S ribosomal protein L28 [Bacillus cereus AH1273]
 gi|228748296|gb|EEL98156.1| 50S ribosomal protein L28 [Bacillus mycoides DSM 2048]
 gi|228761102|gb|EEM10061.1| 50S ribosomal protein L28 [Bacillus mycoides Rock3-17]
 gi|228767220|gb|EEM15856.1| 50S ribosomal protein L28 [Bacillus pseudomycoides DSM 12442]
 gi|228772779|gb|EEM21219.1| 50S ribosomal protein L28 [Bacillus thuringiensis serovar
          tochigiensis BGSC 4Y1]
 gi|228779285|gb|EEM27542.1| 50S ribosomal protein L28 [Bacillus thuringiensis Bt407]
 gi|228785900|gb|EEM33903.1| 50S ribosomal protein L28 [Bacillus thuringiensis serovar
          thuringiensis str. T01001]
 gi|228792906|gb|EEM40464.1| 50S ribosomal protein L28 [Bacillus thuringiensis serovar sotto
          str. T04001]
 gi|228799590|gb|EEM46543.1| 50S ribosomal protein L28 [Bacillus thuringiensis serovar
          pakistani str. T13001]
 gi|228805455|gb|EEM52046.1| 50S ribosomal protein L28 [Bacillus thuringiensis serovar
          kurstaki str. T03a001]
 gi|228812097|gb|EEM58428.1| 50S ribosomal protein L28 [Bacillus thuringiensis serovar
          monterrey BGSC 4AJ1]
 gi|228818782|gb|EEM64848.1| 50S ribosomal protein L28 [Bacillus thuringiensis serovar
          berliner ATCC 10792]
 gi|228824537|gb|EEM70342.1| 50S ribosomal protein L28 [Bacillus thuringiensis serovar
          andalousiensis BGSC 4AW1]
 gi|228830713|gb|EEM76318.1| 50S ribosomal protein L28 [Bacillus thuringiensis serovar
          pondicheriensis BGSC 4BA1]
 gi|228837041|gb|EEM82382.1| 50S ribosomal protein L28 [Bacillus thuringiensis serovar
          huazhongensis BGSC 4BD1]
 gi|228843074|gb|EEM88156.1| 50S ribosomal protein L28 [Bacillus thuringiensis serovar
          pulsiensis BGSC 4CC1]
 gi|228849972|gb|EEM94803.1| 50S ribosomal protein L28 [Bacillus thuringiensis IBL 200]
 gi|228857260|gb|EEN01764.1| 50S ribosomal protein L28 [Bacillus thuringiensis IBL 4222]
 gi|296325405|gb|ADH08333.1| 50S ribosomal protein L28 [Bacillus thuringiensis BMB171]
 gi|300377518|gb|ADK06422.1| 50S ribosomal protein L28 [Bacillus cereus biovar anthracis str.
          CI]
 gi|324327755|gb|ADY23015.1| 50S ribosomal protein L28 [Bacillus thuringiensis serovar
          finitimus YBT-020]
 gi|326941627|gb|AEA17523.1| 50S ribosomal protein L28 [Bacillus thuringiensis serovar
          chinensis CT-43]
          Length = 62

 Score = 37.7 bits (86), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 38/63 (60%), Gaps = 4/63 (6%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS-- 58
          M+RVC +T +   SGN  SHA N T+R++  NL ++ +  D   Q+  + +S  AL+S  
Sbjct: 1  MARVCAITGRKARSGNSRSHAMNATKRKWGANLQKVRVRIDGKVQR--VYVSARALKSGK 58

Query: 59 VER 61
          +ER
Sbjct: 59 IER 61


>gi|284047836|ref|YP_003398175.1| ribosomal protein L28 [Acidaminococcus fermentans DSM 20731]
 gi|283952057|gb|ADB46860.1| ribosomal protein L28 [Acidaminococcus fermentans DSM 20731]
          Length = 63

 Score = 37.7 bits (86), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 26/41 (63%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISD 41
          M+ +CE+  K  +SGN VSH+N   +R + PN+ ++  + D
Sbjct: 1  MACICEICNKGELSGNNVSHSNRHVKRSWKPNVQKVKAVVD 41


>gi|257791103|ref|YP_003181709.1| 50S ribosomal protein L28 [Eggerthella lenta DSM 2243]
 gi|317488173|ref|ZP_07946745.1| ribosomal protein L28 [Eggerthella sp. 1_3_56FAA]
 gi|325830797|ref|ZP_08164181.1| ribosomal protein L28 [Eggerthella sp. HGA1]
 gi|257475000|gb|ACV55320.1| ribosomal protein L28 [Eggerthella lenta DSM 2243]
 gi|316912718|gb|EFV34255.1| ribosomal protein L28 [Eggerthella sp. 1_3_56FAA]
 gi|325487204|gb|EGC89647.1| ribosomal protein L28 [Eggerthella sp. HGA1]
          Length = 63

 Score = 37.7 bits (86), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 25/38 (65%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITL 38
          MS++CE+  K   +G  VSH++  T R F PN+ R+T+
Sbjct: 1  MSKICEVCGKAPSAGRNVSHSHRVTNRWFRPNIQRVTI 38


>gi|134102560|ref|YP_001108221.1| 50S ribosomal protein L28 [Saccharopolyspora erythraea NRRL 2338]
 gi|291007069|ref|ZP_06565042.1| 50S ribosomal protein L28 [Saccharopolyspora erythraea NRRL 2338]
 gi|133915183|emb|CAM05296.1| 50S ribosomal protein L28 [Saccharopolyspora erythraea NRRL 2338]
          Length = 63

 Score = 37.7 bits (86), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 23/33 (69%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNL 33
          M+ VC++  K    GN VSH++ KTRRR+ PN+
Sbjct: 1  MAAVCDVCSKGPGFGNSVSHSHRKTRRRWNPNI 33


>gi|323705494|ref|ZP_08117069.1| ribosomal protein L28 [Thermoanaerobacterium xylanolyticum LX-11]
 gi|323535396|gb|EGB25172.1| ribosomal protein L28 [Thermoanaerobacterium xylanolyticum LX-11]
          Length = 63

 Score = 37.7 bits (86), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 27/41 (65%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISD 41
          M R CE+  KT M+G + SH++ K+ +++ PNL R+  I D
Sbjct: 1  MMRKCEVCGKTPMAGYQYSHSHRKSIKKWQPNLKRVKAIVD 41


>gi|182434338|ref|YP_001822057.1| putative 50S ribosomal protein L28 [Streptomyces griseus subsp.
          griseus NBRC 13350]
 gi|178462854|dbj|BAG17374.1| putative 50S ribosomal protein L28 [Streptomyces griseus subsp.
          griseus NBRC 13350]
          Length = 78

 Score = 37.7 bits (86), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 34/63 (53%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS  C+LT      GN +SH++ +T RRF PN+ R         +  +L +S  A+R+V+
Sbjct: 1  MSAHCQLTGSKPGFGNNISHSHRRTSRRFDPNVQRKRYWLPGEGRSVRLTLSARAIRTVD 60

Query: 61 RQG 63
            G
Sbjct: 61 SIG 63


>gi|282862693|ref|ZP_06271754.1| ribosomal protein L28 [Streptomyces sp. ACTE]
 gi|282562379|gb|EFB67920.1| ribosomal protein L28 [Streptomyces sp. ACTE]
          Length = 78

 Score = 37.7 bits (86), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 34/63 (53%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS  C+LT      GN +SH++ +T RRF PN+ R         +  +L +S  A+R+++
Sbjct: 1  MSAHCQLTGAQPGFGNHISHSHRRTSRRFDPNIQRKRYWLPSEGRHVRLTLSARAIRTID 60

Query: 61 RQG 63
            G
Sbjct: 61 TIG 63


>gi|225873415|ref|YP_002754874.1| ribosomal protein L28 [Acidobacterium capsulatum ATCC 51196]
 gi|254801492|sp|C1F7R8|RL28_ACIC5 RecName: Full=50S ribosomal protein L28
 gi|225792205|gb|ACO32295.1| ribosomal protein L28 [Acidobacterium capsulatum ATCC 51196]
          Length = 63

 Score = 37.7 bits (86), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 23/33 (69%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNL 33
          M++VCE+  K    GN +SHA+N TRRR+  NL
Sbjct: 1  MAQVCEICGKGPQFGNNISHAHNVTRRRWNVNL 33


>gi|295111735|emb|CBL28485.1| LSU ribosomal protein L28P [Synergistetes bacterium SGP1]
          Length = 73

 Score = 37.7 bits (86), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 22/33 (66%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNL 33
          M++ C+   +   SGN VSH+N  TRRR+L NL
Sbjct: 3  MAKFCQCCGRGPASGNAVSHSNRHTRRRWLVNL 35


>gi|19704769|ref|NP_604331.1| 50S ribosomal protein L28P [Fusobacterium nucleatum subsp.
          nucleatum ATCC 25586]
 gi|254303981|ref|ZP_04971339.1| ribosomal protein L28 [Fusobacterium nucleatum subsp. polymorphum
          ATCC 10953]
 gi|296327748|ref|ZP_06870287.1| 50S ribosomal protein L28 [Fusobacterium nucleatum subsp.
          nucleatum ATCC 23726]
 gi|22096047|sp|Q8RDR9|RL28_FUSNN RecName: Full=50S ribosomal protein L28
 gi|19715099|gb|AAL95630.1| LSU ribosomal protein L28P [Fusobacterium nucleatum subsp.
          nucleatum ATCC 25586]
 gi|148324173|gb|EDK89423.1| ribosomal protein L28 [Fusobacterium nucleatum subsp. polymorphum
          ATCC 10953]
 gi|296155095|gb|EFG95873.1| 50S ribosomal protein L28 [Fusobacterium nucleatum subsp.
          nucleatum ATCC 23726]
          Length = 85

 Score = 37.7 bits (86), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 26/37 (70%)

Query: 5  CELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISD 41
          CE+T   ++SGN++SH++  TRR + PNL   TL+ +
Sbjct: 4  CEITGTGLISGNQISHSHRLTRRVWKPNLQVTTLVVN 40


>gi|282878495|ref|ZP_06287278.1| ribosomal protein L28 [Prevotella buccalis ATCC 35310]
 gi|281299383|gb|EFA91769.1| ribosomal protein L28 [Prevotella buccalis ATCC 35310]
          Length = 87

 Score = 37.7 bits (86), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 35/69 (50%), Gaps = 1/69 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS++C++T K    GN VSH+ ++T+R F  NL               L+IS   LR + 
Sbjct: 1  MSKICQITGKKAQIGNNVSHSKHRTKRSFDVNLFSKKFYYVEEGCWISLKISAAGLRLIN 60

Query: 61 RQGGLDRFL 69
          +  GLD  L
Sbjct: 61 KV-GLDAAL 68


>gi|294784947|ref|ZP_06750235.1| 50S ribosomal protein L28 [Fusobacterium sp. 3_1_27]
 gi|294486661|gb|EFG34023.1| 50S ribosomal protein L28 [Fusobacterium sp. 3_1_27]
          Length = 85

 Score = 37.7 bits (86), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 26/37 (70%)

Query: 5  CELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISD 41
          CE+T   ++SGN++SH++  TRR + PNL   TL+ +
Sbjct: 4  CEITGTGLISGNQISHSHRLTRRVWKPNLQVTTLVVN 40


>gi|302546717|ref|ZP_07299059.1| ribosomal protein L28 [Streptomyces hygroscopicus ATCC 53653]
 gi|302464335|gb|EFL27428.1| ribosomal protein L28 [Streptomyces himastatinicus ATCC 53653]
          Length = 78

 Score = 37.7 bits (86), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 16/35 (45%), Positives = 24/35 (68%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCR 35
          MS  C+LT +    G K+SH++ +T+RRF PN+ R
Sbjct: 1  MSAHCQLTGRQPGFGQKISHSHRRTKRRFDPNIQR 35


>gi|237785096|ref|YP_002905801.1| 50S ribosomal protein L28 [Corynebacterium kroppenstedtii DSM
          44385]
 gi|259646731|sp|C4LHF3|RL28_CORK4 RecName: Full=50S ribosomal protein L28
 gi|237758008|gb|ACR17258.1| 50S ribosomal protein L28 [Corynebacterium kroppenstedtii DSM
          44385]
          Length = 78

 Score = 37.7 bits (86), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 34/63 (53%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS  C++T +    G  VSH++ +T RR+ PN+ R +       +   L +S   L++++
Sbjct: 1  MSAYCQVTGRKPSFGKSVSHSHRRTNRRWNPNIQRRSFYLPSEGRTITLNVSTKGLKTID 60

Query: 61 RQG 63
          R G
Sbjct: 61 RYG 63


>gi|282880709|ref|ZP_06289411.1| ribosomal protein L28 [Prevotella timonensis CRIS 5C-B1]
 gi|281305435|gb|EFA97493.1| ribosomal protein L28 [Prevotella timonensis CRIS 5C-B1]
          Length = 87

 Score = 37.7 bits (86), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 35/69 (50%), Gaps = 1/69 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS++C++T K    GN VSH+ ++T+R F  NL               L+IS   LR + 
Sbjct: 1  MSKICQITGKKAQIGNNVSHSKHRTKRSFDVNLFSKKFYYVEEGCWISLKISAAGLRLIN 60

Query: 61 RQGGLDRFL 69
          +  GLD  L
Sbjct: 61 KV-GLDAAL 68


>gi|332297429|ref|YP_004439351.1| 50S ribosomal protein L28 [Treponema brennaborense DSM 12168]
 gi|332180532|gb|AEE16220.1| 50S ribosomal protein L28 [Treponema brennaborense DSM 12168]
          Length = 63

 Score = 37.7 bits (86), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 23/33 (69%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNL 33
          MSR C++  K  +SGNKVS + N TRR + PN+
Sbjct: 1  MSRRCDICGKGSLSGNKVSKSYNHTRRTWKPNI 33


>gi|311029983|ref|ZP_07708073.1| 50S ribosomal protein L28 [Bacillus sp. m3-13]
          Length = 62

 Score = 37.7 bits (86), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 25/63 (39%), Positives = 37/63 (58%), Gaps = 4/63 (6%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS-- 58
          M+R C +T K   SGN  SHA N TRR +  NL ++ ++ D   +  ++ +S  AL+S  
Sbjct: 1  MARKCVITGKKTGSGNARSHAMNSTRRTWGANLQKVRILVD--GKPKRVYVSARALKSGK 58

Query: 59 VER 61
          VER
Sbjct: 59 VER 61


>gi|313885147|ref|ZP_07818899.1| ribosomal protein L28 [Eremococcus coleocola ACS-139-V-Col8]
 gi|312619838|gb|EFR31275.1| ribosomal protein L28 [Eremococcus coleocola ACS-139-V-Col8]
          Length = 62

 Score = 37.7 bits (86), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 37/63 (58%), Gaps = 4/63 (6%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS-- 58
          M++ C  T +   SGN  SHA N ++RRF  NL ++ ++ D   Q  ++ +S  AL+S  
Sbjct: 1  MAKECYYTGRKAKSGNTRSHALNASKRRFGANLQKVRIMVD--GQPKKVWVSARALKSGL 58

Query: 59 VER 61
          VER
Sbjct: 59 VER 61


>gi|54026949|ref|YP_121191.1| 50S ribosomal protein L28 [Nocardia farcinica IFM 10152]
 gi|67461561|sp|Q5YPR4|RL282_NOCFA RecName: Full=50S ribosomal protein L28 2
 gi|54018457|dbj|BAD59827.1| putative ribosomal protein L28 [Nocardia farcinica IFM 10152]
          Length = 78

 Score = 37.7 bits (86), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 35/63 (55%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS  C++T +    G  VSH++ +T RR+ PN+ R T       ++  L +S   +++++
Sbjct: 1  MSAHCQVTGRKPGFGKSVSHSHVRTNRRWDPNIQRKTYYLPSEGRRITLTVSAKGIKTID 60

Query: 61 RQG 63
          R G
Sbjct: 61 RDG 63


>gi|260584628|ref|ZP_05852374.1| 50S ribosomal protein L28 [Granulicatella elegans ATCC 700633]
 gi|260157651|gb|EEW92721.1| 50S ribosomal protein L28 [Granulicatella elegans ATCC 700633]
          Length = 62

 Score = 37.7 bits (86), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 37/63 (58%), Gaps = 4/63 (6%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS-- 58
          M++VC  T +   +GN  SHA N  RR + PNL ++ ++ D   +K  + +S  AL+S  
Sbjct: 1  MAKVCYFTGRRSETGNTRSHAMNANRRTWKPNLQKVRVLIDGKPKK--VWVSTRALKSGK 58

Query: 59 VER 61
          VER
Sbjct: 59 VER 61


>gi|206900831|ref|YP_002251217.1| ribosomal protein L28 [Dictyoglomus thermophilum H-6-12]
 gi|217967890|ref|YP_002353396.1| ribosomal protein L28 [Dictyoglomus turgidum DSM 6724]
 gi|226732827|sp|B5YFA9|RL28_DICT6 RecName: Full=50S ribosomal protein L28
 gi|226732828|sp|B8E2D8|RL28_DICTD RecName: Full=50S ribosomal protein L28
 gi|206739934|gb|ACI18992.1| ribosomal protein L28 [Dictyoglomus thermophilum H-6-12]
 gi|217336989|gb|ACK42782.1| ribosomal protein L28 [Dictyoglomus turgidum DSM 6724]
          Length = 63

 Score = 37.7 bits (86), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 24/33 (72%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNL 33
          MSR CE+  K   +G +VSH++ +T+ R+LPNL
Sbjct: 1  MSRRCEICGKGPWTGLQVSHSHRRTKTRWLPNL 33


>gi|190346312|gb|EDK38365.2| hypothetical protein PGUG_02463 [Meyerozyma guilliermondii ATCC
           6260]
          Length = 255

 Score = 37.7 bits (86), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 27/80 (33%), Positives = 45/80 (56%), Gaps = 11/80 (13%)

Query: 19  SHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFLSNSKKENLS 78
           S A NK  R  LPN+ +  L S+ + +  Q +++   LR+V ++GGLD +L+  K     
Sbjct: 96  SEAGNKNLRAHLPNIVKAKLWSETLNKSIQTKVTTTVLRTVTKEGGLDNYLTKDK----P 151

Query: 79  ARMRT-------LRSQILKK 91
           AR++T       LR +++KK
Sbjct: 152 ARVKTLGLKGWKLRYEVMKK 171


>gi|237742534|ref|ZP_04573015.1| LSU ribosomal protein L28P [Fusobacterium sp. 4_1_13]
 gi|256845871|ref|ZP_05551329.1| ribosomal protein L28 [Fusobacterium sp. 3_1_36A2]
 gi|229430182|gb|EEO40394.1| LSU ribosomal protein L28P [Fusobacterium sp. 4_1_13]
 gi|256719430|gb|EEU32985.1| ribosomal protein L28 [Fusobacterium sp. 3_1_36A2]
          Length = 85

 Score = 37.7 bits (86), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 26/37 (70%)

Query: 5  CELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISD 41
          CE+T   ++SGN++SH++  TRR + PNL   TL+ +
Sbjct: 4  CEITGTGLISGNQISHSHRLTRRVWKPNLQVTTLVVN 40


>gi|146417531|ref|XP_001484734.1| hypothetical protein PGUG_02463 [Meyerozyma guilliermondii ATCC
           6260]
          Length = 255

 Score = 37.7 bits (86), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 27/80 (33%), Positives = 45/80 (56%), Gaps = 11/80 (13%)

Query: 19  SHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFLSNSKKENLS 78
           S A NK  R  LPN+ +  L S+ + +  Q +++   LR+V ++GGLD +L+  K     
Sbjct: 96  SEAGNKNLRAHLPNIVKAKLWSETLNKSIQTKVTTTVLRTVTKEGGLDNYLTKDK----P 151

Query: 79  ARMRT-------LRSQILKK 91
           AR++T       LR +++KK
Sbjct: 152 ARVKTLGLKGWKLRYEVMKK 171


>gi|313793640|gb|EFS41671.1| ribosomal protein L28 [Propionibacterium acnes HL110PA1]
 gi|327455973|gb|EGF02628.1| ribosomal protein L28 [Propionibacterium acnes HL092PA1]
          Length = 78

 Score = 37.7 bits (86), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 35/63 (55%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR C++       GN VSH+   T+RR+ PN+ +       + +K  L ++  A++ ++
Sbjct: 1  MSRRCQVRGTKPEFGNNVSHSQRHTKRRWNPNIQKKRYWVPSLGRKVTLTLTPQAIKEID 60

Query: 61 RQG 63
          R+G
Sbjct: 61 RRG 63


>gi|312880184|ref|ZP_07739984.1| LSU ribosomal protein L28P [Aminomonas paucivorans DSM 12260]
 gi|310783475|gb|EFQ23873.1| LSU ribosomal protein L28P [Aminomonas paucivorans DSM 12260]
          Length = 64

 Score = 37.7 bits (86), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 22/33 (66%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNL 33
          MSRVC+   +   +GN VSH+   TRRR+L NL
Sbjct: 1  MSRVCDCCGRGPQTGNSVSHSVRHTRRRWLINL 33


>gi|238882178|gb|EEQ45816.1| conserved hypothetical protein [Candida albicans WO-1]
          Length = 265

 Score = 37.7 bits (86), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 21/76 (27%), Positives = 45/76 (59%), Gaps = 3/76 (3%)

Query: 23  NKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFL---SNSKKENLSA 79
           NKT R   PN     L S+ + ++ +LR++   L+++ ++GGLD++L   + ++ + +  
Sbjct: 108 NKTLRAHRPNAQWTKLWSETLNRRLRLRVATRVLKTISKEGGLDQYLLKSTPARVKTMGL 167

Query: 80  RMRTLRSQILKKMSEK 95
           +   LR +IL++  +K
Sbjct: 168 KAWQLRYRILQEREQK 183


>gi|68469645|ref|XP_721074.1| likely mitochondrial ribosomal protein (E. coli L28) [Candida
           albicans SC5314]
 gi|68469884|ref|XP_720952.1| likely mitochondrial ribosomal protein (E. coli L28) [Candida
           albicans SC5314]
 gi|46442846|gb|EAL02132.1| likely mitochondrial ribosomal protein (E. coli L28) [Candida
           albicans SC5314]
 gi|46442975|gb|EAL02260.1| likely mitochondrial ribosomal protein (E. coli L28) [Candida
           albicans SC5314]
          Length = 265

 Score = 37.7 bits (86), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 21/76 (27%), Positives = 45/76 (59%), Gaps = 3/76 (3%)

Query: 23  NKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFL---SNSKKENLSA 79
           NKT R   PN     L S+ + ++ +LR++   L+++ ++GGLD++L   + ++ + +  
Sbjct: 108 NKTLRAHRPNAQWTKLWSETLNRRLRLRVATRVLKTISKEGGLDQYLLKSTPARVKTMGL 167

Query: 80  RMRTLRSQILKKMSEK 95
           +   LR +IL++  +K
Sbjct: 168 KAWQLRYRILQEREQK 183


>gi|259047428|ref|ZP_05737829.1| conserved domain protein [Granulicatella adiacens ATCC 49175]
 gi|259035619|gb|EEW36874.1| conserved domain protein [Granulicatella adiacens ATCC 49175]
          Length = 64

 Score = 37.7 bits (86), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 37/63 (58%), Gaps = 4/63 (6%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS-- 58
          M++VC  T +   +GN  SHA N  RR + PNL ++ ++ D   +K  + +S  AL+S  
Sbjct: 3  MAKVCYFTGRRSETGNTRSHAMNANRRTWKPNLQKVRVLIDGKPKK--VWVSTRALKSGK 60

Query: 59 VER 61
          VER
Sbjct: 61 VER 63


>gi|172057926|ref|YP_001814386.1| 50S ribosomal protein L28 [Exiguobacterium sibiricum 255-15]
 gi|226694798|sp|B1YIP3|RL28_EXIS2 RecName: Full=50S ribosomal protein L28
 gi|171990447|gb|ACB61369.1| ribosomal protein L28 [Exiguobacterium sibiricum 255-15]
          Length = 62

 Score = 37.7 bits (86), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 25/63 (39%), Positives = 39/63 (61%), Gaps = 4/63 (6%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS-- 58
          M+R C +T K+  SGN  SHA NKT+R +  N+ ++ ++ D   +K  + +S  AL+S  
Sbjct: 1  MARKCYVTGKSPKSGNNRSHALNKTKRTWGINVQKVRILVDGKPKK--VWVSARALKSGK 58

Query: 59 VER 61
          VER
Sbjct: 59 VER 61


>gi|229822825|ref|ZP_04448895.1| hypothetical protein GCWU000282_00114 [Catonella morbi ATCC
          51271]
 gi|229787638|gb|EEP23752.1| hypothetical protein GCWU000282_00114 [Catonella morbi ATCC
          51271]
          Length = 62

 Score = 37.7 bits (86), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 25/63 (39%), Positives = 37/63 (58%), Gaps = 4/63 (6%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS-- 58
          M++ C  T +   SGN  S A NKT+RRF  NL ++ ++ D   +K  + +S  AL+S  
Sbjct: 1  MAKECYFTGRKARSGNTRSKAMNKTKRRFGANLQKVRILVDGEPKK--VWVSARALKSGK 58

Query: 59 VER 61
          VER
Sbjct: 59 VER 61


>gi|303233252|ref|ZP_07319924.1| ribosomal protein L28 [Atopobium vaginae PB189-T1-4]
 gi|302480642|gb|EFL43730.1| ribosomal protein L28 [Atopobium vaginae PB189-T1-4]
          Length = 66

 Score = 37.7 bits (86), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 25/39 (64%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLI 39
          MS+VC+   K  ++G  +SH++    R+F PN+ R+T+ 
Sbjct: 1  MSKVCDFCGKHAVAGRSISHSHRTVTRKFKPNIQRVTVF 39


>gi|289422328|ref|ZP_06424178.1| ribosomal protein L28 [Peptostreptococcus anaerobius 653-L]
 gi|289157273|gb|EFD05888.1| ribosomal protein L28 [Peptostreptococcus anaerobius 653-L]
          Length = 62

 Score = 37.7 bits (86), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 37/65 (56%), Gaps = 8/65 (12%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKC--ALRS 58
          MS+VC +  K  +SGN+VSH+N   +R +  NL  + ++ D   +    R+S C   LRS
Sbjct: 1  MSKVCSVCGKGKVSGNQVSHSNKHNKRSWSANLRNVKIVEDGTPK----RVSVCTRCLRS 56

Query: 59 --VER 61
            VER
Sbjct: 57 GKVER 61


>gi|50843596|ref|YP_056823.1| 50S ribosomal protein L28 [Propionibacterium acnes KPA171202]
 gi|282854930|ref|ZP_06264264.1| ribosomal protein L28 [Propionibacterium acnes J139]
 gi|289426052|ref|ZP_06427799.1| ribosomal protein L28 [Propionibacterium acnes SK187]
 gi|295131679|ref|YP_003582342.1| ribosomal protein L28 [Propionibacterium acnes SK137]
 gi|67461385|sp|Q6A5U8|RL28_PROAC RecName: Full=50S ribosomal protein L28
 gi|50841198|gb|AAT83865.1| 50S ribosomal protein L28 [Propionibacterium acnes KPA171202]
 gi|282582076|gb|EFB87459.1| ribosomal protein L28 [Propionibacterium acnes J139]
 gi|289153595|gb|EFD02309.1| ribosomal protein L28 [Propionibacterium acnes SK187]
 gi|291376781|gb|ADE00636.1| ribosomal protein L28 [Propionibacterium acnes SK137]
 gi|313765615|gb|EFS36979.1| ribosomal protein L28 [Propionibacterium acnes HL013PA1]
 gi|313771824|gb|EFS37790.1| ribosomal protein L28 [Propionibacterium acnes HL074PA1]
 gi|313802950|gb|EFS44161.1| ribosomal protein L28 [Propionibacterium acnes HL110PA2]
 gi|313810684|gb|EFS48398.1| ribosomal protein L28 [Propionibacterium acnes HL083PA1]
 gi|313813722|gb|EFS51436.1| ribosomal protein L28 [Propionibacterium acnes HL025PA1]
 gi|313816596|gb|EFS54310.1| ribosomal protein L28 [Propionibacterium acnes HL059PA1]
 gi|313829673|gb|EFS67387.1| ribosomal protein L28 [Propionibacterium acnes HL063PA2]
 gi|313831494|gb|EFS69208.1| ribosomal protein L28 [Propionibacterium acnes HL007PA1]
 gi|313833456|gb|EFS71170.1| ribosomal protein L28 [Propionibacterium acnes HL056PA1]
 gi|313839416|gb|EFS77130.1| ribosomal protein L28 [Propionibacterium acnes HL086PA1]
 gi|314916637|gb|EFS80468.1| ribosomal protein L28 [Propionibacterium acnes HL005PA4]
 gi|314918904|gb|EFS82735.1| ribosomal protein L28 [Propionibacterium acnes HL050PA1]
 gi|314920915|gb|EFS84746.1| ribosomal protein L28 [Propionibacterium acnes HL050PA3]
 gi|314924411|gb|EFS88242.1| ribosomal protein L28 [Propionibacterium acnes HL001PA1]
 gi|314931407|gb|EFS95238.1| ribosomal protein L28 [Propionibacterium acnes HL067PA1]
 gi|314956634|gb|EFT00886.1| ribosomal protein L28 [Propionibacterium acnes HL027PA1]
 gi|314959514|gb|EFT03616.1| ribosomal protein L28 [Propionibacterium acnes HL002PA1]
 gi|314964710|gb|EFT08810.1| ribosomal protein L28 [Propionibacterium acnes HL082PA1]
 gi|314968886|gb|EFT12984.1| ribosomal protein L28 [Propionibacterium acnes HL037PA1]
 gi|314974811|gb|EFT18906.1| ribosomal protein L28 [Propionibacterium acnes HL053PA1]
 gi|314977862|gb|EFT21956.1| ribosomal protein L28 [Propionibacterium acnes HL045PA1]
 gi|314981661|gb|EFT25754.1| ribosomal protein L28 [Propionibacterium acnes HL110PA3]
 gi|314984728|gb|EFT28820.1| ribosomal protein L28 [Propionibacterium acnes HL005PA1]
 gi|315079353|gb|EFT51354.1| ribosomal protein L28 [Propionibacterium acnes HL053PA2]
 gi|315082404|gb|EFT54380.1| ribosomal protein L28 [Propionibacterium acnes HL078PA1]
 gi|315092300|gb|EFT64276.1| ribosomal protein L28 [Propionibacterium acnes HL110PA4]
 gi|315095631|gb|EFT67607.1| ribosomal protein L28 [Propionibacterium acnes HL038PA1]
 gi|315100282|gb|EFT72258.1| ribosomal protein L28 [Propionibacterium acnes HL059PA2]
 gi|315102421|gb|EFT74397.1| ribosomal protein L28 [Propionibacterium acnes HL046PA1]
 gi|315104670|gb|EFT76646.1| ribosomal protein L28 [Propionibacterium acnes HL050PA2]
 gi|315107723|gb|EFT79699.1| ribosomal protein L28 [Propionibacterium acnes HL030PA1]
 gi|327332918|gb|EGE74650.1| ribosomal protein L28 [Propionibacterium acnes HL096PA2]
 gi|327335323|gb|EGE77033.1| ribosomal protein L28 [Propionibacterium acnes HL097PA1]
 gi|327448621|gb|EGE95275.1| ribosomal protein L28 [Propionibacterium acnes HL043PA1]
 gi|327451152|gb|EGE97806.1| ribosomal protein L28 [Propionibacterium acnes HL043PA2]
 gi|327455738|gb|EGF02393.1| ribosomal protein L28 [Propionibacterium acnes HL087PA3]
 gi|327458087|gb|EGF04742.1| ribosomal protein L28 [Propionibacterium acnes HL083PA2]
 gi|328757247|gb|EGF70863.1| ribosomal protein L28 [Propionibacterium acnes HL087PA1]
 gi|328757633|gb|EGF71249.1| ribosomal protein L28 [Propionibacterium acnes HL025PA2]
 gi|328761968|gb|EGF75475.1| ribosomal protein L28 [Propionibacterium acnes HL099PA1]
          Length = 78

 Score = 37.4 bits (85), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 35/63 (55%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR C++       GN VSH+   T+RR+ PN+ +       + +K  L ++  A++ ++
Sbjct: 1  MSRRCQVRGTKPEFGNNVSHSQRHTKRRWNPNIQKKRYWVPSLGRKVTLTLTPKAIKEID 60

Query: 61 RQG 63
          R+G
Sbjct: 61 RRG 63


>gi|30263861|ref|NP_846238.1| 50S ribosomal protein L28 [Bacillus anthracis str. Ames]
 gi|47529287|ref|YP_020636.1| 50S ribosomal protein L28 [Bacillus anthracis str. 'Ames
          Ancestor']
 gi|49186708|ref|YP_029960.1| 50S ribosomal protein L28 [Bacillus anthracis str. Sterne]
 gi|190565852|ref|ZP_03018771.1| ribosomal protein L28 [Bacillus anthracis Tsiankovskii-I]
 gi|227813234|ref|YP_002813243.1| 50S ribosomal protein L28 [Bacillus anthracis str. CDC 684]
 gi|229604351|ref|YP_002868095.1| 50S ribosomal protein L28 [Bacillus anthracis str. A0248]
 gi|254683434|ref|ZP_05147294.1| 50S ribosomal protein L28 [Bacillus anthracis str. CNEVA-9066]
 gi|254735896|ref|ZP_05193602.1| 50S ribosomal protein L28 [Bacillus anthracis str. Western North
          America USA6153]
 gi|254739856|ref|ZP_05197549.1| 50S ribosomal protein L28 [Bacillus anthracis str. Kruger B]
 gi|254751046|ref|ZP_05203085.1| 50S ribosomal protein L28 [Bacillus anthracis str. Vollum]
 gi|254756711|ref|ZP_05208740.1| 50S ribosomal protein L28 [Bacillus anthracis str. Australia 94]
 gi|67461511|sp|Q81WI0|RL28_BACAN RecName: Full=50S ribosomal protein L28
 gi|254801498|sp|C3P629|RL28_BACAA RecName: Full=50S ribosomal protein L28
 gi|254801499|sp|C3L769|RL28_BACAC RecName: Full=50S ribosomal protein L28
 gi|30258505|gb|AAP27724.1| 50S ribosomal protein L28 [Bacillus anthracis str. Ames]
 gi|47504435|gb|AAT33111.1| ribosomal protein L28 [Bacillus anthracis str. 'Ames Ancestor']
 gi|49180635|gb|AAT56011.1| ribosomal protein L28 [Bacillus anthracis str. Sterne]
 gi|190562771|gb|EDV16737.1| ribosomal protein L28 [Bacillus anthracis Tsiankovskii-I]
 gi|227002502|gb|ACP12245.1| 50S ribosomal protein L28 [Bacillus anthracis str. CDC 684]
 gi|229268759|gb|ACQ50396.1| 50S ribosomal protein L28 [Bacillus anthracis str. A0248]
          Length = 62

 Score = 37.4 bits (85), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 38/63 (60%), Gaps = 4/63 (6%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS-- 58
          M+RVC +T +   SGN  SHA N T+R++  NL ++ +  D   Q+  + +S  AL+S  
Sbjct: 1  MARVCTITGRKARSGNSRSHAMNATKRKWGANLQKVRVRIDGKVQR--VYVSARALKSGK 58

Query: 59 VER 61
          +ER
Sbjct: 59 IER 61


>gi|89898359|ref|YP_515469.1| 50S ribosomal protein L28 [Chlamydophila felis Fe/C-56]
 gi|123483283|sp|Q254G4|RL28_CHLFF RecName: Full=50S ribosomal protein L28
 gi|89331731|dbj|BAE81324.1| 50S ribosomal protein L28 [Chlamydophila felis Fe/C-56]
          Length = 89

 Score = 37.4 bits (85), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 42/90 (46%), Gaps = 14/90 (15%)

Query: 1  MSRVCELTKKTVMSGNKVS-------------HANNKTRRRFLPNLCRITLISDIMEQKY 47
          MSR C LT K    GN  +                 KT+RRF PN+    L S    +  
Sbjct: 1  MSRKCPLTGKRPRRGNSYTIRGIAKKKKGIGLKVTGKTKRRFFPNMVTKRLWSTEENKFL 60

Query: 48 QLRISKCALRSVERQGGLDRFLSNSKKENL 77
          +L+IS  ALR +++  GL++ ++ +K +  
Sbjct: 61 KLKISASALRLIDKL-GLEKVIARAKSKGF 89


>gi|170288491|ref|YP_001738729.1| ribosomal protein L28 [Thermotoga sp. RQ2]
 gi|281412311|ref|YP_003346390.1| ribosomal protein L28 [Thermotoga naphthophila RKU-10]
 gi|14195689|sp|Q9WY96|RL28_THEMA RecName: Full=50S ribosomal protein L28
 gi|226699179|sp|B1L9P8|RL28_THESQ RecName: Full=50S ribosomal protein L28
 gi|170175994|gb|ACB09046.1| ribosomal protein L28 [Thermotoga sp. RQ2]
 gi|281373414|gb|ADA66976.1| ribosomal protein L28 [Thermotoga naphthophila RKU-10]
          Length = 70

 Score = 37.4 bits (85), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 26/39 (66%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLI 39
          M++ CE+  K   SGN VSH++ K+ R F PNL ++ ++
Sbjct: 1  MAKRCEVCGKAPRSGNTVSHSDKKSGRWFRPNLQKVRVV 39


>gi|329942807|ref|ZP_08291586.1| ribosomal protein L28 [Chlamydophila psittaci Cal10]
 gi|332287399|ref|YP_004422300.1| 50S ribosomal protein L28 [Chlamydophila psittaci 6BC]
 gi|313847979|emb|CBY16976.1| 50s ribosomal protein l28 [Chlamydophila psittaci RD1]
 gi|325506618|gb|ADZ18256.1| 50S ribosomal protein L28 [Chlamydophila psittaci 6BC]
 gi|328815067|gb|EGF85056.1| ribosomal protein L28 [Chlamydophila psittaci Cal10]
 gi|328914648|gb|AEB55481.1| ribosomal protein L28 [Chlamydophila psittaci 6BC]
          Length = 89

 Score = 37.4 bits (85), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 42/90 (46%), Gaps = 14/90 (15%)

Query: 1  MSRVCELTKKTVMSGNKVS-------------HANNKTRRRFLPNLCRITLISDIMEQKY 47
          MSR C LT K    GN  +                 KT RRF PN+    L S    +  
Sbjct: 1  MSRKCPLTGKRPRRGNSYTIRGIAKKKKGIGLKVTGKTPRRFFPNMVTKRLWSTEENKFL 60

Query: 48 QLRISKCALRSVERQGGLDRFLSNSKKENL 77
          +L+IS  ALR +++  GL++ ++ +K + L
Sbjct: 61 KLKISASALRLIDKL-GLEKVIARAKSKGL 89


>gi|258511311|ref|YP_003184745.1| 50S ribosomal protein L28 [Alicyclobacillus acidocaldarius subsp.
          acidocaldarius DSM 446]
 gi|257478037|gb|ACV58356.1| ribosomal protein L28 [Alicyclobacillus acidocaldarius subsp.
          acidocaldarius DSM 446]
          Length = 63

 Score = 37.4 bits (85), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 26/41 (63%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISD 41
          M+R CE+  +    GNK+SH++  T+RR+ PNL  +  + D
Sbjct: 1  MARRCEVCGRGPQVGNKISHSHILTKRRWYPNLQSVRAVVD 41


>gi|119953145|ref|YP_945354.1| 50S ribosomal protein L28 [Borrelia turicatae 91E135]
 gi|254801503|sp|A1QZE2|RL28_BORT9 RecName: Full=50S ribosomal protein L28
 gi|119861916|gb|AAX17684.1| LSU ribosomal protein L28P [Borrelia turicatae 91E135]
          Length = 92

 Score = 37.4 bits (85), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 30/88 (34%), Positives = 38/88 (43%), Gaps = 15/88 (17%)

Query: 1  MSRVCELTKKTVMSGNKVS-------------HANNKTRRRFLPNLCRITLISDIMEQKY 47
          M R CE+T K  M GN V              H   KTRR F  NL         + +  
Sbjct: 1  MGRECEITGKKTMFGNNVPRKGLSRKKGGGGQHIGVKTRRTFKVNLINKKFFVPELGKSI 60

Query: 48 QLRISKCALRSVERQGGLDRFL-SNSKK 74
           +++S   LRS+ +  GL  FL  NSKK
Sbjct: 61 NIKVSASTLRSISKL-GLSVFLKKNSKK 87


>gi|50546210|ref|XP_500626.1| YALI0B08074p [Yarrowia lipolytica]
 gi|49646492|emb|CAG82867.1| YALI0B08074p [Yarrowia lipolytica]
          Length = 299

 Score = 37.4 bits (85), Expect = 0.66,   Method: Composition-based stats.
 Identities = 19/61 (31%), Positives = 36/61 (59%)

Query: 10  KTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFL 69
           +T+ +G + S   NKT R++ PN  + TL S+ + +  ++      L ++ R+GGLD +L
Sbjct: 93  RTLGNGYRSSEFRNKTLRKWKPNAQKTTLPSEALGKNVRITTVPRVLSTIRREGGLDAYL 152

Query: 70  S 70
           +
Sbjct: 153 T 153


>gi|210633268|ref|ZP_03297733.1| hypothetical protein COLSTE_01646 [Collinsella stercoris DSM
          13279]
 gi|229815447|ref|ZP_04445779.1| hypothetical protein COLINT_02495 [Collinsella intestinalis DSM
          13280]
 gi|210159186|gb|EEA90157.1| hypothetical protein COLSTE_01646 [Collinsella stercoris DSM
          13279]
 gi|229808980|gb|EEP44750.1| hypothetical protein COLINT_02495 [Collinsella intestinalis DSM
          13280]
          Length = 62

 Score = 37.4 bits (85), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 32/49 (65%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQL 49
          MS+VCE+  K  ++G  +SH++  + R+F PN+ R+ ++ + + +K  +
Sbjct: 1  MSKVCEICGKHPVAGRSISHSHRVSNRKFRPNIQRVYVVVNGVRRKMNV 49


>gi|150020919|ref|YP_001306273.1| 50S ribosomal protein L28 [Thermosipho melanesiensis BI429]
 gi|166228169|sp|A6LLT7|RL28_THEM4 RecName: Full=50S ribosomal protein L28
 gi|149793440|gb|ABR30888.1| ribosomal protein L28 [Thermosipho melanesiensis BI429]
          Length = 70

 Score = 37.4 bits (85), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 25/37 (67%)

Query: 5  CELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISD 41
          C++  K  ++G  VSH+N +T R F PNL ++ +I+D
Sbjct: 4  CQVCGKGPVTGKNVSHSNRRTNRWFKPNLQKVRVITD 40


>gi|183220423|ref|YP_001838419.1| 50S ribosomal protein L28 [Leptospira biflexa serovar Patoc
          strain 'Patoc 1 (Paris)']
 gi|189910536|ref|YP_001962091.1| 50S ribosomal protein L28 [Leptospira biflexa serovar Patoc
          strain 'Patoc 1 (Ames)']
 gi|226732831|sp|B0SEH0|RL28_LEPBA RecName: Full=50S ribosomal protein L28
 gi|226732832|sp|B0SMJ9|RL28_LEPBP RecName: Full=50S ribosomal protein L28
 gi|167775212|gb|ABZ93513.1| 50S Ribosomal protein L28 [Leptospira biflexa serovar Patoc
          strain 'Patoc 1 (Ames)']
 gi|167778845|gb|ABZ97143.1| 50S ribosomal protein L28 [Leptospira biflexa serovar Patoc
          strain 'Patoc 1 (Paris)']
          Length = 96

 Score = 37.4 bits (85), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 37/63 (58%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+R C +T K   +GN VSH++ K RR +  N+    +  +   +  +++IS  ALR++ 
Sbjct: 1  MARTCVVTGKGTTAGNNVSHSHKKNRRIWKVNVITKKIFLEDENRWVRVKISTRALRTLR 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|229495046|ref|ZP_04388792.1| ribosomal protein L28 [Rhodococcus erythropolis SK121]
 gi|229317977|gb|EEN83852.1| ribosomal protein L28 [Rhodococcus erythropolis SK121]
          Length = 78

 Score = 37.4 bits (85), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 36/63 (57%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS  C++T +    G  VSH++ ++ RR+ PN+ R T +     ++  L +S   +++++
Sbjct: 1  MSAHCQVTGRVPGFGKSVSHSHKRSNRRWNPNIQRKTYLLPSEGRRITLTLSTKGIKTID 60

Query: 61 RQG 63
          R G
Sbjct: 61 RDG 63


>gi|111022583|ref|YP_705555.1| 50S ribosomal protein L28 [Rhodococcus jostii RHA1]
 gi|110822113|gb|ABG97397.1| 50S ribosomal protein L28 [Rhodococcus jostii RHA1]
          Length = 78

 Score = 37.4 bits (85), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 35/63 (55%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS  C++T +    G  VSH++ +T RR+ PN+ + T       ++  L +S   +++++
Sbjct: 1  MSAHCQVTGRQPGFGKSVSHSHKRTNRRWDPNIQKKTYFLPSEGRRVTLTLSAKGIKTID 60

Query: 61 RQG 63
          R G
Sbjct: 61 RDG 63


>gi|241951236|ref|XP_002418340.1| ribosomal protein, large subunit, mitochondrial precursor, putative
           [Candida dubliniensis CD36]
 gi|223641679|emb|CAX43640.1| ribosomal protein, large subunit, mitochondrial precursor, putative
           [Candida dubliniensis CD36]
          Length = 270

 Score = 37.4 bits (85), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 38/62 (61%), Gaps = 4/62 (6%)

Query: 23  NKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFLSNSKKENLSARMR 82
           NKT R   PN+    L S+ + ++ +LR++   L+++ ++GGLD++L  S      AR++
Sbjct: 113 NKTLRVHRPNVQWTKLWSETLNKRLRLRVATRVLKTISKEGGLDQYLLKST----PARVK 168

Query: 83  TL 84
           T+
Sbjct: 169 TM 170


>gi|15643026|ref|NP_228069.1| 50S ribosomal protein L28 [Thermotoga maritima MSB8]
 gi|4980752|gb|AAD35344.1|AE001708_12 ribosomal protein L28 [Thermotoga maritima MSB8]
          Length = 72

 Score = 37.4 bits (85), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 26/39 (66%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLI 39
          M++ CE+  K   SGN VSH++ K+ R F PNL ++ ++
Sbjct: 3  MAKRCEVCGKAPRSGNTVSHSDKKSGRWFRPNLQKVRVV 41


>gi|332976655|gb|EGK13496.1| 50S ribosomal protein L28 [Desmospora sp. 8437]
          Length = 62

 Score = 37.4 bits (85), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 29/41 (70%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISD 41
          M+R C +T K   +GN+VSH++ K+RR++  N+ ++ ++ D
Sbjct: 1  MARRCYITGKEGRTGNQVSHSHRKSRRKWGANVQKVRILVD 41


>gi|152976224|ref|YP_001375741.1| 50S ribosomal protein L28 [Bacillus cereus subsp. cytotoxis NVH
          391-98]
 gi|189042424|sp|A7GRI8|RL28_BACCN RecName: Full=50S ribosomal protein L28
 gi|152024976|gb|ABS22746.1| ribosomal protein L28 [Bacillus cytotoxicus NVH 391-98]
          Length = 62

 Score = 37.4 bits (85), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 40/64 (62%), Gaps = 6/64 (9%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITL-ISDIMEQKYQLRISKCALRS- 58
          M+RVC +T +   SGN  SHA N T+R++  NL ++ + I+  +++ Y   +S  AL+S 
Sbjct: 1  MARVCAITGRKARSGNSRSHAMNATKRKWGANLQKVRVRINGKVQRVY---VSARALKSG 57

Query: 59 -VER 61
           +ER
Sbjct: 58 KIER 61


>gi|296125867|ref|YP_003633119.1| ribosomal protein L28 [Brachyspira murdochii DSM 12563]
 gi|296017683|gb|ADG70920.1| ribosomal protein L28 [Brachyspira murdochii DSM 12563]
          Length = 63

 Score = 37.4 bits (85), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 23/33 (69%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNL 33
          M+RVCE+  K   +G+ VSH+N KT+R F  NL
Sbjct: 1  MARVCEICGKGKQNGHSVSHSNIKTKRSFNANL 33


>gi|148274121|ref|YP_001223682.1| 50S ribosomal protein L28 [Clavibacter michiganensis subsp.
          michiganensis NCPPB 382]
 gi|170783360|ref|YP_001711694.1| 50S ribosomal protein L28 [Clavibacter michiganensis subsp.
          sepedonicus]
 gi|166226562|sp|A5CV85|RL28_CLAM3 RecName: Full=50S ribosomal protein L28
 gi|189042428|sp|B0RDL1|RL28_CLAMS RecName: Full=50S ribosomal protein L28
 gi|147832051|emb|CAN03024.1| 50S ribosomal protein L28 [Clavibacter michiganensis subsp.
          michiganensis NCPPB 382]
 gi|169157930|emb|CAQ03140.1| 50S ribosomal protein L28 [Clavibacter michiganensis subsp.
          sepedonicus]
          Length = 78

 Score = 37.4 bits (85), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 16/63 (25%), Positives = 36/63 (57%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+  C++T      G+ +SH++ +T+RRF PN+ + T     + +  +L +S   ++ ++
Sbjct: 1  MAATCQVTGAVPGFGHNISHSHRRTKRRFDPNVQKKTYYVPSLRRNVKLTLSAKGIKVID 60

Query: 61 RQG 63
           +G
Sbjct: 61 ARG 63


>gi|256374756|ref|YP_003098416.1| ribosomal protein L28 [Actinosynnema mirum DSM 43827]
 gi|255919059|gb|ACU34570.1| ribosomal protein L28 [Actinosynnema mirum DSM 43827]
          Length = 79

 Score = 37.4 bits (85), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 35/62 (56%)

Query: 2  SRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVER 61
          +R C+LT +    G +VSH++ +T RR+LPN  R         +   L +S   +++V+R
Sbjct: 3  ARHCQLTGRKPGYGKQVSHSHRRTNRRWLPNTQRRRYWLPSENRYVVLTLSTKGVKTVDR 62

Query: 62 QG 63
          +G
Sbjct: 63 RG 64


>gi|225620148|ref|YP_002721405.1| 50S ribosomal protein L28 [Brachyspira hyodysenteriae WA1]
 gi|254801504|sp|C0R0R3|RL28_BRAHW RecName: Full=50S ribosomal protein L28
 gi|225214967|gb|ACN83701.1| 50S ribosomal protein L28 [Brachyspira hyodysenteriae WA1]
          Length = 63

 Score = 37.4 bits (85), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 23/33 (69%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNL 33
          M+RVCE+  K   +G+ VSH+N KT+R F  NL
Sbjct: 1  MARVCEICGKGKQNGHSVSHSNIKTKRSFNANL 33


>gi|148380452|ref|YP_001254993.1| ribosomal protein L28 [Clostridium botulinum A str. ATCC 3502]
 gi|153932659|ref|YP_001384675.1| 50S ribosomal protein L28 [Clostridium botulinum A str. ATCC
          19397]
 gi|153936315|ref|YP_001388196.1| 50S ribosomal protein L28 [Clostridium botulinum A str. Hall]
 gi|153940221|ref|YP_001391794.1| 50S ribosomal protein L28 [Clostridium botulinum F str.
          Langeland]
 gi|168180619|ref|ZP_02615283.1| ribosomal protein L28 [Clostridium botulinum NCTC 2916]
 gi|168182575|ref|ZP_02617239.1| 50S ribosomal protein L28 [Clostridium botulinum Bf]
 gi|170754391|ref|YP_001782041.1| 50S ribosomal protein L28 [Clostridium botulinum B1 str. Okra]
 gi|170761433|ref|YP_001787813.1| 50S ribosomal protein L28 [Clostridium botulinum A3 str. Loch
          Maree]
 gi|187778907|ref|ZP_02995380.1| hypothetical protein CLOSPO_02502 [Clostridium sporogenes ATCC
          15579]
 gi|226949851|ref|YP_002804942.1| ribosomal protein L28 [Clostridium botulinum A2 str. Kyoto]
 gi|237795937|ref|YP_002863489.1| 50S ribosomal protein L28 [Clostridium botulinum Ba4 str. 657]
 gi|166226563|sp|A7FW64|RL28_CLOB1 RecName: Full=50S ribosomal protein L28
 gi|166226564|sp|A5I4S6|RL28_CLOBH RecName: Full=50S ribosomal protein L28
 gi|166226565|sp|A7GG84|RL28_CLOBL RecName: Full=50S ribosomal protein L28
 gi|226738056|sp|B1IIK9|RL28_CLOBK RecName: Full=50S ribosomal protein L28
 gi|226738057|sp|B1KX48|RL28_CLOBM RecName: Full=50S ribosomal protein L28
 gi|254801350|sp|C1FSR8|RL28_CLOBJ RecName: Full=50S ribosomal protein L28
 gi|259646729|sp|C3L0J9|RL28_CLOB6 RecName: Full=50S ribosomal protein L28
 gi|148289936|emb|CAL84049.1| 50S ribosomal protein L28 [Clostridium botulinum A str. ATCC
          3502]
 gi|152928703|gb|ABS34203.1| 50S ribosomal protein L28 [Clostridium botulinum A str. ATCC
          19397]
 gi|152932229|gb|ABS37728.1| 50S ribosomal protein L28 [Clostridium botulinum A str. Hall]
 gi|152936117|gb|ABS41615.1| 50S ribosomal protein L28 [Clostridium botulinum F str.
          Langeland]
 gi|169119603|gb|ACA43439.1| 50S ribosomal protein L28 [Clostridium botulinum B1 str. Okra]
 gi|169408422|gb|ACA56833.1| 50S ribosomal protein L28 [Clostridium botulinum A3 str. Loch
          Maree]
 gi|182668383|gb|EDT80362.1| ribosomal protein L28 [Clostridium botulinum NCTC 2916]
 gi|182674187|gb|EDT86148.1| 50S ribosomal protein L28 [Clostridium botulinum Bf]
 gi|187772532|gb|EDU36334.1| hypothetical protein CLOSPO_02502 [Clostridium sporogenes ATCC
          15579]
 gi|226840986|gb|ACO83652.1| ribosomal protein L28 [Clostridium botulinum A2 str. Kyoto]
 gi|229262855|gb|ACQ53888.1| 50S ribosomal protein L28 [Clostridium botulinum Ba4 str. 657]
 gi|295319820|gb|ADG00198.1| 50S ribosomal protein L28 [Clostridium botulinum F str. 230613]
 gi|322806765|emb|CBZ04334.1| LSU ribosomal protein L28p [Clostridium botulinum H04402 065]
          Length = 63

 Score = 37.4 bits (85), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 27/41 (65%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISD 41
          MSR CE+  K V+ G + SH++ +++R F PN+ R+  I +
Sbjct: 1  MSRKCEICGKGVVYGVQYSHSHRQSKRSFAPNIKRVKAIVN 41


>gi|26553855|ref|NP_757789.1| ribosomal protein L28 [Mycoplasma penetrans HF-2]
 gi|67461530|sp|Q8EW04|RL28_MYCPE RecName: Full=50S ribosomal protein L28
 gi|26453862|dbj|BAC44193.1| ribosomal protein L28 [Mycoplasma penetrans HF-2]
          Length = 82

 Score = 37.4 bits (85), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 34/53 (64%), Gaps = 3/53 (5%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLI---SDIMEQKYQLR 50
          M++V ++TKK  M+GN  SHA N +RRR+  NL ++ +    ++I+E K   R
Sbjct: 1  MAKVDQITKKRAMTGNTRSHALNHSRRRWDLNLQKVKIYDENNNIVEVKVTAR 53


>gi|220904652|ref|YP_002479964.1| 50S ribosomal protein L28 [Desulfovibrio desulfuricans subsp.
          desulfuricans str. ATCC 27774]
 gi|254801355|sp|B8J0K9|RL28_DESDA RecName: Full=50S ribosomal protein L28
 gi|219868951|gb|ACL49286.1| ribosomal protein L28 [Desulfovibrio desulfuricans subsp.
          desulfuricans str. ATCC 27774]
          Length = 69

 Score = 37.4 bits (85), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 19/36 (52%), Positives = 23/36 (63%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRI 36
          MS+ C    K    GN VSH+N KT+RRF PNL R+
Sbjct: 1  MSKECIFCGKKPQVGNLVSHSNIKTKRRFNPNLQRV 36


>gi|224534189|ref|ZP_03674767.1| ribosomal protein L28 [Borrelia spielmanii A14S]
 gi|224514291|gb|EEF84607.1| ribosomal protein L28 [Borrelia spielmanii A14S]
          Length = 92

 Score = 37.0 bits (84), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 37/82 (45%), Gaps = 14/82 (17%)

Query: 1  MSRVCELTKKTVMSGNKVS-------------HANNKTRRRFLPNLCRITLISDIMEQKY 47
          M+R CE+T K  M G+ V              H   KT+R F  NL         + +  
Sbjct: 1  MARKCEITGKKTMFGSNVPRKGLAKKKGGAGQHIGVKTKRTFKVNLINKKFFIPDLGRSI 60

Query: 48 QLRISKCALRSVERQGGLDRFL 69
           +++S  ALRS+ +  GLD FL
Sbjct: 61 NIKVSASALRSISKL-GLDAFL 81


>gi|325290437|ref|YP_004266618.1| LSU ribosomal protein L28P [Syntrophobotulus glycolicus DSM 8271]
 gi|324965838|gb|ADY56617.1| LSU ribosomal protein L28P [Syntrophobotulus glycolicus DSM 8271]
          Length = 63

 Score = 37.0 bits (84), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 35/62 (56%), Gaps = 2/62 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS VC +  K V +G KVSH++ +T+R + PNL R+  + +       LR+    LRS +
Sbjct: 1  MSNVCAICGKGVSTGMKVSHSHIRTKRTWKPNLQRVRAVVN--GTPTHLRVCTRCLRSGK 58

Query: 61 RQ 62
           Q
Sbjct: 59 VQ 60


>gi|15618247|ref|NP_224532.1| 50S ribosomal protein L28 [Chlamydophila pneumoniae CWL029]
 gi|15835862|ref|NP_300386.1| 50S ribosomal protein L28 [Chlamydophila pneumoniae J138]
 gi|16752711|ref|NP_444978.1| 50S ribosomal protein L28 [Chlamydophila pneumoniae AR39]
 gi|33241672|ref|NP_876613.1| 50S ribosomal protein L28 [Chlamydophila pneumoniae TW-183]
 gi|7674286|sp|Q9Z8L1|RL28_CHLPN RecName: Full=50S ribosomal protein L28
 gi|4376605|gb|AAD18476.1| L28 Ribosomal Protein [Chlamydophila pneumoniae CWL029]
 gi|7189354|gb|AAF38272.1| ribosomal protein L28 [Chlamydophila pneumoniae AR39]
 gi|8978701|dbj|BAA98537.1| L28 ribosomal protein [Chlamydophila pneumoniae J138]
 gi|33236181|gb|AAP98270.1| ribosomal protein L28 [Chlamydophila pneumoniae TW-183]
 gi|269303204|gb|ACZ33304.1| ribosomal protein L28 [Chlamydophila pneumoniae LPCoLN]
          Length = 89

 Score = 37.0 bits (84), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 41/90 (45%), Gaps = 14/90 (15%)

Query: 1  MSRVCELTKKTVMSGNKVS-------------HANNKTRRRFLPNLCRITLISDIMEQKY 47
          MSR C LT K    G   +                 KT+RRF PN+    L S    +  
Sbjct: 1  MSRKCPLTGKRPRRGYSYTLRGIAKKKKGIGLKVTGKTKRRFFPNMLTKRLWSTEENRFL 60

Query: 48 QLRISKCALRSVERQGGLDRFLSNSKKENL 77
          +L+IS  ALR +++  GL++ L  +K +N 
Sbjct: 61 KLKISASALRHIDKL-GLEKVLERAKSKNF 89


>gi|302562726|ref|ZP_07315068.1| ribosomal protein L28 [Streptomyces griseoflavus Tu4000]
 gi|302480344|gb|EFL43437.1| ribosomal protein L28 [Streptomyces griseoflavus Tu4000]
          Length = 78

 Score = 37.0 bits (84), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 34/63 (53%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS  C+LT      GN +SH++ +T RRF PN+ R         +  +L +S  A+++V+
Sbjct: 1  MSAHCQLTGAQPGFGNTISHSHRRTSRRFDPNIQRKRYWLPSEGRHVRLTLSAKAIKTVD 60

Query: 61 RQG 63
            G
Sbjct: 61 SIG 63


>gi|196014954|ref|XP_002117335.1| hypothetical protein TRIADDRAFT_61404 [Trichoplax adhaerens]
 gi|190580088|gb|EDV20174.1| hypothetical protein TRIADDRAFT_61404 [Trichoplax adhaerens]
          Length = 254

 Score = 37.0 bits (84), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 36/62 (58%), Gaps = 1/62 (1%)

Query: 29  FLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFLSNSKKENLSARMR-TLRSQ 87
           + PN+  + L SDI++Q  ++  +  AL+ +ER G LD ++  +  + L++     LR +
Sbjct: 47  WHPNVQTMKLFSDILDQTLRVPTTMSALKQIERAGSLDNYILRTPDKQLNSEFAFDLRKK 106

Query: 88  IL 89
           IL
Sbjct: 107 IL 108


>gi|29840217|ref|NP_829323.1| 50S ribosomal protein L28 [Chlamydophila caviae GPIC]
 gi|33301621|sp|Q823F7|RL28_CHLCV RecName: Full=50S ribosomal protein L28
 gi|29834565|gb|AAP05201.1| ribosomal protein L28 [Chlamydophila caviae GPIC]
          Length = 89

 Score = 37.0 bits (84), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 42/90 (46%), Gaps = 14/90 (15%)

Query: 1  MSRVCELTKKTVMSGNKVS-------------HANNKTRRRFLPNLCRITLISDIMEQKY 47
          MSR C LT K    GN  +                 KT RRF PN+    L S    +  
Sbjct: 1  MSRKCPLTGKRPRRGNSYTIRGIAKKKKGIGLKVTGKTPRRFFPNMITKRLWSTEENKFL 60

Query: 48 QLRISKCALRSVERQGGLDRFLSNSKKENL 77
          +L+IS  ALR +++  GL++ ++ +K + L
Sbjct: 61 KLKISTSALRLIDKL-GLEKVIARAKSKGL 89


>gi|161353680|ref|NP_627635.2| 50S ribosomal protein L28 [Streptomyces coelicolor A3(2)]
 gi|14195690|sp|Q9X8K8|RL28B_STRCO RecName: Full=50S ribosomal protein L28-2
          Length = 78

 Score = 37.0 bits (84), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 37/65 (56%), Gaps = 4/65 (6%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLC--RITLISDIMEQKYQLRISKCALRS 58
          MS  C LT      GN++SH++ +T RRF PN+   R  L S+   +  +LR+S   +R+
Sbjct: 1  MSAHCMLTGARPGFGNRISHSHRRTSRRFDPNIQTKRYWLPSE--NRHVRLRLSTKGIRT 58

Query: 59 VERQG 63
          V+  G
Sbjct: 59 VDSIG 63


>gi|218290484|ref|ZP_03494604.1| ribosomal protein L28 [Alicyclobacillus acidocaldarius LAA1]
 gi|218239505|gb|EED06700.1| ribosomal protein L28 [Alicyclobacillus acidocaldarius LAA1]
          Length = 63

 Score = 37.0 bits (84), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 23/33 (69%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNL 33
          M+R CE+  +    GNK+SH++  T+RR+ PNL
Sbjct: 1  MARRCEVCGRGPQVGNKISHSHILTKRRWYPNL 33


>gi|163790816|ref|ZP_02185241.1| 50S ribosomal protein L28 [Carnobacterium sp. AT7]
 gi|159873884|gb|EDP67963.1| 50S ribosomal protein L28 [Carnobacterium sp. AT7]
          Length = 62

 Score = 37.0 bits (84), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 35/58 (60%), Gaps = 2/58 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS 58
          M++ C +T +   SGN  SHA NKT+R +  NL ++ ++ D   +K  + +S  AL+S
Sbjct: 1  MAKECAITGRKARSGNNRSHAMNKTKRTWGANLQKVRIMVDGSPKK--VWVSARALKS 56


>gi|256786964|ref|ZP_05525395.1| 50S ribosomal protein L28 [Streptomyces lividans TK24]
 gi|289770857|ref|ZP_06530235.1| 50S ribosomal protein L28 [Streptomyces lividans TK24]
 gi|289701056|gb|EFD68485.1| 50S ribosomal protein L28 [Streptomyces lividans TK24]
          Length = 78

 Score = 37.0 bits (84), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 37/65 (56%), Gaps = 4/65 (6%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLC--RITLISDIMEQKYQLRISKCALRS 58
          MS  C LT      GN++SH++ +T RRF PN+   R  L S+   +  +LR+S   +R+
Sbjct: 1  MSAHCMLTGARPGFGNRISHSHRRTSRRFDPNIQTRRYWLPSE--NRHVRLRLSTKGIRT 58

Query: 59 VERQG 63
          V+  G
Sbjct: 59 VDSIG 63


>gi|89895425|ref|YP_518912.1| 50S ribosomal protein L28 [Desulfitobacterium hafniense Y51]
 gi|219669856|ref|YP_002460291.1| 50S ribosomal protein L28 [Desulfitobacterium hafniense DCB-2]
 gi|122482250|sp|Q24U24|RL28_DESHY RecName: Full=50S ribosomal protein L28
 gi|254801356|sp|B8FS67|RL28_DESHD RecName: Full=50S ribosomal protein L28
 gi|89334873|dbj|BAE84468.1| 50S ribosomal protein L28 [Desulfitobacterium hafniense Y51]
 gi|219540116|gb|ACL21855.1| ribosomal protein L28 [Desulfitobacterium hafniense DCB-2]
          Length = 63

 Score = 37.0 bits (84), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 36/64 (56%), Gaps = 6/64 (9%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKC--ALRS 58
          M+ VC +  K V SG +VSH++ +T+R + PNL R+  I +        RIS C   LRS
Sbjct: 1  MANVCAICGKGVASGIQVSHSHIRTKRTWKPNLQRVHAIVN----GTPTRISVCTRCLRS 56

Query: 59 VERQ 62
           + Q
Sbjct: 57 GKVQ 60


>gi|161407960|ref|NP_875325.2| 50S ribosomal protein L28 [Prochlorococcus marinus subsp. marinus
          str. CCMP1375]
 gi|67461503|sp|Q7VC09|RL28_PROMA RecName: Full=50S ribosomal protein L28
          Length = 78

 Score = 37.0 bits (84), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 41/68 (60%), Gaps = 1/68 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVCEL+     +G  VSH++ +T++    NL +  L  +  ++   +R+S   L++++
Sbjct: 1  MSRVCELSGTRANNGMAVSHSHIRTKKLQQANLQKRRLWWEEGKKWLNIRVSTSTLKTIQ 60

Query: 61 RQGGLDRF 68
          ++ GLD +
Sbjct: 61 KK-GLDSY 67


>gi|300869908|ref|YP_003784779.1| 50S ribosomal protein L28 [Brachyspira pilosicoli 95/1000]
 gi|300687607|gb|ADK30278.1| 50S ribosomal protein L28 [Brachyspira pilosicoli 95/1000]
          Length = 64

 Score = 37.0 bits (84), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 23/33 (69%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNL 33
          M+RVCE+  K   +G+ VSH+N KT+R F  NL
Sbjct: 2  MARVCEICGKGKQNGHSVSHSNIKTKRSFNANL 34


>gi|262039616|ref|ZP_06012910.1| 50S ribosomal protein L28 [Leptotrichia goodfellowii F0264]
 gi|261746373|gb|EEY33918.1| 50S ribosomal protein L28 [Leptotrichia goodfellowii F0264]
          Length = 87

 Score = 37.0 bits (84), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 29/83 (34%), Positives = 49/83 (59%), Gaps = 9/83 (10%)

Query: 3  RVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQ 62
          ++CE+  K V  GN VSH++  T+R + PNL  +TL  D  E K  +R+   A+++++ +
Sbjct: 2  QICEVFGKRVGHGNMVSHSHRATKRIWRPNLQTMTLNVDGSEIK--VRVCTKAMKTLKGK 59

Query: 63 GGLDR----FLSNSKKENLSARM 81
            +D+     L N  K+NLS R+
Sbjct: 60 -NVDQVKKILLEN--KDNLSPRI 79


>gi|169839015|ref|ZP_02872203.1| LSU ribosomal protein L28P [candidate division TM7 single-cell
          isolate TM7a]
          Length = 72

 Score = 37.0 bits (84), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 37/56 (66%), Gaps = 2/56 (3%)

Query: 5  CELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          CE+  KTV  GN+VSH++  T+R + PNL   T++  I  ++ ++R+   A+++++
Sbjct: 18 CEVFGKTVSHGNRVSHSHKATKRIWRPNL--QTMLLTINNEEVRVRVCTKAMKTLK 71


>gi|38233448|ref|NP_939215.1| 50S ribosomal protein L28 [Corynebacterium diphtheriae NCTC
          13129]
 gi|67461437|sp|Q6NIC6|RL28_CORDI RecName: Full=50S ribosomal protein L28
 gi|38199708|emb|CAE49368.1| 50S ribosomal protein L28-2 [Corynebacterium diphtheriae]
          Length = 78

 Score = 37.0 bits (84), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 33/63 (52%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS +C++T +    G  VSH++ +T RR+ PN+ R         +   L +S   L+ ++
Sbjct: 1  MSAICQVTGRQPGYGKSVSHSHRRTSRRWNPNVQRRKFYLPSEGRTITLNVSTKGLKVID 60

Query: 61 RQG 63
          R G
Sbjct: 61 RDG 63


>gi|152964257|ref|YP_001360041.1| ribosomal protein L28 [Kineococcus radiotolerans SRS30216]
 gi|151358774|gb|ABS01777.1| ribosomal protein L28 [Kineococcus radiotolerans SRS30216]
          Length = 78

 Score = 37.0 bits (84), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 33/63 (52%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS  C++T      G  VSH++ +T RRF PN+ R       + +   L +S   +++V+
Sbjct: 1  MSARCQVTGAVPGFGKSVSHSHRRTNRRFDPNVQRKRWFVPSLGRTVTLTVSARGIKTVD 60

Query: 61 RQG 63
           +G
Sbjct: 61 ERG 63


>gi|325068208|ref|ZP_08126881.1| 50S ribosomal protein L28 [Actinomyces oris K20]
 gi|326774132|ref|ZP_08233414.1| ribosomal protein L28 [Actinomyces viscosus C505]
 gi|326636271|gb|EGE37175.1| ribosomal protein L28 [Actinomyces viscosus C505]
          Length = 79

 Score = 37.0 bits (84), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 35/63 (55%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+  C++T    + G  VSH++ +T RR+ PNL R       + +  +L +S   +R+++
Sbjct: 1  MTTYCQVTGARPVFGRSVSHSHKRTPRRWDPNLQRKRYWVPSLGRTVRLTVSAKGIRTID 60

Query: 61 RQG 63
          + G
Sbjct: 61 KLG 63


>gi|33237910|gb|AAP99977.1| Ribosomal protein L28 [Prochlorococcus marinus subsp. marinus
          str. CCMP1375]
          Length = 82

 Score = 37.0 bits (84), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 41/68 (60%), Gaps = 1/68 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVCEL+     +G  VSH++ +T++    NL +  L  +  ++   +R+S   L++++
Sbjct: 5  MSRVCELSGTRANNGMAVSHSHIRTKKLQQANLQKRRLWWEEGKKWLNIRVSTSTLKTIQ 64

Query: 61 RQGGLDRF 68
          ++ GLD +
Sbjct: 65 KK-GLDSY 71


>gi|300932567|ref|ZP_07147823.1| 50S ribosomal protein L28 [Corynebacterium resistens DSM 45100]
          Length = 78

 Score = 37.0 bits (84), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 34/63 (53%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS  C++T +    G  VSH++ +T RR+ PN+ R +       +   L +S   L++++
Sbjct: 1  MSAHCQVTGREPKFGKTVSHSHRRTSRRWNPNIQRRSFYLPSEGRTITLNVSTKGLKTID 60

Query: 61 RQG 63
          R G
Sbjct: 61 RDG 63


>gi|300858075|ref|YP_003783058.1| 50S ribosomal protein L28 [Corynebacterium pseudotuberculosis
          FRC41]
 gi|300685529|gb|ADK28451.1| 50S ribosomal protein L28 [Corynebacterium pseudotuberculosis
          FRC41]
 gi|302205797|gb|ADL10139.1| 50S ribosomal protein L28 [Corynebacterium pseudotuberculosis
          C231]
 gi|302330356|gb|ADL20550.1| 50S ribosomal protein L28 [Corynebacterium pseudotuberculosis
          1002]
 gi|308276032|gb|ADO25931.1| 50S ribosomal protein L28 [Corynebacterium pseudotuberculosis
          I19]
          Length = 78

 Score = 37.0 bits (84), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 33/63 (52%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS +C++T +    G  VSH++ +T RR+ PN+ R         +   L +S   L+ ++
Sbjct: 1  MSAICQVTGRKPGYGKSVSHSHRRTSRRWNPNVQRRKFYLPSEGRTITLNVSTKGLKVID 60

Query: 61 RQG 63
          R G
Sbjct: 61 RDG 63


>gi|254430435|ref|ZP_05044138.1| ribosomal protein L28 [Cyanobium sp. PCC 7001]
 gi|197624888|gb|EDY37447.1| ribosomal protein L28 [Cyanobium sp. PCC 7001]
          Length = 78

 Score = 37.0 bits (84), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 38/63 (60%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC+LT K   +G  VSH++ +T++    NL    L      +  +LR+S  ALR+++
Sbjct: 1  MSRVCQLTGKRANNGMAVSHSHVRTKKLQQVNLQERRLWWAEGNRFVRLRVSTRALRTIQ 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|319950952|ref|ZP_08024824.1| 50S ribosomal protein L28 [Dietzia cinnamea P4]
 gi|319435374|gb|EFV90622.1| 50S ribosomal protein L28 [Dietzia cinnamea P4]
          Length = 78

 Score = 37.0 bits (84), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 35/63 (55%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS  C++T +    G  VSH++ +T RR+ PN+ R +       ++  L +S   +++++
Sbjct: 1  MSAHCQVTGRKPGFGKSVSHSHRRTNRRWNPNIQRRSYFLPSEGRRVTLTVSTKGIKTID 60

Query: 61 RQG 63
          R G
Sbjct: 61 RDG 63


>gi|172040222|ref|YP_001799936.1| 50S ribosomal protein L28 [Corynebacterium urealyticum DSM 7109]
 gi|226738059|sp|B1VFG3|RL28_CORU7 RecName: Full=50S ribosomal protein L28
 gi|171851526|emb|CAQ04502.1| 50S ribosomal protein L28 [Corynebacterium urealyticum DSM 7109]
          Length = 78

 Score = 37.0 bits (84), Expect = 1.00,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 33/63 (52%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS  C++T +    G +VSH++  T RR+ PN+ R         +   L +S   L++++
Sbjct: 1  MSAYCQVTGRKPGFGKQVSHSHRHTSRRWNPNVQRRKFYLPSEGRTITLTVSPKGLKTID 60

Query: 61 RQG 63
          R G
Sbjct: 61 RDG 63


>gi|229541131|ref|ZP_04430191.1| ribosomal protein L28 [Bacillus coagulans 36D1]
 gi|229325551|gb|EEN91226.1| ribosomal protein L28 [Bacillus coagulans 36D1]
          Length = 62

 Score = 37.0 bits (84), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 37/63 (58%), Gaps = 4/63 (6%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS-- 58
          M + C +T +  +SGNK SHA N  +R +  NL ++ ++ D   Q+  + +S  AL+S  
Sbjct: 1  MPKKCAITGRKTVSGNKRSHAMNANKRTWKANLQKVRILVDGKPQR--VWVSARALKSGK 58

Query: 59 VER 61
          VER
Sbjct: 59 VER 61


>gi|227487783|ref|ZP_03918099.1| 50S ribosomal protein L28 [Corynebacterium glucuronolyticum ATCC
          51867]
 gi|227542424|ref|ZP_03972473.1| 50S ribosomal protein L28 [Corynebacterium glucuronolyticum ATCC
          51866]
 gi|227092285|gb|EEI27597.1| 50S ribosomal protein L28 [Corynebacterium glucuronolyticum ATCC
          51867]
 gi|227181622|gb|EEI62594.1| 50S ribosomal protein L28 [Corynebacterium glucuronolyticum ATCC
          51866]
          Length = 78

 Score = 37.0 bits (84), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 33/63 (52%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS +C++T +    G  VSH++ +T RR+ PN+ R         +   L +S   L+ ++
Sbjct: 1  MSAICQVTGRKPGFGKSVSHSHRRTNRRWNPNIQRRKFYLPSEGRTITLNVSTKGLKVID 60

Query: 61 RQG 63
          R G
Sbjct: 61 RDG 63


>gi|60393665|sp|P68998|RL28_MYCLE RecName: Full=Putative 50S ribosomal protein L28
          Length = 64

 Score = 37.0 bits (84), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 30/51 (58%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRI 51
          M+ VC++  K    G  VSH++ +T RR+ PN+  + +++     K QL++
Sbjct: 1  MAAVCDICGKGPGFGKSVSHSHRRTSRRWDPNVQTVHMVTRPGGNKQQLKV 51


>gi|70943001|ref|XP_741599.1| hypothetical protein [Plasmodium chabaudi chabaudi]
 gi|56520081|emb|CAH84010.1| conserved hypothetical protein [Plasmodium chabaudi chabaudi]
          Length = 279

 Score = 36.6 bits (83), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 36/62 (58%), Gaps = 1/62 (1%)

Query: 17  KVSHANNKTRRRFLPNLCRITLISDIMEQKYQ-LRISKCALRSVERQGGLDRFLSNSKKE 75
           KVS++  KTR +  PN+ +  ++S+I+      +RI+  AL +++  GG D ++  +  E
Sbjct: 60  KVSYSLKKTRIKIKPNVFKKHIVSNILNTIIPSVRITTSALHAIDDAGGFDNYILRTPPE 119

Query: 76  NL 77
            L
Sbjct: 120 EL 121


>gi|224110604|ref|XP_002315574.1| predicted protein [Populus trichocarpa]
 gi|222864614|gb|EEF01745.1| predicted protein [Populus trichocarpa]
          Length = 118

 Score = 36.6 bits (83), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 37/64 (57%), Gaps = 1/64 (1%)

Query: 3   RVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQ 62
           R+C  T K     NKVS +N+KT++    NL    +  +  ++  +LR+S  AL+++E+ 
Sbjct: 43  RICPFTGKKANRANKVSFSNHKTKKLQFVNLQYKRVWWEAGKRYVKLRLSTKALKTIEKN 102

Query: 63  GGLD 66
            GLD
Sbjct: 103 -GLD 105


>gi|294673491|ref|YP_003574107.1| 50S ribosomal protein L28 [Prevotella ruminicola 23]
 gi|294471764|gb|ADE81153.1| ribosomal protein L28 [Prevotella ruminicola 23]
          Length = 87

 Score = 36.6 bits (83), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 36/72 (50%), Gaps = 1/72 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS++C++T K    G  VSH+ ++T+R F  NL              QL+IS   LR + 
Sbjct: 1  MSKICQITGKKAQIGCNVSHSKHRTKRSFDVNLFSKKFYYVEEGCWIQLKISAAGLRMIN 60

Query: 61 RQGGLDRFLSNS 72
          +  GLD  L  +
Sbjct: 61 KV-GLDAALKQA 71


>gi|320533926|ref|ZP_08034498.1| ribosomal protein L28 [Actinomyces sp. oral taxon 171 str. F0337]
 gi|320133859|gb|EFW26235.1| ribosomal protein L28 [Actinomyces sp. oral taxon 171 str. F0337]
          Length = 82

 Score = 36.6 bits (83), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 35/63 (55%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+  C++T    + G  VSH++ +T RR+ PNL R       + +  +L +S   +R+++
Sbjct: 4  MTTYCQVTGARPVFGRSVSHSHKRTPRRWDPNLQRKRYWVPSLGRTVRLTVSAKGIRTID 63

Query: 61 RQG 63
          + G
Sbjct: 64 KLG 66


>gi|330836397|ref|YP_004411038.1| 50S ribosomal protein L28P [Spirochaeta coccoides DSM 17374]
 gi|329748300|gb|AEC01656.1| LSU ribosomal protein L28P [Spirochaeta coccoides DSM 17374]
          Length = 76

 Score = 36.6 bits (83), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 35/71 (49%), Gaps = 15/71 (21%)

Query: 1  MSRVCELTKKTVMSGNKVS-------------HANNKTRRRFLPNLCRITLISDIMEQKY 47
          M+R C+LT K  MSGN V+             H    T+R F PNL ++  + D   +  
Sbjct: 1  MARRCQLTGKGTMSGNIVTRKGQAKKKGGVGQHIGVCTKRTFKPNLVKVKTLID--GKPV 58

Query: 48 QLRISKCALRS 58
           L+IS  ALRS
Sbjct: 59 TLKISVRALRS 69


>gi|33861459|ref|NP_893020.1| 50S ribosomal protein L28 [Prochlorococcus marinus subsp.
          pastoris str. CCMP1986]
 gi|67461501|sp|Q7V1H0|RL28_PROMP RecName: Full=50S ribosomal protein L28
 gi|33634036|emb|CAE19361.1| 50S ribosomal protein L28 [Prochlorococcus marinus subsp.
          pastoris str. CCMP1986]
          Length = 78

 Score = 36.6 bits (83), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 40/67 (59%), Gaps = 1/67 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVCELT     +G  VSH++ +T++    NL +  L     ++   ++IS  AL+S++
Sbjct: 1  MSRVCELTGAKANNGMAVSHSHIRTKKLQQVNLQKRRLWWQEGKKWVNIKISTKALKSIQ 60

Query: 61 RQGGLDR 67
          +  GLD+
Sbjct: 61 KV-GLDK 66


>gi|148906245|gb|ABR16278.1| unknown [Picea sitchensis]
          Length = 222

 Score = 36.6 bits (83), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 35/59 (59%), Gaps = 1/59 (1%)

Query: 12  VMSGNKVSH-ANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFL 69
           +  GN +S    NKTRR + PN+    L S I+++  +++++   LR +++ G +D +L
Sbjct: 53  IQFGNNISEDGGNKTRRTWKPNVQEKRLFSLILDRYIRIKVTTHTLRCIDKAGCIDDYL 111


>gi|288802432|ref|ZP_06407871.1| 50S ribosomal protein L28 [Prevotella melaninogenica D18]
 gi|302346522|ref|YP_003814820.1| ribosomal protein L28 [Prevotella melaninogenica ATCC 25845]
 gi|288334960|gb|EFC73396.1| 50S ribosomal protein L28 [Prevotella melaninogenica D18]
 gi|302151106|gb|ADK97367.1| ribosomal protein L28 [Prevotella melaninogenica ATCC 25845]
          Length = 87

 Score = 36.6 bits (83), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 35/69 (50%), Gaps = 1/69 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS++C++T K    G  VSH+ ++T+R F  NL              QL+IS   LR + 
Sbjct: 1  MSKICQITGKKAQIGCNVSHSKHRTKRSFDVNLFSKKFYYVEEACWIQLKISAAGLRLIN 60

Query: 61 RQGGLDRFL 69
          +  GLD  L
Sbjct: 61 KV-GLDAAL 68


>gi|260891095|ref|ZP_05902358.1| ribosomal protein L28 [Leptotrichia hofstadii F0254]
 gi|260859122|gb|EEX73622.1| ribosomal protein L28 [Leptotrichia hofstadii F0254]
          Length = 99

 Score = 36.6 bits (83), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 37/56 (66%), Gaps = 2/56 (3%)

Query: 5  CELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          CE+  KTV  GN+VSH++  T+R + PNL   T++  I  ++ ++R+   A+++++
Sbjct: 18 CEVFGKTVSHGNRVSHSHRATKRIWRPNLQ--TMLLTINNEEVRVRVCTKAMKTLK 71


>gi|257124966|ref|YP_003163080.1| ribosomal protein L28 [Leptotrichia buccalis C-1013-b]
 gi|257048905|gb|ACV38089.1| ribosomal protein L28 [Leptotrichia buccalis C-1013-b]
          Length = 85

 Score = 36.6 bits (83), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 37/56 (66%), Gaps = 2/56 (3%)

Query: 5  CELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          CE+  KTV  GN+VSH++  T+R + PNL   T++  I  ++ ++R+   A+++++
Sbjct: 4  CEVFGKTVSHGNRVSHSHRATKRIWRPNLQ--TMLLTINNEEVRVRVCTKAMKTLK 57


>gi|315109324|gb|EFT81300.1| ribosomal protein L28 [Propionibacterium acnes HL030PA2]
          Length = 92

 Score = 36.6 bits (83), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 35/63 (55%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR C++       GN VSH+   T+RR+ PN+ +       + +K  L ++  A++ ++
Sbjct: 15 MSRRCQVRGTKPEFGNNVSHSQRHTKRRWNPNIQKKRYWVPSLGRKVTLTLTPKAIKEID 74

Query: 61 RQG 63
          R+G
Sbjct: 75 RRG 77


>gi|118487864|gb|ABK95755.1| unknown [Populus trichocarpa]
          Length = 150

 Score = 36.6 bits (83), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 37/64 (57%), Gaps = 1/64 (1%)

Query: 3   RVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQ 62
           R+C  T K     NKVS +N+KT++    NL    +  +  ++  +LR+S  AL+++E+ 
Sbjct: 75  RICPFTGKKANRANKVSFSNHKTKKLQFVNLQYKRVWWEAGKRYVKLRLSTKALKTIEKN 134

Query: 63  GGLD 66
            GLD
Sbjct: 135 -GLD 137


>gi|1903348|gb|AAB70428.1| Strong similarity to 50S ribosomal protein L28 (gb|X68078)
          [Arabidopsis thaliana]
          Length = 81

 Score = 36.6 bits (83), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 35/62 (56%)

Query: 2  SRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVER 61
          SR+C  T K     NKVS +N+KT++    NL    +  +  ++   LR+S  AL+++E+
Sbjct: 5  SRICPFTGKKANRANKVSFSNHKTKKLQFVNLQYKRVWWEAGKRFVILRLSTKALKTIEK 64

Query: 62 QG 63
           G
Sbjct: 65 NG 66


>gi|50365043|ref|YP_053468.1| 50S ribosomal protein L28 [Mesoplasma florum L1]
 gi|67461398|sp|Q6F1N9|RL28_MESFL RecName: Full=50S ribosomal protein L28
 gi|50363599|gb|AAT75584.1| 50S ribosomal protein L28 [Mesoplasma florum L1]
          Length = 66

 Score = 36.6 bits (83), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 39/62 (62%), Gaps = 1/62 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+R   LT K+ +SGN  SHA N T+R++  NL ++ ++ D     + +++S   LR+++
Sbjct: 1  MARKDMLTGKSALSGNSRSHALNATKRKWNLNLQKVKVM-DENGNVFTIKVSARTLRTLK 59

Query: 61 RQ 62
          +Q
Sbjct: 60 KQ 61


>gi|255994498|ref|ZP_05427633.1| ribosomal protein L28 [Eubacterium saphenum ATCC 49989]
 gi|255993211|gb|EEU03300.1| ribosomal protein L28 [Eubacterium saphenum ATCC 49989]
          Length = 63

 Score = 36.6 bits (83), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 29/41 (70%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISD 41
          MS+ CE+  K  +SGN+VSH+N  ++R++  N+ ++ ++ +
Sbjct: 1  MSKKCEICGKGQVSGNRVSHSNIHSKRKWNANIQKVQIVEN 41


>gi|220906054|ref|YP_002481365.1| 50S ribosomal protein L28 [Cyanothece sp. PCC 7425]
 gi|254801354|sp|B8HUV7|RL28_CYAP4 RecName: Full=50S ribosomal protein L28
 gi|219862665|gb|ACL43004.1| ribosomal protein L28 [Cyanothece sp. PCC 7425]
          Length = 78

 Score = 36.6 bits (83), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 40/68 (58%), Gaps = 1/68 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC+LT K   +   VSH++ +T++    NL    +     ++  +LR+S  AL+++E
Sbjct: 1  MSRVCQLTGKRANNAYAVSHSHRRTKKLQEVNLQWKRIWWPQGKRWVRLRLSTKALKTLE 60

Query: 61 RQGGLDRF 68
           + GLD F
Sbjct: 61 HK-GLDSF 67


>gi|302874757|ref|YP_003843390.1| 50S ribosomal protein L28 [Clostridium cellulovorans 743B]
 gi|307690628|ref|ZP_07633074.1| 50S ribosomal protein L28 [Clostridium cellulovorans 743B]
 gi|302577614|gb|ADL51626.1| ribosomal protein L28 [Clostridium cellulovorans 743B]
          Length = 63

 Score = 36.6 bits (83), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 23/33 (69%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNL 33
          MSR CE+  K V+SG + SH++  ++R + PN+
Sbjct: 1  MSRKCEICGKGVISGAQYSHSHRASKRTWAPNI 33


>gi|239918397|ref|YP_002957955.1| LSU ribosomal protein L28P [Micrococcus luteus NCTC 2665]
 gi|281415407|ref|ZP_06247149.1| 50S ribosomal protein L28 [Micrococcus luteus NCTC 2665]
 gi|289707032|ref|ZP_06503363.1| ribosomal protein L28 [Micrococcus luteus SK58]
 gi|259646745|sp|C5C6R3|RL28_MICLC RecName: Full=50S ribosomal protein L28
 gi|239839604|gb|ACS31401.1| LSU ribosomal protein L28P [Micrococcus luteus NCTC 2665]
 gi|289556218|gb|EFD49578.1| ribosomal protein L28 [Micrococcus luteus SK58]
          Length = 78

 Score = 36.6 bits (83), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 17/71 (23%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+  C++T      G+ +SH++ +T+RRF PN+ + T     + +   L +S   +++++
Sbjct: 1  MAAHCQVTGAGPGFGHSISHSHRRTKRRFDPNIQKKTYWVPSLRRNVTLTLSAKGIKTID 60

Query: 61 RQGGLDRFLSN 71
           + G+D  +++
Sbjct: 61 VR-GIDAVVAD 70


>gi|125973794|ref|YP_001037704.1| 50S ribosomal protein L28P [Clostridium thermocellum ATCC 27405]
 gi|256004525|ref|ZP_05429504.1| ribosomal protein L28 [Clostridium thermocellum DSM 2360]
 gi|281417951|ref|ZP_06248971.1| ribosomal protein L28 [Clostridium thermocellum JW20]
 gi|166226567|sp|A3DEY2|RL28_CLOTH RecName: Full=50S ribosomal protein L28
 gi|125714019|gb|ABN52511.1| LSU ribosomal protein L28P [Clostridium thermocellum ATCC 27405]
 gi|255991530|gb|EEU01633.1| ribosomal protein L28 [Clostridium thermocellum DSM 2360]
 gi|281409353|gb|EFB39611.1| ribosomal protein L28 [Clostridium thermocellum JW20]
 gi|316940013|gb|ADU74047.1| ribosomal protein L28 [Clostridium thermocellum DSM 1313]
          Length = 62

 Score = 36.6 bits (83), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 25/37 (67%)

Query: 5  CELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISD 41
          C++  K V+ G KVSH+N KT R + PN+ RI +I +
Sbjct: 4  CDICSKDVLFGLKVSHSNRKTNRTWKPNIRRIKIIEN 40


>gi|118489930|gb|ABK96762.1| unknown [Populus trichocarpa x Populus deltoides]
          Length = 153

 Score = 36.6 bits (83), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 37/64 (57%), Gaps = 1/64 (1%)

Query: 3   RVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQ 62
           R+C  T K     NKVS +N+KT++    NL    +  +  ++  +LR+S  AL+++E+ 
Sbjct: 78  RICPFTGKKANRANKVSFSNHKTKKLQFVNLQYKRVWWEAGKRYVKLRLSTKALKTIEKN 137

Query: 63  GGLD 66
            GLD
Sbjct: 138 -GLD 140


>gi|146163214|ref|XP_001011035.2| ribosomal protein L28 containing protein [Tetrahymena thermophila]
 gi|146146077|gb|EAR90790.2| ribosomal protein L28 containing protein [Tetrahymena thermophila
           SB210]
          Length = 289

 Score = 36.2 bits (82), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 21/79 (26%), Positives = 46/79 (58%), Gaps = 4/79 (5%)

Query: 14  SGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFLSNSK 73
           +G +   +  K+ R +  N+    L SDI+++K ++++S   LR++++ GG D ++  +K
Sbjct: 72  TGLQTCFSEKKSIRWWKVNVHEKYLWSDILQKKIRIQMSSKTLRTIDKYGGFDNYVLLTK 131

Query: 74  KENLSARMRTLRSQILKKM 92
            +N    M +L  + L+K+
Sbjct: 132 PKN----MDSLYGEYLRKL 146


>gi|187918220|ref|YP_001883783.1| 50S ribosomal protein L28 [Borrelia hermsii DAH]
 gi|226738037|sp|B2S057|RL28_BORHD RecName: Full=50S ribosomal protein L28
 gi|119861068|gb|AAX16863.1| LSU ribosomal protein L28P [Borrelia hermsii DAH]
          Length = 92

 Score = 36.2 bits (82), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 35/82 (42%), Gaps = 14/82 (17%)

Query: 1  MSRVCELTKKTVMSGNKVS-------------HANNKTRRRFLPNLCRITLISDIMEQKY 47
          M R CE+T K  M GN V              H   KT+R F  NL         + +  
Sbjct: 1  MGRECEITGKRTMFGNNVPRKGLAKKKGGAGQHIGVKTKRTFKVNLINKKFFIPELGKSV 60

Query: 48 QLRISKCALRSVERQGGLDRFL 69
           ++IS  ALRS+ +  GL  FL
Sbjct: 61 NIKISASALRSISKV-GLSVFL 81


>gi|300727625|ref|ZP_07061014.1| ribosomal protein L28-related protein [Prevotella bryantii B14]
 gi|299775145|gb|EFI71748.1| ribosomal protein L28-related protein [Prevotella bryantii B14]
          Length = 87

 Score = 36.2 bits (82), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 36/72 (50%), Gaps = 1/72 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS++C++T K    G  VSH+ ++T+R F  NL               L+IS   LR + 
Sbjct: 1  MSKICQITGKKAQLGCNVSHSKHRTKRSFDVNLFSKKFYYVEEGCWISLKISAAGLRLIN 60

Query: 61 RQGGLDRFLSNS 72
          +  GLD  L N+
Sbjct: 61 KV-GLDAALQNA 71


>gi|229918589|ref|YP_002887235.1| 50S ribosomal protein L28 [Exiguobacterium sp. AT1b]
 gi|259646738|sp|C4L5Y4|RL28_EXISA RecName: Full=50S ribosomal protein L28
 gi|229470018|gb|ACQ71790.1| ribosomal protein L28 [Exiguobacterium sp. AT1b]
          Length = 62

 Score = 36.2 bits (82), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 39/63 (61%), Gaps = 4/63 (6%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS-- 58
          M+R C +T K+  SGN  SHA NKT+R +  N+ ++ ++ D   ++  + +S  AL+S  
Sbjct: 1  MARKCYVTGKSPKSGNNRSHALNKTKRTWGVNVQKVRILVDGKPKR--VWVSARALKSGL 58

Query: 59 VER 61
          VER
Sbjct: 59 VER 61


>gi|330318732|gb|AEC11026.1| 50S ribosomal protein L28 [Camellia sinensis]
          Length = 74

 Score = 36.2 bits (82), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 34/59 (57%)

Query: 5  CELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQG 63
          C  T K     NKVSH+N+KT++    NL    +  +  ++  +LR+S  A++++E+ G
Sbjct: 1  CPFTGKKSNRANKVSHSNHKTKKLQFVNLQYKRIWWEAGKRYVKLRLSTKAIKTIEKNG 59


>gi|297848674|ref|XP_002892218.1| 50S ribosomal protein L28, chloroplast [Arabidopsis lyrata subsp.
           lyrata]
 gi|297338060|gb|EFH68477.1| 50S ribosomal protein L28, chloroplast [Arabidopsis lyrata subsp.
           lyrata]
          Length = 137

 Score = 36.2 bits (82), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 35/61 (57%)

Query: 3   RVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQ 62
           R+C  T K     NKVS +N+KT++    NL    +  +  ++  +LR+S  AL+++E+ 
Sbjct: 62  RICPFTGKKANRANKVSFSNHKTKKLQFVNLQYKKVWWEAGKRFVKLRLSTKALKTIEKN 121

Query: 63  G 63
           G
Sbjct: 122 G 122


>gi|18403278|ref|NP_565765.1| 50S ribosomal protein L28, chloroplast (CL28) [Arabidopsis
           thaliana]
 gi|21542433|sp|O22795|RK28_ARATH RecName: Full=50S ribosomal protein L28, chloroplastic; AltName:
           Full=CL28; Flags: Precursor
 gi|18252877|gb|AAL62365.1| putative chloroplast 50S ribosomal protein L28 [Arabidopsis
           thaliana]
 gi|20196843|gb|AAB80662.2| putative chloroplast 50S ribosomal protein L28 [Arabidopsis
           thaliana]
 gi|21387067|gb|AAM47937.1| putative chloroplast 50S ribosomal protein L28 [Arabidopsis
           thaliana]
 gi|21592705|gb|AAM64654.1| putative chloroplast 50S ribosomal protein L28 [Arabidopsis
           thaliana]
 gi|330253742|gb|AEC08836.1| 50S ribosomal protein L28 [Arabidopsis thaliana]
          Length = 143

 Score = 36.2 bits (82), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 37/64 (57%), Gaps = 1/64 (1%)

Query: 3   RVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQ 62
           R+C  T K     NKVS +N+KT++    NL    +  +  ++  +LR+S  AL+++E+ 
Sbjct: 68  RICPFTGKKANRANKVSFSNHKTKKLQFVNLQYKRVWWEAGKRFVKLRLSTKALKTIEKN 127

Query: 63  GGLD 66
            GLD
Sbjct: 128 -GLD 130


>gi|206896407|ref|YP_002246642.1| ribosomal protein L28 [Coprothermobacter proteolyticus DSM 5265]
 gi|226738058|sp|B5Y795|RL28_COPPD RecName: Full=50S ribosomal protein L28
 gi|206739024|gb|ACI18102.1| ribosomal protein L28 [Coprothermobacter proteolyticus DSM 5265]
          Length = 63

 Score = 36.2 bits (82), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 24/36 (66%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRI 36
          M+RVC +  K    G+ VSH+N +T RR++ NL R+
Sbjct: 1  MARVCSVCGKGTTFGHNVSHSNRRTNRRWVANLKRV 36


>gi|255642185|gb|ACU21357.1| unknown [Glycine max]
          Length = 136

 Score = 36.2 bits (82), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 35/61 (57%)

Query: 3   RVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQ 62
           RVC  T K     NKVS +N+KT++    NL    +  +  ++  +LR+S  AL+++E+ 
Sbjct: 61  RVCPFTGKKSNRANKVSFSNHKTKKLQFVNLQYKRIWWEAGKRYVKLRLSTKALKTIEKN 120

Query: 63  G 63
           G
Sbjct: 121 G 121


>gi|121533684|ref|ZP_01665511.1| ribosomal protein L28 [Thermosinus carboxydivorans Nor1]
 gi|121307675|gb|EAX48590.1| ribosomal protein L28 [Thermosinus carboxydivorans Nor1]
          Length = 63

 Score = 36.2 bits (82), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 26/41 (63%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISD 41
          M+ VCE+  K   SG  VSH+N KT+R + PN+ R+  + +
Sbjct: 1  MANVCEICGKGERSGFNVSHSNLKTKRTWKPNIQRVKAVVN 41


>gi|58267722|ref|XP_571017.1| hypothetical protein [Cryptococcus neoformans var. neoformans
           JEC21]
 gi|134112281|ref|XP_775116.1| hypothetical protein CNBE3900 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|50257768|gb|EAL20469.1| hypothetical protein CNBE3900 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|57227251|gb|AAW43710.1| expressed protein [Cryptococcus neoformans var. neoformans JEC21]
          Length = 213

 Score = 36.2 bits (82), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 23/95 (24%), Positives = 44/95 (46%), Gaps = 14/95 (14%)

Query: 14  SGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCA--------------LRSV 59
           SGN    +  KT+R F PNL R+     ++     +  +K                +R V
Sbjct: 76  SGNNKPKSLQKTKRTFQPNLTRVDWPVTVLGGPVPIDRTKEQSLPKLEGILMQVRKIRDV 135

Query: 60  ERQGGLDRFLSNSKKENLSARMRTLRSQILKKMSE 94
           E+ GG++  L + + ++L+    +LR+Q+ + + E
Sbjct: 136 EKAGGIEGLLLSRRSKDLTPYGASLRAQLFESLHE 170


>gi|297823141|ref|XP_002879453.1| 50S ribosomal protein L28, chloroplast [Arabidopsis lyrata subsp.
           lyrata]
 gi|297325292|gb|EFH55712.1| 50S ribosomal protein L28, chloroplast [Arabidopsis lyrata subsp.
           lyrata]
          Length = 143

 Score = 36.2 bits (82), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 37/64 (57%), Gaps = 1/64 (1%)

Query: 3   RVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQ 62
           R+C  T K     NKVS +N+KT++    NL    +  +  ++  +LR+S  AL+++E+ 
Sbjct: 68  RICPFTGKKANRANKVSFSNHKTKKLQFVNLQYKRVWWEAGKRFVKLRLSTKALKTIEKN 127

Query: 63  GGLD 66
            GLD
Sbjct: 128 -GLD 130


>gi|329945915|ref|ZP_08293602.1| ribosomal protein L28 [Actinomyces sp. oral taxon 170 str. F0386]
 gi|328528363|gb|EGF55341.1| ribosomal protein L28 [Actinomyces sp. oral taxon 170 str. F0386]
          Length = 82

 Score = 36.2 bits (82), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 35/63 (55%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+  C++T    + G  VSH++ +T RR+ PNL R       + +  +L +S   +R+++
Sbjct: 4  MTTYCQVTGTRPVFGRSVSHSHKRTPRRWNPNLQRKRYWVPSLGRTVRLTVSAKGIRTID 63

Query: 61 RQG 63
          + G
Sbjct: 64 KLG 66


>gi|257063711|ref|YP_003143383.1| LSU ribosomal protein L28P [Slackia heliotrinireducens DSM 20476]
 gi|256791364|gb|ACV22034.1| LSU ribosomal protein L28P [Slackia heliotrinireducens DSM 20476]
          Length = 62

 Score = 36.2 bits (82), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 28/41 (68%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISD 41
          MS+VCE+  K  ++G  +SH++  + R F PN+ +IT++ +
Sbjct: 1  MSKVCEICGKHPVAGRSISHSHRVSNRVFRPNIQKITVLEN 41


>gi|237739403|ref|ZP_04569884.1| LSU ribosomal protein L28P [Fusobacterium sp. 2_1_31]
 gi|262066263|ref|ZP_06025875.1| 50S ribosomal protein L28 [Fusobacterium periodonticum ATCC
          33693]
 gi|294783599|ref|ZP_06748923.1| 50S ribosomal protein L28 [Fusobacterium sp. 1_1_41FAA]
 gi|229423011|gb|EEO38058.1| LSU ribosomal protein L28P [Fusobacterium sp. 2_1_31]
 gi|291380033|gb|EFE87551.1| 50S ribosomal protein L28 [Fusobacterium periodonticum ATCC
          33693]
 gi|294480477|gb|EFG28254.1| 50S ribosomal protein L28 [Fusobacterium sp. 1_1_41FAA]
          Length = 85

 Score = 36.2 bits (82), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 24/34 (70%)

Query: 5  CELTKKTVMSGNKVSHANNKTRRRFLPNLCRITL 38
          CE+T   ++SGN++SH++  TRR + PNL   TL
Sbjct: 4  CEITGTGLISGNQISHSHRLTRRVWKPNLQVTTL 37


>gi|15895010|ref|NP_348359.1| 50S ribosomal protein L28 [Clostridium acetobutylicum ATCC 824]
 gi|20139607|sp|Q97IB7|RL28_CLOAB RecName: Full=50S ribosomal protein L28
 gi|15024700|gb|AAK79699.1|AE007682_9 Ribosomal protein L28 [Clostridium acetobutylicum ATCC 824]
 gi|325509147|gb|ADZ20783.1| Ribosomal protein L28 [Clostridium acetobutylicum EA 2018]
          Length = 63

 Score = 36.2 bits (82), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 29/41 (70%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISD 41
          MSR C++  K +++G + SH++ +++R +LPN+ +I  + D
Sbjct: 1  MSRKCDICGKGLVAGVQYSHSHRQSKRTWLPNIRKIKAVVD 41


>gi|160903264|ref|YP_001568845.1| ribosomal protein L28 [Petrotoga mobilis SJ95]
 gi|189029448|sp|A9BGU1|RL28_PETMO RecName: Full=50S ribosomal protein L28
 gi|160360908|gb|ABX32522.1| ribosomal protein L28 [Petrotoga mobilis SJ95]
          Length = 63

 Score = 36.2 bits (82), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 27/41 (65%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISD 41
          M+R CE+  K+  +GN V+ +   TRR + PNL +I +++D
Sbjct: 1  MARKCEICGKSPATGNTVAKSKVTTRRVWKPNLQKIRVVTD 41


>gi|307326225|ref|ZP_07605422.1| ribosomal protein L28 [Streptomyces violaceusniger Tu 4113]
 gi|306888168|gb|EFN19157.1| ribosomal protein L28 [Streptomyces violaceusniger Tu 4113]
          Length = 78

 Score = 36.2 bits (82), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 23/33 (69%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNL 33
          MS  C+LT +    G+ +SH++ +T+RRF PN+
Sbjct: 1  MSAHCQLTGRQPGFGHHISHSHRRTKRRFDPNI 33


>gi|83814500|ref|YP_444179.1| ribosomal protein L28 [Salinibacter ruber DSM 13855]
 gi|123529898|sp|Q2S6K2|RL28_SALRD RecName: Full=50S ribosomal protein L28
 gi|83755894|gb|ABC44007.1| ribosomal protein L28 [Salinibacter ruber DSM 13855]
          Length = 78

 Score = 36.2 bits (82), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 36/63 (57%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+R  ++T +  ++GN VS +N KT RRF  NL          ++  +L++S   L+++ 
Sbjct: 1  MARKDDVTGEGPVTGNSVSDSNQKTNRRFKRNLHEKRFYIPSEDRHVKLKVSSKTLKTIN 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|42526502|ref|NP_971600.1| ribosomal protein L28 [Treponema denticola ATCC 35405]
 gi|67461474|sp|Q73P09|RL28_TREDE RecName: Full=50S ribosomal protein L28
 gi|41816695|gb|AAS11481.1| ribosomal protein L28 [Treponema denticola ATCC 35405]
 gi|325473443|gb|EGC76638.1| 50S ribosomal protein L28 [Treponema denticola F0402]
          Length = 63

 Score = 36.2 bits (82), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 22/33 (66%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNL 33
          MSRVCE+  K  +SGN VS +   T+R + PNL
Sbjct: 1  MSRVCEICGKGSLSGNSVSKSKIHTKRVWKPNL 33


>gi|297583994|ref|YP_003699774.1| 50S ribosomal protein L28 [Bacillus selenitireducens MLS10]
 gi|297142451|gb|ADH99208.1| ribosomal protein L28 [Bacillus selenitireducens MLS10]
          Length = 62

 Score = 36.2 bits (82), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 27/41 (65%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISD 41
          M+R C +T +   +GNK SHA N T+RR+  N+ ++ ++ D
Sbjct: 1  MARKCVITGRGPKTGNKRSHALNATKRRWGANVQKVRIMVD 41


>gi|327399092|ref|YP_004339961.1| 50S ribosomal protein L28 [Hippea maritima DSM 10411]
 gi|327181721|gb|AEA33902.1| 50S ribosomal protein L28 [Hippea maritima DSM 10411]
          Length = 64

 Score = 36.2 bits (82), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 27/41 (65%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISD 41
          M+R CE+  K    G KVSH++ +T++++ PN+ R+ +  D
Sbjct: 1  MARRCEICGKRAQVGYKVSHSHIRTKKKWNPNIQRVKVYVD 41


>gi|311742952|ref|ZP_07716760.1| 50S ribosomal protein L28 [Aeromicrobium marinum DSM 15272]
 gi|311313632|gb|EFQ83541.1| 50S ribosomal protein L28 [Aeromicrobium marinum DSM 15272]
          Length = 64

 Score = 36.2 bits (82), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 30/49 (61%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQL 49
          ++ VC++  K    G+ VSH++ +T+RRF PN+ R+  + +   Q+  +
Sbjct: 4  VAAVCDVCSKGPGFGHNVSHSHRRTKRRFDPNIQRVRAVVNGTPQRVNV 52


>gi|325003295|ref|ZP_08124407.1| 50S ribosomal protein L28 [Pseudonocardia sp. P1]
          Length = 78

 Score = 36.2 bits (82), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 39/65 (60%), Gaps = 4/65 (6%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNL-CRITLISDIMEQKY-QLRISKCALRS 58
          MSR C+LT +    G  VSH++ +T RR+ PN+  +    +D  E ++ +L +S   +++
Sbjct: 1  MSRRCDLTGREPSFGKAVSHSHRRTSRRWDPNVQSKRYWFAD--EGRWVRLSLSAKGIKT 58

Query: 59 VERQG 63
          V+R G
Sbjct: 59 VDRIG 63


>gi|193216434|ref|YP_001999676.1| ribosomal protein L28 [Mycoplasma arthritidis 158L3-1]
 gi|226732839|sp|B3PLS0|RL28_MYCA5 RecName: Full=50S ribosomal protein L28
 gi|193001757|gb|ACF06972.1| ribosomal protein L28 [Mycoplasma arthritidis 158L3-1]
          Length = 65

 Score = 36.2 bits (82), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 37/58 (63%), Gaps = 1/58 (1%)

Query: 6  ELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQG 63
          +LT +  +SGNK SHA N T+R F  NL ++T++ +   +K  LR++    R++++ G
Sbjct: 6  QLTGQKALSGNKRSHALNTTKRTFDLNLQKVTVLQENGTKKT-LRVTAKNARTLKKLG 62


>gi|317969928|ref|ZP_07971318.1| 50S ribosomal protein L28 [Synechococcus sp. CB0205]
          Length = 78

 Score = 36.2 bits (82), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 38/63 (60%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC+LT K   +G  VSH++ +T++    NL    L      +  +LR+S  AL++++
Sbjct: 1  MSRVCQLTGKRANNGMAVSHSHIRTKKLQQVNLQERRLWWAEGNRYVKLRVSTRALKTIQ 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|123966217|ref|YP_001011298.1| 50S ribosomal protein L28 [Prochlorococcus marinus str. MIT 9515]
 gi|166226601|sp|A2BWN0|RL28_PROM5 RecName: Full=50S ribosomal protein L28
 gi|123200583|gb|ABM72191.1| 50S ribosomal protein L28 [Prochlorococcus marinus str. MIT 9515]
          Length = 78

 Score = 36.2 bits (82), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 40/67 (59%), Gaps = 1/67 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVCELT     +G  VSH++ +T++    NL +  L     ++   ++IS  AL+S++
Sbjct: 1  MSRVCELTGARANNGMAVSHSHIRTKKLQQVNLQKRRLWWQEGKKWINIKISTKALKSIQ 60

Query: 61 RQGGLDR 67
          +  GLD+
Sbjct: 61 KV-GLDK 66


>gi|120403145|ref|YP_952974.1| 50S ribosomal protein L28 [Mycobacterium vanbaalenii PYR-1]
 gi|119955963|gb|ABM12968.1| LSU ribosomal protein L28P [Mycobacterium vanbaalenii PYR-1]
          Length = 64

 Score = 36.2 bits (82), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 16/58 (27%), Positives = 32/58 (55%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS 58
          M+ VCE+  K    G  VSH++ +T RR+ PN+  +  ++     K+++ +    L++
Sbjct: 1  MAAVCEICGKGPGFGKSVSHSHRRTSRRWDPNIQSVRAVAAPGGNKHRVNVCTSCLKA 58


>gi|326774850|ref|ZP_08234115.1| ribosomal protein L28 [Streptomyces cf. griseus XylebKG-1]
 gi|326655183|gb|EGE40029.1| ribosomal protein L28 [Streptomyces cf. griseus XylebKG-1]
          Length = 78

 Score = 35.8 bits (81), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 33/63 (52%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS  C+L       GN +SH++ +T RRF PN+ R         +  +L +S  A+R+V+
Sbjct: 1  MSAHCQLAGSKPGFGNNISHSHRRTSRRFDPNVQRKRYWLPGEGRSVRLTLSARAIRTVD 60

Query: 61 RQG 63
            G
Sbjct: 61 SIG 63


>gi|297571125|ref|YP_003696899.1| ribosomal protein L28 [Arcanobacterium haemolyticum DSM 20595]
 gi|296931472|gb|ADH92280.1| ribosomal protein L28 [Arcanobacterium haemolyticum DSM 20595]
          Length = 77

 Score = 35.8 bits (81), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 17/63 (26%), Positives = 34/63 (53%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+  C++T +    G  VSH++ +T RRF PNL         +++   L +S   +++++
Sbjct: 1  MATYCQVTGRKPQFGKTVSHSHKRTSRRFNPNLQTKKYYVPSLKRTISLTVSAKGIKTID 60

Query: 61 RQG 63
           +G
Sbjct: 61 SKG 63


>gi|284052089|ref|ZP_06382299.1| 50S ribosomal protein L28 [Arthrospira platensis str. Paraca]
 gi|291569882|dbj|BAI92154.1| 50S ribosomal protein L28 [Arthrospira platensis NIES-39]
          Length = 78

 Score = 35.8 bits (81), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 38/63 (60%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC+LT K   +G  VSH++ ++ +    NL    +     ++  +LR+S  A++++E
Sbjct: 1  MSRVCQLTGKRANNGMAVSHSHRRSHKLQQANLQWKRIWWPQGKRWVRLRLSTKAIKTIE 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|87302721|ref|ZP_01085532.1| 50S ribosomal protein L28 [Synechococcus sp. WH 5701]
 gi|87282604|gb|EAQ74562.1| 50S ribosomal protein L28 [Synechococcus sp. WH 5701]
          Length = 78

 Score = 35.8 bits (81), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 40/68 (58%), Gaps = 1/68 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC+LT K   +G  VSH++ +T++    NL    L      +  +LR++   LR+++
Sbjct: 1  MSRVCQLTGKRANNGMAVSHSHVRTKKLQQVNLQERRLWWAEGNRWVKLRVATRTLRTIQ 60

Query: 61 RQGGLDRF 68
          ++ GLD +
Sbjct: 61 KK-GLDAY 67


>gi|254449094|ref|ZP_05062546.1| ribosomal protein L28 [gamma proteobacterium HTCC5015]
 gi|198261286|gb|EDY85579.1| ribosomal protein L28 [gamma proteobacterium HTCC5015]
          Length = 61

 Score = 35.8 bits (81), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 30/46 (65%)

Query: 18 VSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQG 63
          +SH+N K++RRFLPNL       +   +  +LRIS  A+R ++++G
Sbjct: 1  MSHSNIKSKRRFLPNLQTHRFWVESENRFVKLRISTKAMRIIDKKG 46


>gi|332671614|ref|YP_004454622.1| 50S ribosomal protein L28 [Cellulomonas fimi ATCC 484]
 gi|332340652|gb|AEE47235.1| ribosomal protein L28 [Cellulomonas fimi ATCC 484]
          Length = 79

 Score = 35.8 bits (81), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 17/63 (26%), Positives = 34/63 (53%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS  C++       G+ VSH++ +T+RR+ PN+ R T     + ++    +S   + +++
Sbjct: 1  MSARCQVLGTVPGFGHAVSHSHRRTKRRWNPNVQRRTFFVPSLRRRVTFTVSARGITTID 60

Query: 61 RQG 63
          R G
Sbjct: 61 RLG 63


>gi|224476334|ref|YP_002633940.1| 50S ribosomal protein L28 [Staphylococcus carnosus subsp.
          carnosus TM300]
 gi|254801376|sp|B9DPK8|RL28_STACT RecName: Full=50S ribosomal protein L28
 gi|222420941|emb|CAL27755.1| 50S ribosomal protein L28 [Staphylococcus carnosus subsp.
          carnosus TM300]
          Length = 62

 Score = 35.8 bits (81), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 35/58 (60%), Gaps = 2/58 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS 58
          M + C +T +   +GN+ SHA N T+RR+  NL ++ ++ D   +K  + +S  AL+S
Sbjct: 1  MGKQCYVTGRKASTGNRRSHALNSTKRRWNANLQKVRILVDGKPKK--VWVSARALKS 56


>gi|239978057|ref|ZP_04700581.1| putative 50S ribosomal protein L28 [Streptomyces albus J1074]
 gi|291449958|ref|ZP_06589348.1| 50S ribosomal protein L28 [Streptomyces albus J1074]
 gi|291352907|gb|EFE79809.1| 50S ribosomal protein L28 [Streptomyces albus J1074]
          Length = 78

 Score = 35.8 bits (81), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 16/35 (45%), Positives = 22/35 (62%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCR 35
          MS  C+LT      GN +SH++ +T RRF PN+ R
Sbjct: 1  MSAHCQLTGAKPGFGNSISHSHRRTSRRFDPNIQR 35


>gi|118443905|ref|YP_878308.1| 50S ribosomal protein L28 [Clostridium novyi NT]
 gi|166226566|sp|A0Q106|RL28_CLONN RecName: Full=50S ribosomal protein L28
 gi|118134361|gb|ABK61405.1| ribosomal protein L28 [Clostridium novyi NT]
          Length = 63

 Score = 35.8 bits (81), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 25/33 (75%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNL 33
          M++ CE+  K V+SG + SH++ +++RR+ PN+
Sbjct: 1  MAKRCEVCGKGVVSGVQYSHSHRQSKRRWAPNI 33


>gi|269114781|ref|YP_003302544.1| 50S ribosomal protein L28 [Mycoplasma hominis]
 gi|268322406|emb|CAX37141.1| 50S ribosomal protein L28 [Mycoplasma hominis ATCC 23114]
          Length = 65

 Score = 35.8 bits (81), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 37/58 (63%), Gaps = 1/58 (1%)

Query: 6  ELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQG 63
          +LT +  +SGNK SHA N  +R F  NL ++T++++   +K  +R++    R++++ G
Sbjct: 6  QLTGQKALSGNKRSHALNTAKRTFDLNLQKVTVLTETGSKK-TVRVTAKNARTLKKYG 62


>gi|203284266|ref|YP_002222006.1| 50S ribosomal protein L28 [Borrelia duttonii Ly]
 gi|203287803|ref|YP_002222818.1| 50S ribosomal protein L28 [Borrelia recurrentis A1]
 gi|226738036|sp|B5RLT4|RL28_BORDL RecName: Full=50S ribosomal protein L28
 gi|226738039|sp|B5RRG3|RL28_BORRA RecName: Full=50S ribosomal protein L28
 gi|201083709|gb|ACH93300.1| 50S ribosomal protein L28 [Borrelia duttonii Ly]
 gi|201085023|gb|ACH94597.1| 50S ribosomal protein L28 [Borrelia recurrentis A1]
          Length = 92

 Score = 35.8 bits (81), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 27/88 (30%), Positives = 38/88 (43%), Gaps = 14/88 (15%)

Query: 1  MSRVCELTKKTVMSGNKVS-------------HANNKTRRRFLPNLCRITLISDIMEQKY 47
          M R CE+T K  M GN V              H   KT+R F  NL         + +  
Sbjct: 1  MGRECEITGKRTMFGNNVPRKGLAKKKGGAGQHIGVKTKRTFKVNLINKKFFIPELGKNV 60

Query: 48 QLRISKCALRSVERQGGLDRFLSNSKKE 75
           ++IS   LRS+ +  GL+ FL  + K+
Sbjct: 61 SIKISASTLRSISKV-GLNVFLKKNNKK 87


>gi|253682003|ref|ZP_04862800.1| ribosomal protein L28 [Clostridium botulinum D str. 1873]
 gi|331269676|ref|YP_004396168.1| 50S ribosomal protein L28 [Clostridium botulinum BKT015925]
 gi|253561715|gb|EES91167.1| ribosomal protein L28 [Clostridium botulinum D str. 1873]
 gi|329126226|gb|AEB76171.1| ribosomal protein L28 [Clostridium botulinum BKT015925]
          Length = 63

 Score = 35.8 bits (81), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 32/49 (65%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQL 49
          M++ CE+  K V+SG + SH++ +++RR+ PN+  I  + + + +K  +
Sbjct: 1  MAKRCEVCGKGVVSGVQYSHSHRQSKRRWAPNIKNIRAVVNGVPKKISV 49


>gi|238019124|ref|ZP_04599550.1| hypothetical protein VEIDISOL_00986 [Veillonella dispar ATCC
          17748]
 gi|269798118|ref|YP_003312018.1| ribosomal protein L28 [Veillonella parvula DSM 2008]
 gi|237863823|gb|EEP65113.1| hypothetical protein VEIDISOL_00986 [Veillonella dispar ATCC
          17748]
 gi|269094747|gb|ACZ24738.1| ribosomal protein L28 [Veillonella parvula DSM 2008]
          Length = 62

 Score = 35.8 bits (81), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 30/49 (61%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQL 49
          M+ +CE+  K+  SG  VSH++ +TR+ + PN+ R+  + D   +K  +
Sbjct: 1  MANLCEVCGKSTSSGMNVSHSHIRTRKTWKPNIQRVRAVVDGATKKVNV 49


>gi|294791989|ref|ZP_06757137.1| ribosomal protein L28 [Veillonella sp. 6_1_27]
 gi|294793853|ref|ZP_06758990.1| ribosomal protein L28 [Veillonella sp. 3_1_44]
 gi|313893258|ref|ZP_07826833.1| ribosomal protein L28 [Veillonella sp. oral taxon 158 str. F0412]
 gi|294455423|gb|EFG23795.1| ribosomal protein L28 [Veillonella sp. 3_1_44]
 gi|294457219|gb|EFG25581.1| ribosomal protein L28 [Veillonella sp. 6_1_27]
 gi|313442154|gb|EFR60571.1| ribosomal protein L28 [Veillonella sp. oral taxon 158 str. F0412]
          Length = 62

 Score = 35.8 bits (81), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 30/49 (61%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQL 49
          M+ +CE+  K+  SG  VSH++ +TR+ + PN+ R+  + D   +K  +
Sbjct: 1  MANLCEVCGKSTSSGMNVSHSHIRTRKTWKPNIQRVRAVVDGATKKVNV 49


>gi|254519233|ref|ZP_05131289.1| ribosomal protein L28 [Clostridium sp. 7_2_43FAA]
 gi|226912982|gb|EEH98183.1| ribosomal protein L28 [Clostridium sp. 7_2_43FAA]
          Length = 63

 Score = 35.8 bits (81), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 26/36 (72%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRI 36
          M+R CE+  K V+SG + SH++ +++R + PN+ R+
Sbjct: 1  MARRCEVCNKGVVSGTQYSHSHRQSKRTWAPNIKRV 36


>gi|15672174|ref|NP_266348.1| 50S ribosomal protein L28 [Lactococcus lactis subsp. lactis
          Il1403]
 gi|116511022|ref|YP_808238.1| 50S ribosomal protein L28 [Lactococcus lactis subsp. cremoris
          SK11]
 gi|125623081|ref|YP_001031564.1| 50S ribosomal protein L28 [Lactococcus lactis subsp. cremoris
          MG1363]
 gi|281490681|ref|YP_003352661.1| 50S ribosomal protein L28P [Lactococcus lactis subsp. lactis
          KF147]
 gi|14195117|sp|Q9CJ14|RL28_LACLA RecName: Full=50S ribosomal protein L28
 gi|122940401|sp|Q032Q6|RL28_LACLS RecName: Full=50S ribosomal protein L28
 gi|166226583|sp|A2RHS3|RL28_LACLM RecName: Full=50S ribosomal protein L28
 gi|12723045|gb|AAK04290.1|AE006256_12 50S ribosomal protein L28 [Lactococcus lactis subsp. lactis
          Il1403]
 gi|116106676|gb|ABJ71816.1| LSU ribosomal protein L28P [Lactococcus lactis subsp. cremoris
          SK11]
 gi|124491889|emb|CAL96810.1| 50S ribosomal protein L28 [Lactococcus lactis subsp. cremoris
          MG1363]
 gi|281374450|gb|ADA63971.1| LSU ribosomal protein L28P [Lactococcus lactis subsp. lactis
          KF147]
 gi|300069829|gb|ADJ59229.1| 50S ribosomal protein L28 [Lactococcus lactis subsp. cremoris
          NZ9000]
 gi|326405768|gb|ADZ62839.1| 50S ribosomal protein L28P [Lactococcus lactis subsp. lactis
          CV56]
          Length = 64

 Score = 35.8 bits (81), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 26/41 (63%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISD 41
          MS+ C  T +  +S N  SHA N+T+R   PNL ++T++ +
Sbjct: 1  MSKECYFTGRKTVSSNNRSHAMNQTKRVVKPNLQKVTILEN 41


>gi|313665374|ref|YP_004047245.1| ribosomal protein L28 [Mycoplasma leachii PG50]
 gi|312949805|gb|ADR24401.1| ribosomal protein L28 [Mycoplasma leachii PG50]
          Length = 65

 Score = 35.8 bits (81), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 38/62 (61%), Gaps = 1/62 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+R   LT K+ +SG   SHA N T+R++  NL ++ +I D     + +++S   LR+++
Sbjct: 1  MARRDALTGKSALSGQSRSHALNATKRKWNLNLQKVRVI-DENGSVFNIKVSARTLRTLK 59

Query: 61 RQ 62
          +Q
Sbjct: 60 KQ 61


>gi|282896999|ref|ZP_06305001.1| Ribosomal protein L28 [Raphidiopsis brookii D9]
 gi|282900464|ref|ZP_06308413.1| Ribosomal protein L28 [Cylindrospermopsis raciborskii CS-505]
 gi|281194657|gb|EFA69605.1| Ribosomal protein L28 [Cylindrospermopsis raciborskii CS-505]
 gi|281197651|gb|EFA72545.1| Ribosomal protein L28 [Raphidiopsis brookii D9]
          Length = 78

 Score = 35.8 bits (81), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 36/63 (57%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT K   +   VSH++ +TRR   PNL    +      +  +L++S  A+++++
Sbjct: 1  MSRRCELTGKKANNAMSVSHSHRRTRRLQQPNLQTKRVWWPAGNRWVKLKLSTKAIKTLD 60

Query: 61 RQG 63
           +G
Sbjct: 61 TKG 63


>gi|169830811|ref|YP_001716793.1| 50S ribosomal protein L28 [Candidatus Desulforudis audaxviator
          MP104C]
 gi|226738067|sp|B1I2D5|RL28_DESAP RecName: Full=50S ribosomal protein L28
 gi|169637655|gb|ACA59161.1| ribosomal protein L28 [Candidatus Desulforudis audaxviator
          MP104C]
          Length = 63

 Score = 35.8 bits (81), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 28/41 (68%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISD 41
          M++ C+L  K V+ G K+SH++ +T+R + PNL R+  + D
Sbjct: 1  MAKKCDLCGKGVVVGMKLSHSHIRTKRTWEPNLQRVRALVD 41


>gi|213966101|ref|ZP_03394289.1| conserved domain protein [Corynebacterium amycolatum SK46]
 gi|213951299|gb|EEB62693.1| conserved domain protein [Corynebacterium amycolatum SK46]
          Length = 135

 Score = 35.8 bits (81), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 34/63 (53%)

Query: 1   MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
           MS +C++T +    G  VSH++ +T RR+ PN+ R         +   L +S   L++++
Sbjct: 58  MSAICQVTGRKPSFGKTVSHSHRRTSRRWNPNVQRKKFYLASEGRHITLNVSPKGLKTID 117

Query: 61  RQG 63
           + G
Sbjct: 118 KYG 120


>gi|291533320|emb|CBL06433.1| LSU ribosomal protein L28P [Megamonas hypermegale ART12/1]
          Length = 62

 Score = 35.4 bits (80), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 26/41 (63%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISD 41
          M+ VCE+  K   +G  VSH++ KT+R + PN+ R+  + D
Sbjct: 1  MANVCEICAKGERAGMNVSHSHLKTKRTWKPNIQRVRAVVD 41


>gi|318041480|ref|ZP_07973436.1| 50S ribosomal protein L28 [Synechococcus sp. CB0101]
          Length = 78

 Score = 35.4 bits (80), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 38/63 (60%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC+LT K   +G  VSH++ +T++    NL    L      +  +LR+S  AL++++
Sbjct: 1  MSRVCQLTGKRANNGMAVSHSHVRTKKLQQVNLQERRLWWAEGNRFVKLRVSTRALKTIQ 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|325856873|ref|ZP_08172371.1| ribosomal protein L28 [Prevotella denticola CRIS 18C-A]
 gi|327314533|ref|YP_004329970.1| 50S ribosomal protein L28 [Prevotella denticola F0289]
 gi|325483246|gb|EGC86223.1| ribosomal protein L28 [Prevotella denticola CRIS 18C-A]
 gi|326945968|gb|AEA21853.1| ribosomal protein L28 [Prevotella denticola F0289]
          Length = 87

 Score = 35.4 bits (80), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 32/63 (50%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS++C++T K    G  VSH+ ++T+R F  NL              +L+IS   LR + 
Sbjct: 1  MSKICQITGKKAQIGCNVSHSKHRTKRSFDVNLFSKKFYYVEEGCWIELKISAAGLRLIN 60

Query: 61 RQG 63
          + G
Sbjct: 61 KMG 63


>gi|288924981|ref|ZP_06418917.1| 50S ribosomal protein L28 [Prevotella buccae D17]
 gi|315608015|ref|ZP_07883008.1| 50S ribosomal protein L28 [Prevotella buccae ATCC 33574]
 gi|288338171|gb|EFC76521.1| 50S ribosomal protein L28 [Prevotella buccae D17]
 gi|315250484|gb|EFU30480.1| 50S ribosomal protein L28 [Prevotella buccae ATCC 33574]
          Length = 94

 Score = 35.4 bits (80), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 34/74 (45%), Gaps = 22/74 (29%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNL-----------CRITLISDIMEQKYQL 49
          MS+VC++T K    G  VSH+ ++T+R F  NL           C IT           L
Sbjct: 1  MSKVCQITGKKAQIGCNVSHSKHRTKRSFDVNLFSKKFFWVEENCWIT-----------L 49

Query: 50 RISKCALRSVERQG 63
          +IS   LR + + G
Sbjct: 50 KISAAGLRLINKIG 63


>gi|169627438|ref|YP_001701087.1| 50S ribosomal protein L28-2 [Mycobacterium abscessus ATCC 19977]
 gi|169239405|emb|CAM60433.1| 50S ribosomal protein L28-2 [Mycobacterium abscessus]
          Length = 82

 Score = 35.4 bits (80), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 39/63 (61%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          +S  CE+T ++   GN VSH++ +TRRR+ PN+   T      +++ +LR+S   ++ ++
Sbjct: 5  LSAHCEVTGRSPGFGNAVSHSHRRTRRRWSPNIQLKTYYLPSEDRRIKLRVSTKGIKVID 64

Query: 61 RQG 63
          R G
Sbjct: 65 RDG 67


>gi|145224793|ref|YP_001135471.1| 50S ribosomal protein L28 [Mycobacterium gilvum PYR-GCK]
 gi|315445123|ref|YP_004078002.1| 50S ribosomal protein L28P [Mycobacterium sp. Spyr1]
 gi|145217279|gb|ABP46683.1| LSU ribosomal protein L28P [Mycobacterium gilvum PYR-GCK]
 gi|315263426|gb|ADU00168.1| LSU ribosomal protein L28P [Mycobacterium sp. Spyr1]
          Length = 64

 Score = 35.4 bits (80), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 31/58 (53%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS 58
          M+ VCE+  K    G  VSH++ +T RR+ PN+  +  +S     K ++ +    L++
Sbjct: 1  MAAVCEICGKGPGFGKSVSHSHRRTSRRWNPNIQSVRAVSSPGGNKQRVNVCTSCLKA 58


>gi|289428038|ref|ZP_06429742.1| ribosomal protein L28 [Propionibacterium acnes J165]
 gi|289158921|gb|EFD07121.1| ribosomal protein L28 [Propionibacterium acnes J165]
 gi|313808366|gb|EFS46833.1| ribosomal protein L28 [Propionibacterium acnes HL087PA2]
 gi|313818213|gb|EFS55927.1| ribosomal protein L28 [Propionibacterium acnes HL046PA2]
 gi|313821128|gb|EFS58842.1| ribosomal protein L28 [Propionibacterium acnes HL036PA1]
 gi|313824051|gb|EFS61765.1| ribosomal protein L28 [Propionibacterium acnes HL036PA2]
 gi|313827203|gb|EFS64917.1| ribosomal protein L28 [Propionibacterium acnes HL063PA1]
 gi|314926906|gb|EFS90737.1| ribosomal protein L28 [Propionibacterium acnes HL036PA3]
 gi|314961918|gb|EFT06019.1| ribosomal protein L28 [Propionibacterium acnes HL002PA2]
 gi|314979538|gb|EFT23632.1| ribosomal protein L28 [Propionibacterium acnes HL072PA2]
 gi|314988381|gb|EFT32472.1| ribosomal protein L28 [Propionibacterium acnes HL005PA2]
 gi|314990277|gb|EFT34368.1| ribosomal protein L28 [Propionibacterium acnes HL005PA3]
 gi|315083856|gb|EFT55832.1| ribosomal protein L28 [Propionibacterium acnes HL027PA2]
 gi|315087265|gb|EFT59241.1| ribosomal protein L28 [Propionibacterium acnes HL002PA3]
 gi|315089683|gb|EFT61659.1| ribosomal protein L28 [Propionibacterium acnes HL072PA1]
 gi|327326655|gb|EGE68443.1| ribosomal protein L28 [Propionibacterium acnes HL096PA3]
 gi|327449527|gb|EGE96181.1| ribosomal protein L28 [Propionibacterium acnes HL013PA2]
 gi|328757436|gb|EGF71052.1| ribosomal protein L28 [Propionibacterium acnes HL020PA1]
 gi|332676542|gb|AEE73358.1| 50S ribosomal protein L28 [Propionibacterium acnes 266]
          Length = 78

 Score = 35.4 bits (80), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 34/63 (53%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR C++       GN VSH+    +RR+ PN+ +       + +K  L ++  A++ ++
Sbjct: 1  MSRRCQVRGTKPEFGNNVSHSQRHIKRRWNPNIQKKRYWVPSLGRKVTLTLTPKAIKEID 60

Query: 61 RQG 63
          R+G
Sbjct: 61 RRG 63


>gi|288801234|ref|ZP_06406689.1| 50S ribosomal protein L28 [Prevotella sp. oral taxon 299 str.
          F0039]
 gi|288331845|gb|EFC70328.1| 50S ribosomal protein L28 [Prevotella sp. oral taxon 299 str.
          F0039]
          Length = 87

 Score = 35.4 bits (80), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 35/69 (50%), Gaps = 1/69 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS++C++T K    G  VSH+ ++T+R F  NL +             L+IS   LR + 
Sbjct: 1  MSKICQITGKKAQIGCNVSHSKHRTKRSFDVNLFKKKFYYVEEACWISLKISAAGLRLIN 60

Query: 61 RQGGLDRFL 69
          +  GLD  L
Sbjct: 61 KV-GLDAAL 68


>gi|304373304|ref|YP_003856513.1| 50S ribosomal protein L28 [Mycoplasma hyorhinis HUB-1]
 gi|304309495|gb|ADM21975.1| 50S ribosomal protein L28 [Mycoplasma hyorhinis HUB-1]
 gi|330723822|gb|AEC46192.1| 50S ribosomal protein L28 [Mycoplasma hyorhinis MCLD]
          Length = 63

 Score = 35.4 bits (80), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 38/63 (60%), Gaps = 2/63 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+R  ++T K  +SGN  SHA N T+R+F  NL ++  + ++   K  L++S    +++ 
Sbjct: 1  MARKDDITGKGPLSGNNRSHALNATKRKFNLNLQKV--VVEVNGVKQTLKVSAKTKKTLR 58

Query: 61 RQG 63
          ++G
Sbjct: 59 KKG 61


>gi|320165557|gb|EFW42456.1| conserved hypothetical protein [Capsaspora owczarzaki ATCC 30864]
          Length = 615

 Score = 35.0 bits (79), Expect = 3.1,   Method: Composition-based stats.
 Identities = 20/63 (31%), Positives = 29/63 (46%)

Query: 33  LCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFLSNSKKENLSARMRTLRSQILKKM 92
           +CR+TL   I+    Q R+S    R+      LD  L NS K N S R+   R  +  + 
Sbjct: 196 ICRLTLRGYIIPAPLQRRLSDLLDRNTAVTQVLDEILDNSCKRNFSTRLSAFRRSVFLRR 255

Query: 93  SEK 95
            E+
Sbjct: 256 GEE 258


>gi|33862967|ref|NP_894527.1| 50S ribosomal protein L28 [Prochlorococcus marinus str. MIT 9313]
 gi|124023228|ref|YP_001017535.1| 50S ribosomal protein L28 [Prochlorococcus marinus str. MIT 9303]
 gi|67461502|sp|Q7V7P3|RL28_PROMM RecName: Full=50S ribosomal protein L28
 gi|166226600|sp|A2C9W0|RL28_PROM3 RecName: Full=50S ribosomal protein L28
 gi|33634884|emb|CAE20870.1| 50S ribosomal protein L28 [Prochlorococcus marinus str. MIT 9313]
 gi|123963514|gb|ABM78270.1| 50S ribosomal protein L28 [Prochlorococcus marinus str. MIT 9303]
          Length = 78

 Score = 35.0 bits (79), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 38/63 (60%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC+LT     +G  VSH++ +T++    NL +  L      +  +LR+S  AL++++
Sbjct: 1  MSRVCQLTGTRANNGMAVSHSHIRTKKLQQANLQQRRLWWAEGNRWLKLRVSTRALKTIQ 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|326428826|gb|EGD74396.1| hypothetical protein PTSG_06407 [Salpingoeca sp. ATCC 50818]
          Length = 149

 Score = 35.0 bits (79), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 20/88 (22%), Positives = 49/88 (55%), Gaps = 3/88 (3%)

Query: 10  KTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFL 69
           K ++ G K S       +R+ PN+    + S I+E+K +++++   LR +++ G  D ++
Sbjct: 24  KKIIFGVKSSDDKKSPIKRWEPNVISKNVYSHILEKKIKVKMTTRVLRCIDKAGSFDNYI 83

Query: 70  SNSKKENLSARM-RTLRSQILKKMSEKS 96
             +K  NL +++   +++Q++  + +K 
Sbjct: 84  LKAK--NLESQLGEDIKAQMVAALEKKG 109


>gi|237736146|ref|ZP_04566627.1| LSU ribosomal protein L28P [Fusobacterium mortiferum ATCC 9817]
 gi|229421699|gb|EEO36746.1| LSU ribosomal protein L28P [Fusobacterium mortiferum ATCC 9817]
          Length = 85

 Score = 35.0 bits (79), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 22/29 (75%)

Query: 5  CELTKKTVMSGNKVSHANNKTRRRFLPNL 33
          CE+T   ++SGN++SH++  TRR + PNL
Sbjct: 4  CEITGVGLISGNQISHSHRLTRRVWKPNL 32


>gi|15924214|ref|NP_371748.1| 50S ribosomal protein L28 [Staphylococcus aureus subsp. aureus
          Mu50]
 gi|15926807|ref|NP_374340.1| 50S ribosomal protein L28 [Staphylococcus aureus subsp. aureus
          N315]
 gi|21282836|ref|NP_645924.1| 50S ribosomal protein L28 [Staphylococcus aureus subsp. aureus
          MW2]
 gi|49483387|ref|YP_040611.1| 50S ribosomal protein L28 [Staphylococcus aureus subsp. aureus
          MRSA252]
 gi|49486063|ref|YP_043284.1| 50S ribosomal protein L28 [Staphylococcus aureus subsp. aureus
          MSSA476]
 gi|57651792|ref|YP_186098.1| 50S ribosomal protein L28 [Staphylococcus aureus subsp. aureus
          COL]
 gi|82750828|ref|YP_416569.1| 50S ribosomal protein L28 [Staphylococcus aureus RF122]
 gi|87160693|ref|YP_493814.1| 50S ribosomal protein L28 [Staphylococcus aureus subsp. aureus
          USA300_FPR3757]
 gi|88194930|ref|YP_499730.1| 50S ribosomal protein L28 [Staphylococcus aureus subsp. aureus
          NCTC 8325]
 gi|148267715|ref|YP_001246658.1| 50S ribosomal protein L28 [Staphylococcus aureus subsp. aureus
          JH9]
 gi|150393773|ref|YP_001316448.1| 50S ribosomal protein L28 [Staphylococcus aureus subsp. aureus
          JH1]
 gi|151221346|ref|YP_001332168.1| 50S ribosomal protein L28 [Staphylococcus aureus subsp. aureus
          str. Newman]
 gi|156979545|ref|YP_001441804.1| 50S ribosomal protein L28 [Staphylococcus aureus subsp. aureus
          Mu3]
 gi|221142014|ref|ZP_03566507.1| 50S ribosomal protein L28 [Staphylococcus aureus subsp. aureus
          str. JKD6009]
 gi|253315582|ref|ZP_04838795.1| 50S ribosomal protein L28 [Staphylococcus aureus subsp. aureus
          str. CF-Marseille]
 gi|253731841|ref|ZP_04866006.1| 50S ribosomal protein L28 [Staphylococcus aureus subsp. aureus
          USA300_TCH959]
 gi|253733538|ref|ZP_04867703.1| 50S ribosomal protein L28 [Staphylococcus aureus subsp. aureus
          TCH130]
 gi|255006011|ref|ZP_05144612.2| 50S ribosomal protein L28 [Staphylococcus aureus subsp. aureus
          Mu50-omega]
 gi|257425277|ref|ZP_05601702.1| LSU ribosomal protein L28P [Staphylococcus aureus subsp. aureus
          55/2053]
 gi|257427937|ref|ZP_05604335.1| ribosomal protein L28 [Staphylococcus aureus subsp. aureus
          65-1322]
 gi|257430570|ref|ZP_05606952.1| 50S ribosomal protein L28 [Staphylococcus aureus subsp. aureus
          68-397]
 gi|257433331|ref|ZP_05609689.1| ribosomal protein L28 [Staphylococcus aureus subsp. aureus E1410]
 gi|257436173|ref|ZP_05612220.1| LSU ribosomal protein L28 [Staphylococcus aureus subsp. aureus
          M876]
 gi|257795720|ref|ZP_05644699.1| 50S ribosomal protein L28 [Staphylococcus aureus A9781]
 gi|258415944|ref|ZP_05682214.1| 50S ribosomal protein L28 [Staphylococcus aureus A9763]
 gi|258419691|ref|ZP_05682658.1| LSU ribosomal protein L28 [Staphylococcus aureus A9719]
 gi|258423733|ref|ZP_05686619.1| LSU ribosomal protein L28 [Staphylococcus aureus A9635]
 gi|258438733|ref|ZP_05689886.1| 50S ribosomal protein L28 [Staphylococcus aureus A9299]
 gi|258444561|ref|ZP_05692890.1| ribosomal protein L28 [Staphylococcus aureus A8115]
 gi|258447606|ref|ZP_05695750.1| 50S ribosomal protein L28 [Staphylococcus aureus A6300]
 gi|258449448|ref|ZP_05697551.1| ribosomal protein L28 [Staphylococcus aureus A6224]
 gi|258452521|ref|ZP_05700527.1| LSU ribosomal protein L28P [Staphylococcus aureus A5948]
 gi|258454827|ref|ZP_05702791.1| 50S ribosomal protein L28 [Staphylococcus aureus A5937]
 gi|262048122|ref|ZP_06021009.1| 50S ribosomal protein L28 [Staphylococcus aureus D30]
 gi|262051872|ref|ZP_06024088.1| 50S ribosomal protein L28 [Staphylococcus aureus 930918-3]
 gi|269202839|ref|YP_003282108.1| 50S ribosomal protein L28 [Staphylococcus aureus subsp. aureus
          ED98]
 gi|282892710|ref|ZP_06300945.1| 50S ribosomal protein L28 [Staphylococcus aureus A8117]
 gi|282903777|ref|ZP_06311665.1| ribosomal protein L28 [Staphylococcus aureus subsp. aureus C160]
 gi|282905541|ref|ZP_06313396.1| 50S ribosomal protein L28 [Staphylococcus aureus subsp. aureus
          Btn1260]
 gi|282908517|ref|ZP_06316347.1| ribosomal protein L28 [Staphylococcus aureus subsp. aureus
          WW2703/97]
 gi|282910796|ref|ZP_06318599.1| ribosomal protein L28 [Staphylococcus aureus subsp. aureus
          WBG10049]
 gi|282913999|ref|ZP_06321786.1| conserved domain protein [Staphylococcus aureus subsp. aureus
          M899]
 gi|282916473|ref|ZP_06324235.1| 50S ribosomal protein L28 [Staphylococcus aureus subsp. aureus
          D139]
 gi|282918921|ref|ZP_06326656.1| 50S ribosomal protein L28 [Staphylococcus aureus subsp. aureus
          C427]
 gi|282920006|ref|ZP_06327735.1| 50S ribosomal protein L28 [Staphylococcus aureus A9765]
 gi|282924044|ref|ZP_06331720.1| 50S ribosomal protein L28 [Staphylococcus aureus subsp. aureus
          C101]
 gi|282927564|ref|ZP_06335180.1| 50S ribosomal protein L28 [Staphylococcus aureus A10102]
 gi|283770285|ref|ZP_06343177.1| large subunit ribosomal protein L28 [Staphylococcus aureus subsp.
          aureus H19]
 gi|283957965|ref|ZP_06375416.1| ribosomal protein L28 [Staphylococcus aureus subsp. aureus
          A017934/97]
 gi|284024148|ref|ZP_06378546.1| 50S ribosomal protein L28 [Staphylococcus aureus subsp. aureus
          132]
 gi|293501032|ref|ZP_06666883.1| 50S ribosomal protein L28 [Staphylococcus aureus subsp. aureus
          58-424]
 gi|293509991|ref|ZP_06668699.1| 50S ribosomal protein L28 [Staphylococcus aureus subsp. aureus
          M809]
 gi|293526579|ref|ZP_06671264.1| conserved domain protein [Staphylococcus aureus subsp. aureus
          M1015]
 gi|294848217|ref|ZP_06788964.1| 50S ribosomal protein L28 [Staphylococcus aureus A9754]
 gi|295407162|ref|ZP_06816963.1| 50S ribosomal protein L28 [Staphylococcus aureus A8819]
 gi|295427709|ref|ZP_06820341.1| 50S ribosomal protein L28 [Staphylococcus aureus subsp. aureus
          EMRSA16]
 gi|296275245|ref|ZP_06857752.1| 50S ribosomal protein L28 [Staphylococcus aureus subsp. aureus
          MR1]
 gi|297208132|ref|ZP_06924563.1| 50S ribosomal protein L28 [Staphylococcus aureus subsp. aureus
          ATCC 51811]
 gi|297245952|ref|ZP_06929811.1| 50S ribosomal protein L28 [Staphylococcus aureus A8796]
 gi|297591332|ref|ZP_06949970.1| 50S ribosomal protein L28 [Staphylococcus aureus subsp. aureus
          MN8]
 gi|300912212|ref|ZP_07129655.1| 50S ribosomal protein L28 [Staphylococcus aureus subsp. aureus
          TCH70]
 gi|304381213|ref|ZP_07363866.1| 50S ribosomal protein L28 [Staphylococcus aureus subsp. aureus
          ATCC BAA-39]
 gi|54039150|sp|P66153|RL28_STAAN RecName: Full=50S ribosomal protein L28
 gi|54039151|sp|P66154|RL28_STAAW RecName: Full=50S ribosomal protein L28
 gi|54041851|sp|P66152|RL28_STAAM RecName: Full=50S ribosomal protein L28
 gi|56749524|sp|Q6G9Y9|RL28_STAAS RecName: Full=50S ribosomal protein L28
 gi|56749571|sp|Q6GHL1|RL28_STAAR RecName: Full=50S ribosomal protein L28
 gi|67461253|sp|Q5HGK9|RL28_STAAC RecName: Full=50S ribosomal protein L28
 gi|122539716|sp|Q2FZ60|RL28_STAA8 RecName: Full=50S ribosomal protein L28
 gi|123486223|sp|Q2FHL4|RL28_STAA3 RecName: Full=50S ribosomal protein L28
 gi|123549055|sp|Q2YXJ2|RL28_STAAB RecName: Full=50S ribosomal protein L28
 gi|166228156|sp|A7X1I6|RL28_STAA1 RecName: Full=50S ribosomal protein L28
 gi|172048853|sp|A6QGC4|RL28_STAAE RecName: Full=50S ribosomal protein L28
 gi|189029457|sp|A6U143|RL28_STAA2 RecName: Full=50S ribosomal protein L28
 gi|189029458|sp|A5ISA9|RL28_STAA9 RecName: Full=50S ribosomal protein L28
 gi|13701024|dbj|BAB42319.1| 50S ribosomal protein L28 [Staphylococcus aureus subsp. aureus
          N315]
 gi|14246994|dbj|BAB57386.1| 50S ribosomal protein L28 [Staphylococcus aureus subsp. aureus
          Mu50]
 gi|21204275|dbj|BAB94972.1| 50S ribosomal protein L28 [Staphylococcus aureus subsp. aureus
          MW2]
 gi|49241516|emb|CAG40202.1| 50S ribosomal protein L28 [Staphylococcus aureus subsp. aureus
          MRSA252]
 gi|49244506|emb|CAG42935.1| 50S ribosomal protein L28 [Staphylococcus aureus subsp. aureus
          MSSA476]
 gi|57285978|gb|AAW38072.1| ribosomal protein L28 [Staphylococcus aureus subsp. aureus COL]
 gi|82656359|emb|CAI80777.1| 50S ribosomal protein L28 [Staphylococcus aureus RF122]
 gi|87126667|gb|ABD21181.1| 50S ribosomal protein L28 [Staphylococcus aureus subsp. aureus
          USA300_FPR3757]
 gi|87202488|gb|ABD30298.1| ribosomal protein L28 [Staphylococcus aureus subsp. aureus NCTC
          8325]
 gi|147740784|gb|ABQ49082.1| LSU ribosomal protein L28P [Staphylococcus aureus subsp. aureus
          JH9]
 gi|149946225|gb|ABR52161.1| ribosomal protein L28 [Staphylococcus aureus subsp. aureus JH1]
 gi|150374146|dbj|BAF67406.1| 50S ribosomal protein L28 [Staphylococcus aureus subsp. aureus
          str. Newman]
 gi|156721680|dbj|BAF78097.1| 50S ribosomal protein L28 [Staphylococcus aureus subsp. aureus
          Mu3]
 gi|253724440|gb|EES93169.1| 50S ribosomal protein L28 [Staphylococcus aureus subsp. aureus
          USA300_TCH959]
 gi|253728592|gb|EES97321.1| 50S ribosomal protein L28 [Staphylococcus aureus subsp. aureus
          TCH130]
 gi|257271734|gb|EEV03872.1| LSU ribosomal protein L28P [Staphylococcus aureus subsp. aureus
          55/2053]
 gi|257274778|gb|EEV06265.1| ribosomal protein L28 [Staphylococcus aureus subsp. aureus
          65-1322]
 gi|257278698|gb|EEV09317.1| 50S ribosomal protein L28 [Staphylococcus aureus subsp. aureus
          68-397]
 gi|257281424|gb|EEV11561.1| ribosomal protein L28 [Staphylococcus aureus subsp. aureus E1410]
 gi|257284455|gb|EEV14575.1| LSU ribosomal protein L28 [Staphylococcus aureus subsp. aureus
          M876]
 gi|257789692|gb|EEV28032.1| 50S ribosomal protein L28 [Staphylococcus aureus A9781]
 gi|257839280|gb|EEV63754.1| 50S ribosomal protein L28 [Staphylococcus aureus A9763]
 gi|257844276|gb|EEV68658.1| LSU ribosomal protein L28 [Staphylococcus aureus A9719]
 gi|257845965|gb|EEV69993.1| LSU ribosomal protein L28 [Staphylococcus aureus A9635]
 gi|257847992|gb|EEV71985.1| 50S ribosomal protein L28 [Staphylococcus aureus A9299]
 gi|257850054|gb|EEV74007.1| ribosomal protein L28 [Staphylococcus aureus A8115]
 gi|257853797|gb|EEV76756.1| 50S ribosomal protein L28 [Staphylococcus aureus A6300]
 gi|257857436|gb|EEV80334.1| ribosomal protein L28 [Staphylococcus aureus A6224]
 gi|257859739|gb|EEV82581.1| LSU ribosomal protein L28P [Staphylococcus aureus A5948]
 gi|257863210|gb|EEV85974.1| 50S ribosomal protein L28 [Staphylococcus aureus A5937]
 gi|259160273|gb|EEW45301.1| 50S ribosomal protein L28 [Staphylococcus aureus 930918-3]
 gi|259163688|gb|EEW48243.1| 50S ribosomal protein L28 [Staphylococcus aureus D30]
 gi|262075129|gb|ACY11102.1| 50S ribosomal protein L28 [Staphylococcus aureus subsp. aureus
          ED98]
 gi|269940716|emb|CBI49097.1| 50S ribosomal protein L28 [Staphylococcus aureus subsp. aureus
          TW20]
 gi|282314016|gb|EFB44408.1| 50S ribosomal protein L28 [Staphylococcus aureus subsp. aureus
          C101]
 gi|282316731|gb|EFB47105.1| 50S ribosomal protein L28 [Staphylococcus aureus subsp. aureus
          C427]
 gi|282319913|gb|EFB50261.1| 50S ribosomal protein L28 [Staphylococcus aureus subsp. aureus
          D139]
 gi|282322067|gb|EFB52391.1| conserved domain protein [Staphylococcus aureus subsp. aureus
          M899]
 gi|282325401|gb|EFB55710.1| ribosomal protein L28 [Staphylococcus aureus subsp. aureus
          WBG10049]
 gi|282327579|gb|EFB57862.1| ribosomal protein L28 [Staphylococcus aureus subsp. aureus
          WW2703/97]
 gi|282330833|gb|EFB60347.1| 50S ribosomal protein L28 [Staphylococcus aureus subsp. aureus
          Btn1260]
 gi|282590567|gb|EFB95644.1| 50S ribosomal protein L28 [Staphylococcus aureus A10102]
 gi|282594722|gb|EFB99706.1| 50S ribosomal protein L28 [Staphylococcus aureus A9765]
 gi|282595395|gb|EFC00359.1| ribosomal protein L28 [Staphylococcus aureus subsp. aureus C160]
 gi|282764707|gb|EFC04832.1| 50S ribosomal protein L28 [Staphylococcus aureus A8117]
 gi|283460432|gb|EFC07522.1| large subunit ribosomal protein L28 [Staphylococcus aureus subsp.
          aureus H19]
 gi|283470436|emb|CAQ49647.1| ribosomal protein L28 [Staphylococcus aureus subsp. aureus ST398]
 gi|283790114|gb|EFC28931.1| ribosomal protein L28 [Staphylococcus aureus subsp. aureus
          A017934/97]
 gi|285816906|gb|ADC37393.1| 50S ribosomal protein L28 [Staphylococcus aureus 04-02981]
 gi|290920651|gb|EFD97714.1| conserved domain protein [Staphylococcus aureus subsp. aureus
          M1015]
 gi|291096037|gb|EFE26298.1| 50S ribosomal protein L28 [Staphylococcus aureus subsp. aureus
          58-424]
 gi|291466935|gb|EFF09453.1| 50S ribosomal protein L28 [Staphylococcus aureus subsp. aureus
          M809]
 gi|294825017|gb|EFG41439.1| 50S ribosomal protein L28 [Staphylococcus aureus A9754]
 gi|294968015|gb|EFG44043.1| 50S ribosomal protein L28 [Staphylococcus aureus A8819]
 gi|295128067|gb|EFG57701.1| 50S ribosomal protein L28 [Staphylococcus aureus subsp. aureus
          EMRSA16]
 gi|296887375|gb|EFH26277.1| 50S ribosomal protein L28 [Staphylococcus aureus subsp. aureus
          ATCC 51811]
 gi|297177116|gb|EFH36370.1| 50S ribosomal protein L28 [Staphylococcus aureus A8796]
 gi|297576218|gb|EFH94934.1| 50S ribosomal protein L28 [Staphylococcus aureus subsp. aureus
          MN8]
 gi|298694517|gb|ADI97739.1| 50S ribosomal protein L28 [Staphylococcus aureus subsp. aureus
          ED133]
 gi|300886458|gb|EFK81660.1| 50S ribosomal protein L28 [Staphylococcus aureus subsp. aureus
          TCH70]
 gi|302332828|gb|ADL23021.1| 50S ribosomal protein L28 [Staphylococcus aureus subsp. aureus
          JKD6159]
 gi|302751047|gb|ADL65224.1| 50S ribosomal protein L28 [Staphylococcus aureus subsp. aureus
          str. JKD6008]
 gi|304340196|gb|EFM06137.1| 50S ribosomal protein L28 [Staphylococcus aureus subsp. aureus
          ATCC BAA-39]
 gi|312438399|gb|ADQ77470.1| 50S ribosomal protein L28 [Staphylococcus aureus subsp. aureus
          TCH60]
 gi|312829618|emb|CBX34460.1| ribosomal protein L28 [Staphylococcus aureus subsp. aureus ECT-R
          2]
 gi|315131015|gb|EFT86999.1| 50S ribosomal protein L28 [Staphylococcus aureus subsp. aureus
          CGS03]
 gi|315194110|gb|EFU24503.1| 50S ribosomal protein L28 [Staphylococcus aureus subsp. aureus
          CGS00]
 gi|315198461|gb|EFU28790.1| 50S ribosomal protein L28 [Staphylococcus aureus subsp. aureus
          CGS01]
 gi|320140961|gb|EFW32808.1| ribosomal protein L28 [Staphylococcus aureus subsp. aureus
          MRSA131]
 gi|320144324|gb|EFW36090.1| ribosomal protein L28 [Staphylococcus aureus subsp. aureus
          MRSA177]
 gi|323440999|gb|EGA98706.1| 50S ribosomal protein L28 [Staphylococcus aureus O11]
 gi|323442315|gb|EGA99945.1| 50S ribosomal protein L28 [Staphylococcus aureus O46]
 gi|329313893|gb|AEB88306.1| 50S ribosomal protein L28 [Staphylococcus aureus subsp. aureus
          T0131]
 gi|329724752|gb|EGG61257.1| ribosomal protein L28 [Staphylococcus aureus subsp. aureus 21189]
 gi|329727234|gb|EGG63690.1| ribosomal protein L28 [Staphylococcus aureus subsp. aureus 21172]
 gi|329728849|gb|EGG65270.1| ribosomal protein L28 [Staphylococcus aureus subsp. aureus 21193]
          Length = 62

 Score = 35.0 bits (79), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 35/58 (60%), Gaps = 2/58 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS 58
          M + C +T +   +GN+ SHA N T+RR+  NL ++ ++ D   +K  + +S  AL+S
Sbjct: 1  MGKQCFVTGRKASTGNRRSHALNSTKRRWNANLQKVRILVDGKPKK--VWVSARALKS 56


>gi|94967196|ref|YP_589244.1| 50S ribosomal protein L28 [Candidatus Koribacter versatilis
          Ellin345]
 gi|166226529|sp|Q1IVD0|RL28_ACIBL RecName: Full=50S ribosomal protein L28
 gi|94549246|gb|ABF39170.1| LSU ribosomal protein L28P [Candidatus Koribacter versatilis
          Ellin345]
          Length = 62

 Score = 35.0 bits (79), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 23/33 (69%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNL 33
          M++VC++  K    GN +SHA+N T+RR+  NL
Sbjct: 1  MAQVCDMCGKGPQFGNNISHAHNVTKRRWNVNL 33


>gi|88808581|ref|ZP_01124091.1| 50S ribosomal protein L28 [Synechococcus sp. WH 7805]
 gi|148239573|ref|YP_001224960.1| 50S ribosomal protein L28 [Synechococcus sp. WH 7803]
 gi|166228167|sp|A5GL48|RL28_SYNPW RecName: Full=50S ribosomal protein L28
 gi|88787569|gb|EAR18726.1| 50S ribosomal protein L28 [Synechococcus sp. WH 7805]
 gi|147848112|emb|CAK23663.1| 50S ribosomal protein L28 [Synechococcus sp. WH 7803]
          Length = 78

 Score = 35.0 bits (79), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 38/63 (60%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC+LT     +G  VSH++ +T++    NL +  L     ++   LRI+  AL++++
Sbjct: 1  MSRVCQLTGTKANNGMAVSHSHIRTKKLQQANLQQRRLWWAEGKRWVNLRITTRALKTIQ 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|296118268|ref|ZP_06836849.1| ribosomal protein L28 [Corynebacterium ammoniagenes DSM 20306]
 gi|295968826|gb|EFG82070.1| ribosomal protein L28 [Corynebacterium ammoniagenes DSM 20306]
          Length = 78

 Score = 35.0 bits (79), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 34/63 (53%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS +C++T +    G +VSH++ +T RR+ PN+ R         +   L +S   ++ ++
Sbjct: 1  MSAICQVTGREPSFGKQVSHSHRRTSRRWNPNVQRRRYYLPSEGRTITLNVSTKGIKIID 60

Query: 61 RQG 63
          R G
Sbjct: 61 RDG 63


>gi|302023371|ref|ZP_07248582.1| 50S ribosomal protein L28 [Streptococcus suis 05HAS68]
          Length = 58

 Score = 35.0 bits (79), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 34/57 (59%), Gaps = 4/57 (7%)

Query: 7  LTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS--VER 61
           T +  +SGN  SHA N+T+R   PNL ++T++ D   +K  +  S  AL+S  VER
Sbjct: 3  FTGRKTVSGNNRSHAMNQTKRAVKPNLQKVTVLIDGKPKK--VWASARALKSGKVER 57


>gi|305681979|ref|ZP_07404783.1| 50S ribosomal protein L28 [Corynebacterium matruchotii ATCC
          14266]
 gi|305658452|gb|EFM47955.1| 50S ribosomal protein L28 [Corynebacterium matruchotii ATCC
          14266]
          Length = 111

 Score = 35.0 bits (79), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 33/63 (52%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS +C++T +    G  VSH++ +T RR+ PN+ R         +   L +S   L+ ++
Sbjct: 34 MSAICQVTGRKPGYGKSVSHSHRRTSRRWNPNVQRRKFYLPSEGRTITLTVSTKGLKVID 93

Query: 61 RQG 63
          R G
Sbjct: 94 RDG 96


>gi|15834980|ref|NP_296739.1| 50S ribosomal protein L28 [Chlamydia muridarum Nigg]
 gi|270285149|ref|ZP_06194543.1| 50S ribosomal protein L28 [Chlamydia muridarum Nigg]
 gi|270289170|ref|ZP_06195472.1| 50S ribosomal protein L28 [Chlamydia muridarum Weiss]
 gi|301336544|ref|ZP_07224746.1| 50S ribosomal protein L28 [Chlamydia muridarum MopnTet14]
 gi|13633858|sp|Q9PKV0|RL28_CHLMU RecName: Full=50S ribosomal protein L28
 gi|7190403|gb|AAF39222.1| ribosomal protein L28 [Chlamydia muridarum Nigg]
          Length = 89

 Score = 35.0 bits (79), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 33/56 (58%), Gaps = 1/56 (1%)

Query: 22 NNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFLSNSKKENL 77
            +T+RRFLPN+    L S    +  +L+IS  ALR V++  GLD+ ++ +K +  
Sbjct: 35 TGRTKRRFLPNMMTKRLWSTEENRFLKLKISAAALRLVDKL-GLDKVVARAKSKGF 89


>gi|154685998|ref|YP_001421159.1| 50S ribosomal protein L28 [Bacillus amyloliquefaciens FZB42]
 gi|308173545|ref|YP_003920250.1| 50S ribosomal protein L28 [Bacillus amyloliquefaciens DSM 7]
 gi|166226541|sp|A7Z4K2|RL28_BACA2 RecName: Full=50S ribosomal protein L28
 gi|154351849|gb|ABS73928.1| RpmB [Bacillus amyloliquefaciens FZB42]
 gi|307606409|emb|CBI42780.1| ribosomal protein L28 [Bacillus amyloliquefaciens DSM 7]
 gi|328553522|gb|AEB24014.1| 50S ribosomal protein L28 [Bacillus amyloliquefaciens TA208]
 gi|328911686|gb|AEB63282.1| 50S ribosomal protein L28 [Bacillus amyloliquefaciens LL3]
          Length = 62

 Score = 35.0 bits (79), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 37/63 (58%), Gaps = 4/63 (6%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS-- 58
          M+R C +T K   +GN  SHA N ++R +  NL ++ ++ D   +K  + +S  AL+S  
Sbjct: 1  MARKCFITGKKTKAGNNRSHAMNASKRTWGANLQKVRILVDGKPKK--VYVSARALKSGK 58

Query: 59 VER 61
          VER
Sbjct: 59 VER 61


>gi|161485759|ref|NP_683251.2| 50S ribosomal protein L28 [Thermosynechococcus elongatus BP-1]
 gi|67461522|sp|Q8DG62|RL28_THEEB RecName: Full=50S ribosomal protein L28
          Length = 78

 Score = 35.0 bits (79), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 38/63 (60%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC+LT K   +   +SH++ +T++    NL    +     ++  +LR+S  A++++E
Sbjct: 1  MSRVCQLTGKKANNAYAISHSHRRTKKLQQVNLQWKRVWWPEGKRWVRLRLSTKAIKTLE 60

Query: 61 RQG 63
          R+G
Sbjct: 61 RKG 63


>gi|328957305|ref|YP_004374691.1| 50S ribosomal protein L28 [Carnobacterium sp. 17-4]
 gi|328673629|gb|AEB29675.1| 50S ribosomal protein L28 [Carnobacterium sp. 17-4]
          Length = 62

 Score = 35.0 bits (79), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 35/58 (60%), Gaps = 2/58 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS 58
          M++ C +T +   SGN  SHA NK++R +  NL ++ ++ D   +K  + +S  AL+S
Sbjct: 1  MAKECVITGRKARSGNNRSHAMNKSKRTWGANLQKVRIMVDGTPKK--VWVSARALKS 56


>gi|228474967|ref|ZP_04059695.1| ribosomal protein L28 [Staphylococcus hominis SK119]
 gi|314936614|ref|ZP_07843961.1| ribosomal protein L28 [Staphylococcus hominis subsp. hominis C80]
 gi|228270952|gb|EEK12340.1| ribosomal protein L28 [Staphylococcus hominis SK119]
 gi|313655233|gb|EFS18978.1| ribosomal protein L28 [Staphylococcus hominis subsp. hominis C80]
          Length = 62

 Score = 35.0 bits (79), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 33/58 (56%), Gaps = 2/58 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS 58
          M + C +T +   +GN  SHA N  +RRF  NL ++ ++ D   +K  + +S  AL+S
Sbjct: 1  MGKQCYVTGRKATTGNNRSHALNANKRRFNANLQKVRILVDGKPKK--VWVSARALKS 56


>gi|169333684|ref|ZP_02860877.1| hypothetical protein ANASTE_00068 [Anaerofustis stercorihominis
          DSM 17244]
 gi|169259678|gb|EDS73644.1| hypothetical protein ANASTE_00068 [Anaerofustis stercorihominis
          DSM 17244]
          Length = 63

 Score = 35.0 bits (79), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 27/41 (65%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISD 41
          M + C +  K + SG++VSH+N  T+R + PNL ++ ++ +
Sbjct: 18 MPKECYVCGKKITSGHQVSHSNIHTKRTWKPNLKKVRIVEN 58


>gi|281422460|ref|ZP_06253459.1| 50S ribosomal protein L28 [Prevotella copri DSM 18205]
 gi|281403523|gb|EFB34203.1| 50S ribosomal protein L28 [Prevotella copri DSM 18205]
          Length = 87

 Score = 35.0 bits (79), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 38/76 (50%), Gaps = 1/76 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS++C++T K    G  VSH+ ++T+R F  NL               L+IS   LR + 
Sbjct: 1  MSKICQITGKKAQLGCNVSHSKHRTKRSFDVNLFSKKFYYVEEGCWISLKISAAGLRLIN 60

Query: 61 RQGGLDRFLSNSKKEN 76
          +  GLD  L+ + K+ 
Sbjct: 61 KV-GLDAALNQAVKKG 75


>gi|260592535|ref|ZP_05857993.1| 50S ribosomal protein L28 [Prevotella veroralis F0319]
 gi|260535581|gb|EEX18198.1| 50S ribosomal protein L28 [Prevotella veroralis F0319]
          Length = 87

 Score = 35.0 bits (79), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 32/63 (50%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS++C++T K    G  VSH+ ++T+R F  NL              +L+IS   LR + 
Sbjct: 1  MSKICQITGKKAQLGCNVSHSKHRTKRSFDVNLFSKKFYYVEESCWIELKISAAGLRLIN 60

Query: 61 RQG 63
          + G
Sbjct: 61 KVG 63


>gi|297192961|ref|ZP_06910359.1| 50S ribosomal protein L28 [Streptomyces pristinaespiralis ATCC
          25486]
 gi|297151573|gb|EDY66542.2| 50S ribosomal protein L28 [Streptomyces pristinaespiralis ATCC
          25486]
          Length = 78

 Score = 35.0 bits (79), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 16/35 (45%), Positives = 22/35 (62%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCR 35
          MS  C LT      GN++SH++ +T RRF PN+ R
Sbjct: 1  MSAHCMLTGAQPGFGNRISHSHRRTSRRFDPNIQR 35


>gi|154249705|ref|YP_001410530.1| ribosomal protein L28 [Fervidobacterium nodosum Rt17-B1]
 gi|171769354|sp|A7HLU0|RL28_FERNB RecName: Full=50S ribosomal protein L28
 gi|154153641|gb|ABS60873.1| ribosomal protein L28 [Fervidobacterium nodosum Rt17-B1]
          Length = 73

 Score = 35.0 bits (79), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 39/75 (52%), Gaps = 5/75 (6%)

Query: 5  CELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGG 64
          CE+  K   +G  VSH+N  T R F PN+ ++ ++ D    K   R++ C   S  + G 
Sbjct: 4  CEICGKEPRAGKNVSHSNRHTNRWFKPNVQKVRVLLDDGTVK---RMNVCT--SCLKAGK 58

Query: 65 LDRFLSNSKKENLSA 79
          + R++S S+   L A
Sbjct: 59 VRRYVSKSQSVALEA 73


>gi|149248730|ref|XP_001528752.1| conserved hypothetical protein [Lodderomyces elongisporus NRRL
           YB-4239]
 gi|146448706|gb|EDK43094.1| conserved hypothetical protein [Lodderomyces elongisporus NRRL
           YB-4239]
          Length = 283

 Score = 35.0 bits (79), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 31/50 (62%)

Query: 23  NKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFLSNS 72
           NK  R   PN     + S+ M++++++R+S   LR++ + GGLD++L  S
Sbjct: 128 NKNLRAHKPNRQVAKIWSEAMQRQFKVRVSTKFLRTMTKDGGLDQYLLKS 177


>gi|227501466|ref|ZP_03931515.1| 50S ribosomal protein L28 [Corynebacterium accolens ATCC 49725]
 gi|255324830|ref|ZP_05365943.1| ribosomal protein L28 [Corynebacterium tuberculostearicum SK141]
 gi|306835627|ref|ZP_07468636.1| 50S ribosomal protein L28 [Corynebacterium accolens ATCC 49726]
 gi|311740878|ref|ZP_07714705.1| 50S ribosomal protein L28 [Corynebacterium pseudogenitalium ATCC
          33035]
 gi|227077491|gb|EEI15454.1| 50S ribosomal protein L28 [Corynebacterium accolens ATCC 49725]
 gi|255298130|gb|EET77434.1| ribosomal protein L28 [Corynebacterium tuberculostearicum SK141]
 gi|304568471|gb|EFM44027.1| 50S ribosomal protein L28 [Corynebacterium accolens ATCC 49726]
 gi|311304398|gb|EFQ80474.1| 50S ribosomal protein L28 [Corynebacterium pseudogenitalium ATCC
          33035]
          Length = 78

 Score = 35.0 bits (79), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 34/63 (53%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS +C++T +    G +VSH++ +T RR+ PN+ R         +   L +S   ++ ++
Sbjct: 1  MSAICQVTGRKPEFGKQVSHSHRRTSRRWNPNVQRRRYYLPSEGRTITLNVSTKGMKIID 60

Query: 61 RQG 63
          R G
Sbjct: 61 RDG 63


>gi|87124436|ref|ZP_01080285.1| ribosomal protein L28 [Synechococcus sp. RS9917]
 gi|86168008|gb|EAQ69266.1| ribosomal protein L28 [Synechococcus sp. RS9917]
          Length = 78

 Score = 35.0 bits (79), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 38/63 (60%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC+LT     +G  VSH++ +T++    NL +  L     ++   LRI+  AL++++
Sbjct: 1  MSRVCQLTGTRANNGMAVSHSHIRTKKLQQANLQQRRLWWAEGKRWVNLRITTRALKTIQ 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|227504195|ref|ZP_03934244.1| 50S ribosomal protein L28 [Corynebacterium striatum ATCC 6940]
 gi|227199239|gb|EEI79287.1| 50S ribosomal protein L28 [Corynebacterium striatum ATCC 6940]
          Length = 78

 Score = 34.7 bits (78), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 34/63 (53%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS +C++T +    G +VSH++ +T RR+ PN+ R         +   L +S   ++ ++
Sbjct: 1  MSAICQVTGRKPEFGKQVSHSHRRTSRRWNPNVQRRRYYLPSEGRTITLNVSTKGIKIID 60

Query: 61 RQG 63
          R G
Sbjct: 61 RDG 63


>gi|319892220|ref|YP_004149095.1| LSU ribosomal protein L28p [Staphylococcus pseudintermedius
          HKU10-03]
 gi|317161916|gb|ADV05459.1| LSU ribosomal protein L28p [Staphylococcus pseudintermedius
          HKU10-03]
 gi|323464683|gb|ADX76836.1| ribosomal protein L28 [Staphylococcus pseudintermedius ED99]
          Length = 62

 Score = 34.7 bits (78), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 35/58 (60%), Gaps = 2/58 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS 58
          M + C +T +   +GN+ SHA N T+RR+  NL ++ ++ D   +K  + +S  AL+S
Sbjct: 1  MGKECFVTGRKASTGNRRSHALNSTKRRWNANLQKVRILVDGKPKK--VWVSTRALKS 56


>gi|108801694|ref|YP_641891.1| 50S ribosomal protein L28 [Mycobacterium sp. MCS]
 gi|119870845|ref|YP_940797.1| 50S ribosomal protein L28 [Mycobacterium sp. KMS]
 gi|126437680|ref|YP_001073371.1| 50S ribosomal protein L28 [Mycobacterium sp. JLS]
 gi|108772113|gb|ABG10835.1| LSU ribosomal protein L28P [Mycobacterium sp. MCS]
 gi|119696934|gb|ABL94007.1| LSU ribosomal protein L28P [Mycobacterium sp. KMS]
 gi|126237480|gb|ABO00881.1| LSU ribosomal protein L28P [Mycobacterium sp. JLS]
          Length = 78

 Score = 34.7 bits (78), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 45/76 (59%), Gaps = 1/76 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS  C++T ++   GN+VSH++ +TRRR+ PN+   T       ++  LR+S   ++ ++
Sbjct: 1  MSAHCQVTGRSPGFGNRVSHSHRRTRRRWRPNIQTKTYYVPSEGRRVTLRVSAKGIKVID 60

Query: 61 RQGGLDRFLSNSKKEN 76
          R  G+D  L+  +++ 
Sbjct: 61 RD-GIDAVLARIRRQG 75


>gi|145221904|ref|YP_001132582.1| ribosomal protein L28 [Mycobacterium gilvum PYR-GCK]
 gi|315446360|ref|YP_004079239.1| 50S ribosomal protein L28P [Mycobacterium sp. Spyr1]
 gi|145214390|gb|ABP43794.1| LSU ribosomal protein L28P [Mycobacterium gilvum PYR-GCK]
 gi|315264663|gb|ADU01405.1| LSU ribosomal protein L28P [Mycobacterium sp. Spyr1]
          Length = 78

 Score = 34.7 bits (78), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 37/63 (58%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS  C++T +    GN VSH++ +TRRR+ PN+ R T       ++  LR+S   ++ ++
Sbjct: 1  MSAHCQVTGRKPGFGNAVSHSHRRTRRRWDPNIQRKTYYLPSEGRRITLRVSTKGIKIID 60

Query: 61 RQG 63
          R G
Sbjct: 61 RDG 63


>gi|17536507|ref|NP_493672.1| hypothetical protein T25D3.2 [Caenorhabditis elegans]
 gi|3319437|gb|AAC26291.1| Hypothetical protein T25D3.2 [Caenorhabditis elegans]
          Length = 310

 Score = 34.7 bits (78), Expect = 4.2,   Method: Composition-based stats.
 Identities = 17/69 (24%), Positives = 43/69 (62%), Gaps = 1/69 (1%)

Query: 29  FLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFLSNSKKENLSARM-RTLRSQ 87
           F P L  + L S+I+++  ++ +++ A+R ++   GLD ++  SK+ +L ++   +L+ +
Sbjct: 133 FFPALKNVVLYSEILDKYIKVTVTERAMRLIDEHFGLDYYILESKEIDLDSKFANSLKRE 192

Query: 88  ILKKMSEKS 96
           +L  ++ +S
Sbjct: 193 MLLTLTTES 201


>gi|302553139|ref|ZP_07305481.1| ribosomal protein L28 [Streptomyces viridochromogenes DSM 40736]
 gi|302470757|gb|EFL33850.1| ribosomal protein L28 [Streptomyces viridochromogenes DSM 40736]
          Length = 78

 Score = 34.7 bits (78), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 37/65 (56%), Gaps = 4/65 (6%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLC--RITLISDIMEQKYQLRISKCALRS 58
          MS  C LT      GN+VSH++ +T RRF PN+   R  L S+   +  +LR+S   +R+
Sbjct: 1  MSAHCMLTGARPGFGNRVSHSHRRTSRRFDPNIQSKRYWLPSE--GRCVRLRLSVRGIRT 58

Query: 59 VERQG 63
          V+  G
Sbjct: 59 VDAIG 63


>gi|304316963|ref|YP_003852108.1| ribosomal protein L28 [Thermoanaerobacterium
          thermosaccharolyticum DSM 571]
 gi|302778465|gb|ADL69024.1| ribosomal protein L28 [Thermoanaerobacterium
          thermosaccharolyticum DSM 571]
          Length = 62

 Score = 34.7 bits (78), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 26/39 (66%)

Query: 3  RVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISD 41
          R C++  KT M+G + SH++ K+ +++ PNL R+  I D
Sbjct: 2  RKCDVCGKTPMAGYQYSHSHRKSIKKWQPNLKRVRAIVD 40


>gi|218439797|ref|YP_002378126.1| ribosomal protein L28 [Cyanothece sp. PCC 7424]
 gi|226738063|sp|B7K8R0|RL28_CYAP7 RecName: Full=50S ribosomal protein L28
 gi|218172525|gb|ACK71258.1| ribosomal protein L28 [Cyanothece sp. PCC 7424]
          Length = 78

 Score = 34.7 bits (78), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 38/63 (60%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+R CELT K   +   +SH++ +T+R    NL    +  +  ++  +LR+S  A++++E
Sbjct: 1  MARHCELTGKKANNAFSISHSHRRTKRLQHANLQWKRIWWEEGKRWVKLRLSTKAIKTLE 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|113953218|ref|YP_730605.1| 50S ribosomal protein L28 [Synechococcus sp. CC9311]
 gi|123327823|sp|Q0IAB7|RL28_SYNS3 RecName: Full=50S ribosomal protein L28
 gi|113880569|gb|ABI45527.1| ribosomal protein L28 [Synechococcus sp. CC9311]
          Length = 78

 Score = 34.7 bits (78), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 38/63 (60%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC+LT     +G  VSH++ +T++    NL +  L     ++   LRI+  AL++++
Sbjct: 1  MSRVCQLTGTRANNGMAVSHSHIRTKKLQQANLQQRRLWWAEGKRWINLRITTRALKTIQ 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|89098696|ref|ZP_01171578.1| 50S ribosomal protein L28 [Bacillus sp. NRRL B-14911]
 gi|89086658|gb|EAR65777.1| 50S ribosomal protein L28 [Bacillus sp. NRRL B-14911]
          Length = 62

 Score = 34.7 bits (78), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 36/63 (57%), Gaps = 4/63 (6%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS-- 58
          M R C +T +   SGNK SHA N  +R +  NL ++ ++ D   +  ++ +S  AL+S  
Sbjct: 1  MPRKCVVTGRKTTSGNKRSHAMNANKRTWGANLQKVRILVD--GKPKRVWVSARALKSGK 58

Query: 59 VER 61
          VER
Sbjct: 59 VER 61


>gi|70726692|ref|YP_253606.1| 50S ribosomal protein L28 [Staphylococcus haemolyticus JCSC1435]
 gi|82581586|sp|Q4L5S5|RL28_STAHJ RecName: Full=50S ribosomal protein L28
 gi|68447416|dbj|BAE05000.1| 50S ribosomal protein L28 [Staphylococcus haemolyticus JCSC1435]
          Length = 62

 Score = 34.7 bits (78), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 33/58 (56%), Gaps = 2/58 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS 58
          M + C +T +   +GN  SHA N  +RRF  NL ++ ++ D   +K  + +S  AL+S
Sbjct: 1  MGKQCYVTGRKASTGNNRSHALNANKRRFNANLQKVRILVDGKPKK--VWVSARALKS 56


>gi|227832650|ref|YP_002834357.1| 50S ribosomal protein L28 [Corynebacterium aurimucosum ATCC
          700975]
 gi|262182865|ref|ZP_06042286.1| 50S ribosomal protein L28 [Corynebacterium aurimucosum ATCC
          700975]
 gi|254801353|sp|C3PF15|RL28_CORA7 RecName: Full=50S ribosomal protein L28
 gi|227453666|gb|ACP32419.1| 50S ribosomal protein L28 [Corynebacterium aurimucosum ATCC
          700975]
          Length = 78

 Score = 34.7 bits (78), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 34/63 (53%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS +C++T +    G +VSH++ +T RR+ PN+ R         +   L +S   ++ ++
Sbjct: 1  MSAICQVTGRKPEFGKQVSHSHRRTSRRWNPNVQRRRYYLPSEGRTITLTVSTKGMKIID 60

Query: 61 RQG 63
          R G
Sbjct: 61 RDG 63


>gi|209525260|ref|ZP_03273802.1| ribosomal protein L28 [Arthrospira maxima CS-328]
 gi|209494275|gb|EDZ94588.1| ribosomal protein L28 [Arthrospira maxima CS-328]
          Length = 78

 Score = 34.7 bits (78), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 38/63 (60%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC+LT K   +G  VSH++ ++ +    NL    +     ++  +L++S  A++++E
Sbjct: 1  MSRVCQLTGKRANNGMAVSHSHRRSHKLQQANLQWKRIWWPQGKRWVRLKLSTKAIKTIE 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|126700181|ref|YP_001089078.1| 50S ribosomal protein L28 [Clostridium difficile 630]
 gi|255101725|ref|ZP_05330702.1| 50S ribosomal protein L28 [Clostridium difficile QCD-63q42]
 gi|255307594|ref|ZP_05351765.1| 50S ribosomal protein L28 [Clostridium difficile ATCC 43255]
 gi|255656541|ref|ZP_05401950.1| 50S ribosomal protein L28 [Clostridium difficile QCD-23m63]
 gi|296450008|ref|ZP_06891772.1| 50S ribosomal protein L28 [Clostridium difficile NAP08]
 gi|296878389|ref|ZP_06902397.1| 50S ribosomal protein L28 [Clostridium difficile NAP07]
 gi|122973635|sp|Q182Q0|RL28_CLOD6 RecName: Full=50S ribosomal protein L28
 gi|115251618|emb|CAJ69451.1| 50S ribosomal protein L28 [Clostridium difficile]
 gi|296261278|gb|EFH08109.1| 50S ribosomal protein L28 [Clostridium difficile NAP08]
 gi|296430687|gb|EFH16526.1| 50S ribosomal protein L28 [Clostridium difficile NAP07]
          Length = 62

 Score = 34.7 bits (78), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 29/49 (59%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQL 49
          M++VC +  K  +SGN+VSH+N   +R +  NL  +  I D   ++ ++
Sbjct: 1  MAKVCSVCGKGKVSGNQVSHSNKHNKRTWSANLRSVRAIIDGAPKRVKV 49


>gi|72080462|ref|YP_287520.1| 50S ribosomal protein L28 [Mycoplasma hyopneumoniae 7448]
 gi|123645231|sp|Q4A8P2|RL28_MYCH7 RecName: Full=50S ribosomal protein L28
 gi|71913586|gb|AAZ53497.1| 50S ribosomal protein L28 [Mycoplasma hyopneumoniae 7448]
          Length = 64

 Score = 34.7 bits (78), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 38/63 (60%), Gaps = 1/63 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+R  +++ +  +SGN  SHA N T+R+F  NL +ITL      +K +L++S    +++ 
Sbjct: 1  MARKDQISHRGPLSGNNRSHALNATKRKFNLNLQQITL-KTASGKKIRLKVSAKTKKTLR 59

Query: 61 RQG 63
          + G
Sbjct: 60 KWG 62


>gi|332707891|ref|ZP_08427904.1| LSU ribosomal protein L28P [Lyngbya majuscula 3L]
 gi|332353331|gb|EGJ32858.1| LSU ribosomal protein L28P [Lyngbya majuscula 3L]
          Length = 78

 Score = 34.7 bits (78), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 39/63 (61%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR C+LT K   +G  VSH++ +T+R    NL    +  +  ++  +LRIS  A+++++
Sbjct: 1  MSRRCQLTGKKANNGYAVSHSHRRTKRLQNVNLQVKRVWWEEGKRWVKLRISTKAIKTLQ 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|294505837|ref|YP_003569895.1| 50S Ribosomal protein L28 [Salinibacter ruber M8]
 gi|294342165|emb|CBH22943.1| 50S Ribosomal protein L28 [Salinibacter ruber M8]
          Length = 166

 Score = 34.7 bits (78), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 36/63 (57%)

Query: 1   MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
           M+R  ++T +  ++GN VS +N KT RRF  NL          ++  +L++S   L+++ 
Sbjct: 89  MARKDDVTGEGPVTGNSVSDSNQKTNRRFKRNLHEKRFYIPSEDRHVKLKVSSKTLKTIN 148

Query: 61  RQG 63
           ++G
Sbjct: 149 KKG 151


>gi|254976152|ref|ZP_05272624.1| 50S ribosomal protein L28 [Clostridium difficile QCD-66c26]
 gi|255093542|ref|ZP_05323020.1| 50S ribosomal protein L28 [Clostridium difficile CIP 107932]
 gi|255315285|ref|ZP_05356868.1| 50S ribosomal protein L28 [Clostridium difficile QCD-76w55]
 gi|255517953|ref|ZP_05385629.1| 50S ribosomal protein L28 [Clostridium difficile QCD-97b34]
 gi|255651069|ref|ZP_05397971.1| 50S ribosomal protein L28 [Clostridium difficile QCD-37x79]
 gi|260684135|ref|YP_003215420.1| 50S ribosomal protein L28 [Clostridium difficile CD196]
 gi|260687794|ref|YP_003218928.1| 50S ribosomal protein L28 [Clostridium difficile R20291]
 gi|306520925|ref|ZP_07407272.1| 50S ribosomal protein L28 [Clostridium difficile QCD-32g58]
 gi|260210298|emb|CBA64601.1| 50S ribosomal protein L28 [Clostridium difficile CD196]
 gi|260213811|emb|CBE05780.1| 50S ribosomal protein L28 [Clostridium difficile R20291]
          Length = 62

 Score = 34.7 bits (78), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 29/49 (59%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQL 49
          M++VC +  K  +SGN+VSH+N   +R +  NL  +  I D   ++ ++
Sbjct: 1  MAKVCSVCDKGKVSGNQVSHSNKHNKRTWSANLRSVRAIIDGAPKRVKV 49


>gi|71893475|ref|YP_278921.1| 50S ribosomal protein L28 [Mycoplasma hyopneumoniae J]
 gi|123645950|sp|Q4AAL1|RL28_MYCHJ RecName: Full=50S ribosomal protein L28
 gi|71851602|gb|AAZ44210.1| 50S ribosomal protein L28 [Mycoplasma hyopneumoniae J]
 gi|312601647|gb|ADQ90902.1| 50S ribosomal protein L28 [Mycoplasma hyopneumoniae 168]
          Length = 64

 Score = 34.7 bits (78), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 38/63 (60%), Gaps = 1/63 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+R  +++ +  +SGN  SHA N T+R+F  NL +ITL      +K +L++S    +++ 
Sbjct: 1  MARKDQISHRGPLSGNNRSHALNATKRKFNLNLQQITL-KTASGKKIRLKVSAKTKKTLR 59

Query: 61 RQG 63
          + G
Sbjct: 60 KWG 62


>gi|22296189|dbj|BAC10013.1| 50S ribosomal protein L28 [Thermosynechococcus elongatus BP-1]
          Length = 104

 Score = 34.7 bits (78), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 41/74 (55%), Gaps = 8/74 (10%)

Query: 1   MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
           MSRVC+LT K   +   +SH++ +T++    NL    +     ++  +LR+S  A++++E
Sbjct: 27  MSRVCQLTGKKANNAYAISHSHRRTKKLQQVNLQWKRVWWPEGKRWVRLRLSTKAIKTLE 86

Query: 61  RQG--------GLD 66
           R+G        GLD
Sbjct: 87  RKGLSAFAKEAGLD 100


>gi|19552095|ref|NP_600097.1| 50S ribosomal protein L28 [Corynebacterium glutamicum ATCC 13032]
 gi|62389758|ref|YP_225160.1| 50S ribosomal protein L28 [Corynebacterium glutamicum ATCC 13032]
 gi|145295039|ref|YP_001137860.1| 50S ribosomal protein L28 [Corynebacterium glutamicum R]
 gi|23822039|sp|Q8NS15|RL28_CORGL RecName: Full=50S ribosomal protein L28
 gi|166226568|sp|A4QCL1|RL28_CORGB RecName: Full=50S ribosomal protein L28
 gi|21323635|dbj|BAB98262.1| Ribosomal protein L28 [Corynebacterium glutamicum ATCC 13032]
 gi|41325093|emb|CAF19574.1| 50S RIBOSOMAL PROTEIN L28 [Corynebacterium glutamicum ATCC 13032]
 gi|140844959|dbj|BAF53958.1| hypothetical protein [Corynebacterium glutamicum R]
          Length = 78

 Score = 34.3 bits (77), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 32/63 (50%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS  C++T +    G  VSH++ +T RR+ PN+ R         +   L +S   L+ ++
Sbjct: 1  MSAHCQVTGRKPSFGKSVSHSHRRTSRRWNPNVQRRKFYVPSEGRTITLTVSTKGLKVID 60

Query: 61 RQG 63
          R G
Sbjct: 61 RDG 63


>gi|302868521|ref|YP_003837158.1| 50S ribosomal protein L28 [Micromonospora aurantiaca ATCC 27029]
 gi|302571380|gb|ADL47582.1| ribosomal protein L28 [Micromonospora aurantiaca ATCC 27029]
          Length = 78

 Score = 34.3 bits (77), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 27/66 (40%), Positives = 43/66 (65%), Gaps = 6/66 (9%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNL--CRITLISDIMEQKY-QLRISKCALR 57
          MSR C++T      GN VSH++ +TRRR+ PNL   R  L S   E+++ +L ++  AL+
Sbjct: 1  MSRRCDVTGAKPSFGNAVSHSHRRTRRRWNPNLQNHRFWLPS---ERRWVRLNLTAKALK 57

Query: 58 SVERQG 63
          +V+R+G
Sbjct: 58 TVDRKG 63


>gi|330444467|ref|YP_004377453.1| 50S ribosomal protein L28 [Chlamydophila pecorum E58]
 gi|328807577|gb|AEB41750.1| ribosomal protein L28 [Chlamydophila pecorum E58]
          Length = 89

 Score = 34.3 bits (77), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 35/76 (46%), Gaps = 13/76 (17%)

Query: 1  MSRVCELTKKTVMSGNKVS-------------HANNKTRRRFLPNLCRITLISDIMEQKY 47
          MSR C LT K    GN  +                 KT+RRF PN+    L S   ++  
Sbjct: 1  MSRKCPLTGKRPRCGNSYTIRGIAKKKKGIGLKTTGKTKRRFYPNMVTKRLWSTEEKRFL 60

Query: 48 QLRISKCALRSVERQG 63
          +++IS  ALR +++ G
Sbjct: 61 KMKISASALRLIDKLG 76


>gi|116074818|ref|ZP_01472079.1| 50S ribosomal protein L28 [Synechococcus sp. RS9916]
 gi|116068040|gb|EAU73793.1| 50S ribosomal protein L28 [Synechococcus sp. RS9916]
          Length = 78

 Score = 34.3 bits (77), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 38/63 (60%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC+LT     +G  VSH++ +T++    NL +  L      +  +LR++  AL++++
Sbjct: 1  MSRVCQLTGTRANNGMAVSHSHIRTKKLQQANLQQRRLWWAEGNRWVKLRVTTRALKTIQ 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|323702706|ref|ZP_08114367.1| ribosomal protein L28 [Desulfotomaculum nigrificans DSM 574]
 gi|323532369|gb|EGB22247.1| ribosomal protein L28 [Desulfotomaculum nigrificans DSM 574]
          Length = 62

 Score = 34.3 bits (77), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 24/37 (64%)

Query: 5  CELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISD 41
          CE+  K +  G K+SH++ +T+R + PNL R+  I D
Sbjct: 4  CEVCGKGITVGIKLSHSHIRTKRTWSPNLQRVKAIVD 40


>gi|325269748|ref|ZP_08136359.1| 50S ribosomal protein L28 [Prevotella multiformis DSM 16608]
 gi|324987949|gb|EGC19921.1| 50S ribosomal protein L28 [Prevotella multiformis DSM 16608]
          Length = 87

 Score = 34.3 bits (77), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 32/63 (50%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS++C++T K    G  VSH+ ++T+R F  NL              +L++S   LR + 
Sbjct: 1  MSKICQITGKKAQIGCNVSHSKHRTKRSFDVNLFSKKFYYVEEGCWIELKVSAAGLRLIN 60

Query: 61 RQG 63
          + G
Sbjct: 61 KVG 63


>gi|166365941|ref|YP_001658214.1| 50S ribosomal protein L28 [Microcystis aeruginosa NIES-843]
 gi|189029446|sp|B0JLJ8|RL28_MICAN RecName: Full=50S ribosomal protein L28
 gi|159029749|emb|CAO87827.1| rpmB [Microcystis aeruginosa PCC 7806]
 gi|166088314|dbj|BAG03022.1| 50S ribosomal protein L28 [Microcystis aeruginosa NIES-843]
          Length = 78

 Score = 34.3 bits (77), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 36/63 (57%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC +T K   +   VSH++ +T++    NL    +      +  +LRIS  A++++E
Sbjct: 1  MSRVCTMTGKKANNAYAVSHSHRRTKKLQEANLQWKRVWWSEGNRWVKLRISTKAIKTIE 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|326329684|ref|ZP_08196005.1| ribosomal protein L28 [Nocardioidaceae bacterium Broad-1]
 gi|325952449|gb|EGD44468.1| ribosomal protein L28 [Nocardioidaceae bacterium Broad-1]
          Length = 78

 Score = 34.3 bits (77), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 33/63 (52%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR C++T      GN    +   TRRR+  NL + T     + +K  LR+S  A++ ++
Sbjct: 1  MSRTCQVTGARPGFGNNRPWSKKATRRRWEVNLQKKTYYVPSLGRKVTLRLSTNAIKQID 60

Query: 61 RQG 63
           +G
Sbjct: 61 VRG 63


>gi|83319933|ref|YP_424461.1| 50S ribosomal protein L28 [Mycoplasma capricolum subsp.
          capricolum ATCC 27343]
 gi|123535696|sp|Q2SS02|RL28_MYCCT RecName: Full=50S ribosomal protein L28
 gi|83283819|gb|ABC01751.1| 50S ribosomal protein L28 [Mycoplasma capricolum subsp.
          capricolum ATCC 27343]
 gi|256383718|gb|ACU78288.1| ribosomal protein L28 [Mycoplasma mycoides subsp. capri str.
          GM12]
 gi|256384549|gb|ACU79118.1| ribosomal protein L28 [Mycoplasma mycoides subsp. capri str.
          GM12]
 gi|296455896|gb|ADH22131.1| ribosomal protein L28 [synthetic Mycoplasma mycoides JCVI-syn1.0]
          Length = 65

 Score = 34.3 bits (77), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 38/62 (61%), Gaps = 1/62 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+R   LT K+ +SG   SHA N T+R++  NL ++ ++ D     + +++S   LR+++
Sbjct: 1  MARRDALTGKSALSGQSRSHALNATKRKWNLNLQKVRVM-DENGSVFNIKVSARTLRTLK 59

Query: 61 RQ 62
          +Q
Sbjct: 60 KQ 61


>gi|72382145|ref|YP_291500.1| 50S ribosomal protein L28 [Prochlorococcus marinus str. NATL2A]
 gi|124025685|ref|YP_001014801.1| 50S ribosomal protein L28 [Prochlorococcus marinus str. NATL1A]
 gi|123621283|sp|Q46L31|RL28_PROMT RecName: Full=50S ribosomal protein L28
 gi|166226599|sp|A2C226|RL28_PROM1 RecName: Full=50S ribosomal protein L28
 gi|72001995|gb|AAZ57797.1| LSU ribosomal protein L28P [Prochlorococcus marinus str. NATL2A]
 gi|123960753|gb|ABM75536.1| 50S ribosomal protein L28 [Prochlorococcus marinus str. NATL1A]
          Length = 78

 Score = 34.3 bits (77), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 38/63 (60%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC+LT     +G  VSH++ +T++    NL +  L  +   +   +R++  AL++++
Sbjct: 1  MSRVCQLTGTRANNGMSVSHSHIRTKKLQQANLQQRRLWWEEENKWINIRVTTRALKTIQ 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|331703482|ref|YP_004400169.1| 50S ribosomal protein L28 [Mycoplasma mycoides subsp. capri LC
          str. 95010]
 gi|328802037|emb|CBW54191.1| 50S ribosomal protein L28 [Mycoplasma mycoides subsp. capri LC
          str. 95010]
          Length = 68

 Score = 34.3 bits (77), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 38/62 (61%), Gaps = 1/62 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+R   LT K+ +SG   SHA N T+R++  NL ++ ++ D     + +++S   LR+++
Sbjct: 4  MARRDALTGKSALSGQSRSHALNATKRKWNLNLQKVRVM-DENGSVFNIKVSARTLRTLK 62

Query: 61 RQ 62
          +Q
Sbjct: 63 KQ 64


>gi|290967866|ref|ZP_06559417.1| ribosomal protein L28 [Megasphaera genomosp. type_1 str. 28L]
 gi|290782106|gb|EFD94683.1| ribosomal protein L28 [Megasphaera genomosp. type_1 str. 28L]
          Length = 63

 Score = 34.3 bits (77), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 24/36 (66%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRI 36
          M+  CE+  K  M+G  VSH++ KT+R + PN+ R+
Sbjct: 1  MANYCEICGKGKMAGMNVSHSHLKTKRTWKPNIQRV 36


>gi|258645746|ref|ZP_05733215.1| ribosomal protein L28 [Dialister invisus DSM 15470]
 gi|260403115|gb|EEW96662.1| ribosomal protein L28 [Dialister invisus DSM 15470]
          Length = 63

 Score = 34.3 bits (77), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 26/41 (63%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISD 41
          M+  CE+  K   +G  VSH++ KT+R + PN+ R+ + +D
Sbjct: 1  MANYCEICGKHTATGFNVSHSHLKTKRTWKPNIQRVRVKAD 41


>gi|78212935|ref|YP_381714.1| 50S ribosomal protein L28 [Synechococcus sp. CC9605]
 gi|260434887|ref|ZP_05788857.1| ribosomal protein L28 [Synechococcus sp. WH 8109]
 gi|123578150|sp|Q3AJS3|RL28_SYNSC RecName: Full=50S ribosomal protein L28
 gi|78197394|gb|ABB35159.1| ribosomal protein L28 [Synechococcus sp. CC9605]
 gi|260412761|gb|EEX06057.1| ribosomal protein L28 [Synechococcus sp. WH 8109]
          Length = 78

 Score = 34.3 bits (77), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 38/63 (60%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC+LT     +G  VSH++ +T++    NL +  L      +  +LR++  AL++++
Sbjct: 1  MSRVCQLTGTRANNGMAVSHSHIRTKKLQQANLQQRRLWWAEGNRWVKLRVTTRALKTIQ 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|304384257|ref|ZP_07366668.1| 50S ribosomal protein L28 [Prevotella marshii DSM 16973]
 gi|304334573|gb|EFM00855.1| 50S ribosomal protein L28 [Prevotella marshii DSM 16973]
          Length = 87

 Score = 34.3 bits (77), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 34/69 (49%), Gaps = 1/69 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS++C++T K    G  VSH+ ++T+R F  NL               L+IS   LR + 
Sbjct: 1  MSKICQITGKKAQIGCNVSHSKHRTKRSFDVNLFNKKFYYVEEGCWISLKISAAGLRLIN 60

Query: 61 RQGGLDRFL 69
          +  GLD  L
Sbjct: 61 KV-GLDAAL 68


>gi|188585969|ref|YP_001917514.1| LSU ribosomal protein L28P [Natranaerobius thermophilus
          JW/NM-WN-LF]
 gi|226732841|sp|B2A2L1|RL28_NATTJ RecName: Full=50S ribosomal protein L28
 gi|179350656|gb|ACB84926.1| LSU ribosomal protein L28P [Natranaerobius thermophilus
          JW/NM-WN-LF]
          Length = 63

 Score = 34.3 bits (77), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 30/49 (61%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQL 49
          M+ +CE+  K   SG  VSH+N KT+R++  N+ ++  + D   +K ++
Sbjct: 1  MANLCEICGKGNNSGASVSHSNKKTKRKWKGNIQKLKAMVDGRPKKVKV 49


>gi|317506812|ref|ZP_07964586.1| ribosomal protein L28 [Segniliparus rugosus ATCC BAA-974]
 gi|316254886|gb|EFV14182.1| ribosomal protein L28 [Segniliparus rugosus ATCC BAA-974]
          Length = 78

 Score = 34.3 bits (77), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 34/63 (53%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS  C++T +    G  VSH++ +T RR+ PN+ R         +   L +S   +++++
Sbjct: 1  MSAHCQVTGRQPGFGMAVSHSHRRTNRRWNPNIQRRRYFLPSEGRTITLNVSAKGIKTID 60

Query: 61 RQG 63
          R+G
Sbjct: 61 RKG 63


>gi|295398475|ref|ZP_06808512.1| 50S ribosomal protein L28 [Aerococcus viridans ATCC 11563]
 gi|294973290|gb|EFG49080.1| 50S ribosomal protein L28 [Aerococcus viridans ATCC 11563]
          Length = 65

 Score = 34.3 bits (77), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 24/41 (58%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISD 41
          M++ C  T +   SGN  SHA N T+R F  NL ++ +I +
Sbjct: 3  MAKECYYTGRKTTSGNNRSHALNATKRTFKANLQKVRIIDE 43


>gi|297617074|ref|YP_003702233.1| ribosomal protein L28 [Syntrophothermus lipocalidus DSM 12680]
 gi|297144911|gb|ADI01668.1| ribosomal protein L28 [Syntrophothermus lipocalidus DSM 12680]
          Length = 62

 Score = 34.3 bits (77), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 13/42 (30%), Positives = 27/42 (64%)

Query: 5  CELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQK 46
          CE+  K ++ G + SH++ +T R++ PN+ ++ ++ D   QK
Sbjct: 4  CEICGKGIVFGKQYSHSHIRTNRKWKPNVQKVRILVDGQPQK 45


>gi|78184654|ref|YP_377089.1| 50S ribosomal protein L28 [Synechococcus sp. CC9902]
 gi|116070521|ref|ZP_01467790.1| 50S ribosomal protein L28 [Synechococcus sp. BL107]
 gi|123581534|sp|Q3AXY2|RL28_SYNS9 RecName: Full=50S ribosomal protein L28
 gi|78168948|gb|ABB26045.1| LSU ribosomal protein L28P [Synechococcus sp. CC9902]
 gi|116065926|gb|EAU71683.1| 50S ribosomal protein L28 [Synechococcus sp. BL107]
          Length = 78

 Score = 34.3 bits (77), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 38/63 (60%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC+LT     +G  VSH++ +T++    NL +  L      +  +LR++  AL++++
Sbjct: 1  MSRVCQLTGTRANNGMAVSHSHIRTKKLQQANLQQRRLWWAEGNRWIKLRVTTRALKTIQ 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|156743829|ref|YP_001433958.1| 50S ribosomal protein L28 [Roseiflexus castenholzii DSM 13941]
 gi|156235157|gb|ABU59940.1| ribosomal protein L28 [Roseiflexus castenholzii DSM 13941]
          Length = 91

 Score = 34.3 bits (77), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 32/67 (47%), Gaps = 8/67 (11%)

Query: 5  CELTKKTVMSGNKVSHANN--------KTRRRFLPNLCRITLISDIMEQKYQLRISKCAL 56
          C+LT K V  G  + H  +        KT R F PN+ R T+    + Q   L +S  AL
Sbjct: 4  CDLTGKKVAFGRNIRHKASGGWARRAPKTNRTFRPNVHRHTIYVPEIGQSVTLNLSTKAL 63

Query: 57 RSVERQG 63
          R + ++G
Sbjct: 64 RIINKKG 70


>gi|323345510|ref|ZP_08085733.1| 50S ribosomal protein L28 [Prevotella oralis ATCC 33269]
 gi|323093624|gb|EFZ36202.1| 50S ribosomal protein L28 [Prevotella oralis ATCC 33269]
          Length = 87

 Score = 33.9 bits (76), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 34/69 (49%), Gaps = 1/69 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS++C++T K    G  VSH+ ++T+R F  NL               L+IS   LR + 
Sbjct: 1  MSKICQITGKKAQIGCNVSHSKHRTKRSFDVNLFNKKFYYVEEGCWISLKISAAGLRLIN 60

Query: 61 RQGGLDRFL 69
          +  GLD  L
Sbjct: 61 KV-GLDAAL 68


>gi|110802212|ref|YP_699020.1| 50S ribosomal protein L28 [Clostridium perfringens SM101]
 gi|123047305|sp|Q0SS87|RL28_CLOPS RecName: Full=50S ribosomal protein L28
 gi|110682713|gb|ABG86083.1| 50S ribosomal protein L28 [Clostridium perfringens SM101]
          Length = 63

 Score = 33.9 bits (76), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 13/39 (33%), Positives = 27/39 (69%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLI 39
          M+R CE+  K V++G + SH++ +++R + PN+ ++  I
Sbjct: 1  MARKCEICNKGVVAGVQYSHSHRQSKRTWAPNIKKVKAI 39


>gi|333022771|ref|ZP_08450835.1| putative ribosomal protein L28 [Streptomyces sp. Tu6071]
 gi|332742623|gb|EGJ73064.1| putative ribosomal protein L28 [Streptomyces sp. Tu6071]
          Length = 78

 Score = 33.9 bits (76), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 16/35 (45%), Positives = 23/35 (65%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCR 35
          MS  C+LT      GN+VS+++ +T RRF PN+ R
Sbjct: 1  MSAHCQLTGSKPAFGNRVSNSHRRTSRRFDPNIQR 35


>gi|210622467|ref|ZP_03293172.1| hypothetical protein CLOHIR_01120 [Clostridium hiranonis DSM
          13275]
 gi|210154180|gb|EEA85186.1| hypothetical protein CLOHIR_01120 [Clostridium hiranonis DSM
          13275]
          Length = 62

 Score = 33.9 bits (76), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 37/63 (58%), Gaps = 4/63 (6%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS-- 58
          MSRVC +  K   SGN VSH+N   +R +  NL  + ++ +   ++ ++  ++C LRS  
Sbjct: 1  MSRVCSVCGKGKHSGNTVSHSNKHNKRTWSANLRTVRVVENGTPKRVKV-CTRC-LRSGK 58

Query: 59 VER 61
          VER
Sbjct: 59 VER 61


>gi|296393677|ref|YP_003658561.1| 50S ribosomal protein L28 [Segniliparus rotundus DSM 44985]
 gi|296180824|gb|ADG97730.1| ribosomal protein L28 [Segniliparus rotundus DSM 44985]
          Length = 78

 Score = 33.9 bits (76), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 34/63 (53%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS  C++T +    G  VSH++ +T RR+ PN+ R         +   L +S   +++++
Sbjct: 1  MSAHCQVTGRQPGFGMAVSHSHRRTNRRWNPNIQRRRYFLPSEGRTITLNVSTKGIKTID 60

Query: 61 RQG 63
          R+G
Sbjct: 61 RKG 63


>gi|281425621|ref|ZP_06256534.1| 50S ribosomal protein L28 [Prevotella oris F0302]
 gi|299140817|ref|ZP_07033955.1| 50S ribosomal protein L28 [Prevotella oris C735]
 gi|281400208|gb|EFB31039.1| 50S ribosomal protein L28 [Prevotella oris F0302]
 gi|298577783|gb|EFI49651.1| 50S ribosomal protein L28 [Prevotella oris C735]
          Length = 87

 Score = 33.9 bits (76), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 34/69 (49%), Gaps = 1/69 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS++C++T K    G  VSH+ ++T+R F  NL               L+IS   LR + 
Sbjct: 1  MSKICQITGKKAQIGCNVSHSKHRTKRSFDVNLFSKKFYYVEEGCWISLKISAAGLRLIN 60

Query: 61 RQGGLDRFL 69
          +  GLD  L
Sbjct: 61 KV-GLDAAL 68


>gi|309810314|ref|ZP_07704152.1| ribosomal protein L28 [Dermacoccus sp. Ellin185]
 gi|308435742|gb|EFP59536.1| ribosomal protein L28 [Dermacoccus sp. Ellin185]
          Length = 64

 Score = 33.9 bits (76), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 16/59 (27%), Positives = 33/59 (55%), Gaps = 1/59 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRI-TLISDIMEQKYQLRISKCALRS 58
          M+  C++  K    G+ +SH+N +T+RR+ PN+ R+  L+ +      +L +    L++
Sbjct: 1  MAATCDVCGKGPGFGHNISHSNRRTKRRWNPNIQRVRALVGEAGVTPKRLNVCTSCLKA 59


>gi|46446300|ref|YP_007665.1| 50S ribosomal protein L28 [Candidatus Protochlamydia amoebophila
          UWE25]
 gi|67461428|sp|Q6MDF9|RL28_PARUW RecName: Full=50S ribosomal protein L28
 gi|46399941|emb|CAF23390.1| putative ribosomal protein L28 [Candidatus Protochlamydia
          amoebophila UWE25]
          Length = 91

 Score = 33.9 bits (76), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 36/76 (47%), Gaps = 13/76 (17%)

Query: 1  MSRVCELTKKTVMSGNKVS-------------HANNKTRRRFLPNLCRITLISDIMEQKY 47
          MS+VC++T +    G K +                 KT+RRF PNL +  +      +  
Sbjct: 1  MSKVCQVTGRKPTRGYKYAIRGIAKKKKGIGLKVTGKTKRRFQPNLFKKRIWFAEENRFI 60

Query: 48 QLRISKCALRSVERQG 63
           L++S  ALR+++R G
Sbjct: 61 TLKLSTAALRTIDRLG 76


>gi|85057883|ref|YP_456799.1| 50S ribosomal protein L28 [Aster yellows witches'-broom
          phytoplasma AYWB]
 gi|123518063|sp|Q2NIM3|RL28_AYWBP RecName: Full=50S ribosomal protein L28
 gi|84789988|gb|ABC65720.1| LSU ribosomal protein L28P [Aster yellows witches'-broom
          phytoplasma AYWB]
          Length = 62

 Score = 33.9 bits (76), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 35/59 (59%), Gaps = 3/59 (5%)

Query: 5  CELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQ-LRISKCALRSVERQ 62
          C +T KT + GN+ SHA N T+R +  NL  + +I +    K Q ++IS  AL+ ++ Q
Sbjct: 4  CYITGKTTLFGNRRSHAMNATKRIWKANLQNVKIIDE--NGKIQKVKISARALKKLKLQ 60


>gi|157692262|ref|YP_001486724.1| 50S ribosomal protein L28 [Bacillus pumilus SAFR-032]
 gi|194015123|ref|ZP_03053740.1| ribosomal protein L28 [Bacillus pumilus ATCC 7061]
 gi|166987909|sp|A8FD47|RL28_BACP2 RecName: Full=50S ribosomal protein L28
 gi|157681020|gb|ABV62164.1| ribosomal protein L28 [Bacillus pumilus SAFR-032]
 gi|194014149|gb|EDW23714.1| ribosomal protein L28 [Bacillus pumilus ATCC 7061]
          Length = 62

 Score = 33.9 bits (76), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 37/63 (58%), Gaps = 4/63 (6%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS-- 58
          M+R C +T +   +GN  SHA N T+R +  NL ++ ++ D   +  ++ +S  AL+S  
Sbjct: 1  MARKCVITGRKTKAGNNRSHAMNSTKRTWGANLQKVRILVD--GKPKRVYVSARALKSGK 58

Query: 59 VER 61
          VER
Sbjct: 59 VER 61


>gi|120406435|ref|YP_956264.1| 50S ribosomal protein L28 [Mycobacterium vanbaalenii PYR-1]
 gi|119959253|gb|ABM16258.1| LSU ribosomal protein L28P [Mycobacterium vanbaalenii PYR-1]
          Length = 78

 Score = 33.9 bits (76), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 37/63 (58%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS  C++T +    GN VSH++ +TRRR+ PN+   T       ++ +LR+S   ++ ++
Sbjct: 1  MSAHCQVTGRAPGFGNAVSHSHRRTRRRWNPNIQTKTYYLPSEGRRVKLRVSAKGIKVID 60

Query: 61 RQG 63
          R G
Sbjct: 61 RDG 63


>gi|83309420|ref|YP_419684.1| ribosomal protein L28 [Magnetospirillum magneticum AMB-1]
 gi|82944261|dbj|BAE49125.1| Ribosomal protein L28 [Magnetospirillum magneticum AMB-1]
          Length = 55

 Score = 33.9 bits (76), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 29/48 (60%)

Query: 48 QLRISKCALRSVERQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEK 95
          +LRIS   L+++E  GG+D +L +     LSA  R L+ +I + ++ K
Sbjct: 2  RLRISTNGLKTIEHNGGIDSYLLSIASTKLSAEARRLKKRIERALASK 49


>gi|317503232|ref|ZP_07961290.1| 50S ribosomal protein L28 [Prevotella salivae DSM 15606]
 gi|315665645|gb|EFV05254.1| 50S ribosomal protein L28 [Prevotella salivae DSM 15606]
          Length = 87

 Score = 33.9 bits (76), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 22/33 (66%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNL 33
          MS++C++T K    G  VSH+ ++T+R F  NL
Sbjct: 1  MSKICQITGKKAQIGCNVSHSKHRTKRSFDVNL 33


>gi|189485611|ref|YP_001956552.1| 50S ribosomal protein L28 [uncultured Termite group 1 bacterium
          phylotype Rs-D17]
 gi|226699181|sp|B1H0Q9|RL28_UNCTG RecName: Full=50S ribosomal protein L28
 gi|170287570|dbj|BAG14091.1| 50S ribosomal protein L28 [uncultured Termite group 1 bacterium
          phylotype Rs-D17]
          Length = 63

 Score = 33.9 bits (76), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 20/33 (60%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNL 33
          MS  C +  K   SGN VSH+N  ++R F PNL
Sbjct: 1  MSYKCAVCGKGSRSGNTVSHSNKASKRLFRPNL 33


>gi|303235498|ref|ZP_07322110.1| ribosomal protein L28 [Prevotella disiens FB035-09AN]
 gi|302484297|gb|EFL47280.1| ribosomal protein L28 [Prevotella disiens FB035-09AN]
          Length = 87

 Score = 33.9 bits (76), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 31/63 (49%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS++C++T K    G  VSH+ ++T+R F  NL               L+IS   LR + 
Sbjct: 1  MSKICQITGKKAQIGCNVSHSKHRTKRSFDVNLFSKKFYYVEEGCWISLKISTAGLRLIN 60

Query: 61 RQG 63
          + G
Sbjct: 61 KVG 63


>gi|54020115|ref|YP_115772.1| 50S ribosomal protein L28 [Mycoplasma hyopneumoniae 232]
 gi|67461351|sp|Q601E3|RL28_MYCH2 RecName: Full=50S ribosomal protein L28
 gi|53987288|gb|AAV27489.1| 50s ribosomal protein L28 [Mycoplasma hyopneumoniae 232]
          Length = 64

 Score = 33.9 bits (76), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 26/38 (68%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITL 38
          M+R  +++ +  +SGN  SHA N T+R+F  NL +ITL
Sbjct: 1  MARKDQISHRGPLSGNNRSHALNATKRKFNLNLQQITL 38


>gi|284045156|ref|YP_003395496.1| ribosomal protein L28 [Conexibacter woesei DSM 14684]
 gi|283949377|gb|ADB52121.1| ribosomal protein L28 [Conexibacter woesei DSM 14684]
          Length = 62

 Score = 33.9 bits (76), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 21/38 (55%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITL 38
          M R C +  K    GN  SH+   T+RRF PNL RI +
Sbjct: 1  MPRTCHVCNKGPAFGNSRSHSRVATKRRFDPNLQRIRI 38


>gi|307069699|ref|YP_003878176.1| 50S ribosomal subunit protein L28 [Candidatus Zinderia
          insecticola CARI]
 gi|306482959|gb|ADM89830.1| 50S ribosomal subunit protein L28 [Candidatus Zinderia
          insecticola CARI]
          Length = 69

 Score = 33.9 bits (76), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 25/33 (75%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNL 33
          MS +C +TKK ++ GNK+SH+N K +++FL N 
Sbjct: 1  MSNICIITKKKLIIGNKISHSNKKNKKKFLVNF 33


>gi|110801060|ref|YP_696420.1| 50S ribosomal protein L28 [Clostridium perfringens ATCC 13124]
 gi|168207260|ref|ZP_02633265.1| ribosomal protein L28 [Clostridium perfringens E str. JGS1987]
 gi|168210634|ref|ZP_02636259.1| ribosomal protein L28 [Clostridium perfringens B str. ATCC 3626]
 gi|168214210|ref|ZP_02639835.1| ribosomal protein L28 [Clostridium perfringens CPE str. F4969]
 gi|168217020|ref|ZP_02642645.1| ribosomal protein L28 [Clostridium perfringens NCTC 8239]
 gi|169342741|ref|ZP_02863781.1| ribosomal protein L28 [Clostridium perfringens C str. JGS1495]
 gi|182625863|ref|ZP_02953629.1| ribosomal protein L28 [Clostridium perfringens D str. JGS1721]
 gi|122958807|sp|Q0TPM0|RL28_CLOP1 RecName: Full=50S ribosomal protein L28
 gi|110675707|gb|ABG84694.1| 50S ribosomal protein L28 [Clostridium perfringens ATCC 13124]
 gi|169299247|gb|EDS81317.1| ribosomal protein L28 [Clostridium perfringens C str. JGS1495]
 gi|170661348|gb|EDT14031.1| ribosomal protein L28 [Clostridium perfringens E str. JGS1987]
 gi|170711305|gb|EDT23487.1| ribosomal protein L28 [Clostridium perfringens B str. ATCC 3626]
 gi|170714330|gb|EDT26512.1| ribosomal protein L28 [Clostridium perfringens CPE str. F4969]
 gi|177908897|gb|EDT71389.1| ribosomal protein L28 [Clostridium perfringens D str. JGS1721]
 gi|182380915|gb|EDT78394.1| ribosomal protein L28 [Clostridium perfringens NCTC 8239]
          Length = 63

 Score = 33.9 bits (76), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 13/39 (33%), Positives = 27/39 (69%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLI 39
          M+R CE+  K V++G + SH++ +++R + PN+ ++  I
Sbjct: 1  MARRCEICNKGVVAGVQYSHSHRQSKRTWAPNIKKVKAI 39


>gi|302899398|ref|XP_003048042.1| predicted protein [Nectria haematococca mpVI 77-13-4]
 gi|256728974|gb|EEU42329.1| predicted protein [Nectria haematococca mpVI 77-13-4]
          Length = 262

 Score = 33.9 bits (76), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 38/71 (53%), Gaps = 5/71 (7%)

Query: 15  GNKVSH-ANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFLSNSK 73
           GN V+   NNK RR + PN+   +     ++   + R++   L+++ R+GGL  +L  SK
Sbjct: 77  GNTVAEKYNNKARRFWRPNVHVKSFHLPAVDANVKTRLTLRVLKTIRREGGLQEYLLKSK 136

Query: 74  KENLSARMRTL 84
                AR++ L
Sbjct: 137 ----PARLKEL 143


>gi|256370632|ref|YP_003108457.1| 50S ribosomal protein L28 [Candidatus Sulcia muelleri SMDSEM]
 gi|256009424|gb|ACU52784.1| 50S ribosomal subunit protein L28 [Candidatus Sulcia muelleri
          SMDSEM]
          Length = 64

 Score = 33.9 bits (76), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 13/21 (61%), Positives = 17/21 (80%)

Query: 15 GNKVSHANNKTRRRFLPNLCR 35
          GNK+SHANNK +R+F  NL +
Sbjct: 2  GNKISHANNKIKRKFYLNLSK 22


>gi|198427866|ref|XP_002126303.1| PREDICTED: similar to mitochondrial ribosomal protein L28 [Ciona
           intestinalis]
          Length = 285

 Score = 33.9 bits (76), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 20/89 (22%), Positives = 45/89 (50%), Gaps = 3/89 (3%)

Query: 12  VMSGNKVSHANNKTRRRFL---PNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRF 68
           ++ G K +     +R+ +    P L   TL S+I+++K++  ++   L  ++   G D F
Sbjct: 112 IVWGFKYARGKKMSRKYYKVWKPQLFTRTLYSEILDKKFKTTVTGLTLDLIDEAYGFDFF 171

Query: 69  LSNSKKENLSARMRTLRSQILKKMSEKSS 97
           + N+    L      L+ +IL ++++K +
Sbjct: 172 ILNTSSTVLQEFGSKLKREILLRLADKDN 200


>gi|156100187|ref|XP_001615821.1| hypothetical protein [Plasmodium vivax SaI-1]
 gi|148804695|gb|EDL46094.1| hypothetical protein, conserved [Plasmodium vivax]
          Length = 281

 Score = 33.5 bits (75), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 17/62 (27%), Positives = 36/62 (58%), Gaps = 1/62 (1%)

Query: 17  KVSHANNKTRRRFLPNLCRITLISDIMEQKYQ-LRISKCALRSVERQGGLDRFLSNSKKE 75
           KVS++  KTR +  PN+ +  ++S+I+      ++++  AL +++  GG D ++  +  E
Sbjct: 60  KVSYSLKKTRIKLKPNVFKKHIVSNILNTIIPNVKVTTSALHAMDDAGGFDNYILRTPPE 119

Query: 76  NL 77
            L
Sbjct: 120 EL 121


>gi|256824927|ref|YP_003148887.1| 50S ribosomal protein L28P [Kytococcus sedentarius DSM 20547]
 gi|256688320|gb|ACV06122.1| LSU ribosomal protein L28P [Kytococcus sedentarius DSM 20547]
          Length = 64

 Score = 33.5 bits (75), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 13/36 (36%), Positives = 24/36 (66%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRI 36
          M+  C++  K    G+ +SH+N +T+RR+ PN+ R+
Sbjct: 1  MAATCDVCGKGPSFGHNISHSNRRTKRRWNPNIQRV 36


>gi|217077375|ref|YP_002335093.1| ribosomal protein L28 [Thermosipho africanus TCF52B]
 gi|226699176|sp|B7ICM5|RL28_THEAB RecName: Full=50S ribosomal protein L28
 gi|217037230|gb|ACJ75752.1| ribosomal protein L28 [Thermosipho africanus TCF52B]
          Length = 69

 Score = 33.5 bits (75), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 22/35 (62%)

Query: 5  CELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLI 39
          C++  K   SG  VSH+N +T R F PNL ++ ++
Sbjct: 4  CQICGKGPASGKNVSHSNRRTNRWFRPNLQKVRVL 38


>gi|221059319|ref|XP_002260305.1| hypothetical protein, conserved in Apicomplexan species [Plasmodium
           knowlesi strain H]
 gi|193810378|emb|CAQ41572.1| hypothetical protein, conserved in Apicomplexan species [Plasmodium
           knowlesi strain H]
          Length = 281

 Score = 33.5 bits (75), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 17/62 (27%), Positives = 36/62 (58%), Gaps = 1/62 (1%)

Query: 17  KVSHANNKTRRRFLPNLCRITLISDIMEQKYQ-LRISKCALRSVERQGGLDRFLSNSKKE 75
           KVS++  KTR +  PN+ +  ++S+I+      ++++  AL +++  GG D ++  +  E
Sbjct: 60  KVSYSLKKTRIKLKPNVFKKHIVSNILNTIIPNVKVTTSALHAMDDAGGFDNYILRTPPE 119

Query: 76  NL 77
            L
Sbjct: 120 EL 121


>gi|225848237|ref|YP_002728400.1| 50S ribosomal protein L28 [Sulfurihydrogenibium azorense Az-Fu1]
 gi|225643928|gb|ACN98978.1| ribosomal protein L28 [Sulfurihydrogenibium azorense Az-Fu1]
          Length = 63

 Score = 33.5 bits (75), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 28/52 (53%), Gaps = 3/52 (5%)

Query: 4  VCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCA 55
          VC++  K  + GN V+H+    RR + PNL R+ +   I+E     RI  CA
Sbjct: 3  VCQVCGKKTVFGNTVAHSATTERRTWKPNLRRVRV---ILEDGSTKRIYVCA 51


>gi|18310716|ref|NP_562650.1| 50S ribosomal protein L28 [Clostridium perfringens str. 13]
 gi|20139454|sp|Q8XJM2|RL28_CLOPE RecName: Full=50S ribosomal protein L28
 gi|18145397|dbj|BAB81440.1| probable 50S ribosomal protein L28 [Clostridium perfringens str.
          13]
          Length = 84

 Score = 33.5 bits (75), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 13/39 (33%), Positives = 27/39 (69%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLI 39
          M+R CE+  K V++G + SH++ +++R + PN+ ++  I
Sbjct: 1  MARRCEICNKGVVAGVQYSHSHRQSKRTWAPNIKKVKAI 39


>gi|308459187|ref|XP_003091918.1| hypothetical protein CRE_31545 [Caenorhabditis remanei]
 gi|308254815|gb|EFO98767.1| hypothetical protein CRE_31545 [Caenorhabditis remanei]
          Length = 358

 Score = 33.5 bits (75), Expect = 9.5,   Method: Composition-based stats.
 Identities = 16/69 (23%), Positives = 42/69 (60%), Gaps = 1/69 (1%)

Query: 29  FLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFLSNSKKENLSARM-RTLRSQ 87
           F P L    L S+++++  ++ +++ A+R ++   GLD ++  S++ +L ++   +L+ +
Sbjct: 181 FFPTLKTAVLYSEVLDKYIKVTVTERAMRLIDEHFGLDYYILQSQEIDLDSKFANSLKRE 240

Query: 88  ILKKMSEKS 96
           IL  ++ +S
Sbjct: 241 ILLTLATES 249


>gi|330467292|ref|YP_004405035.1| ribosomal protein L28 [Verrucosispora maris AB-18-032]
 gi|328810263|gb|AEB44435.1| ribosomal protein L28 [Verrucosispora maris AB-18-032]
          Length = 78

 Score = 33.5 bits (75), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 27/66 (40%), Positives = 42/66 (63%), Gaps = 6/66 (9%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNL--CRITLISDIMEQKY-QLRISKCALR 57
          MSR C++T      GN VSH++ +TRRR+ PNL   R  L S   E+++  L ++  AL+
Sbjct: 1  MSRRCDVTGAKPSFGNAVSHSHRRTRRRWNPNLQNHRYWLPS---ERRWVSLTLTAKALK 57

Query: 58 SVERQG 63
          +V+R+G
Sbjct: 58 TVDRKG 63


>gi|269122247|ref|YP_003310424.1| ribosomal protein L28 [Sebaldella termitidis ATCC 33386]
 gi|268616125|gb|ACZ10493.1| ribosomal protein L28 [Sebaldella termitidis ATCC 33386]
          Length = 87

 Score = 33.5 bits (75), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 25/39 (64%)

Query: 3  RVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISD 41
          ++CE+  K V  GN VSH++  T+R + PNL  +T+  D
Sbjct: 2  KICEVFGKKVGHGNLVSHSHRSTKRIWRPNLQVMTINVD 40


>gi|148654768|ref|YP_001274973.1| 50S ribosomal protein L28 [Roseiflexus sp. RS-1]
 gi|148566878|gb|ABQ89023.1| ribosomal protein L28 [Roseiflexus sp. RS-1]
          Length = 91

 Score = 33.5 bits (75), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 36/71 (50%), Gaps = 9/71 (12%)

Query: 1  MSRVCELTKKTVMSGNKVSHANN--------KTRRRFLPNLCRITLISDIMEQKYQLRIS 52
          M+R C+LT K V  G  + H  +        KT R F PN+ R T+    + +   L +S
Sbjct: 1  MAR-CDLTGKKVAFGRNIRHKASGGWARRAPKTNRTFRPNVHRHTIYVPEIGRSITLNLS 59

Query: 53 KCALRSVERQG 63
            ALR++ ++G
Sbjct: 60 TKALRTINKKG 70


>gi|91200830|emb|CAJ73884.1| conserved hypothetical protein [Candidatus Kuenenia
          stuttgartiensis]
          Length = 89

 Score = 33.5 bits (75), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 28/54 (51%), Gaps = 13/54 (24%)

Query: 1  MSRVCELTKKTVMSGNKVS-------------HANNKTRRRFLPNLCRITLISD 41
          MSRVCE+ KK  ++GN++                  KT+R+F PN+ ++  + D
Sbjct: 13 MSRVCEICKKKTVAGNQIETRGLAKWKGGVGKKITGKTKRKFKPNIQKVKALID 66


>gi|67461432|sp|Q6MTC5|RL28_MYCMS RecName: Full=50S ribosomal protein L28
 gi|301321118|gb|ADK69761.1| ribosomal protein L28 [Mycoplasma mycoides subsp. mycoides SC
          str. Gladysdale]
          Length = 65

 Score = 33.5 bits (75), Expect = 10.0,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 39/62 (62%), Gaps = 1/62 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+R   LT K+ +SG   SHA N T+R++  NL