BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780584|ref|YP_003064997.1| 50S ribosomal protein L28
[Candidatus Liberibacter asiaticus str. psy62]
         (97 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|126739957|ref|ZP_01755647.1| ribosomal protein L28 [Roseobacter sp. SK209-2-6]
 gi|126718776|gb|EBA15488.1| ribosomal protein L28 [Roseobacter sp. SK209-2-6]
          Length = 114

 Score =  139 bits (350), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 49/96 (51%), Positives = 67/96 (69%)

Query: 1   MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
           MSR CELT K  M+GN VSHANNKT+RRFLPNL  +TL S+ + +  +LRIS  ALRSV+
Sbjct: 19  MSRRCELTGKGPMTGNNVSHANNKTKRRFLPNLNDVTLQSETLGRGIKLRISAAALRSVD 78

Query: 61  RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKS 96
            +GGLD FL+ +K + LS     ++ +I K  + ++
Sbjct: 79  HRGGLDAFLAKAKDDELSTAALKVKKEIAKAQAAEA 114


>gi|260431018|ref|ZP_05784989.1| 50S ribosomal protein L28 [Silicibacter lacuscaerulensis ITI-1157]
 gi|260414846|gb|EEX08105.1| 50S ribosomal protein L28 [Silicibacter lacuscaerulensis ITI-1157]
          Length = 106

 Score =  137 bits (346), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 50/95 (52%), Positives = 66/95 (69%)

Query: 1   MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
           MSR CELT K  M+GN VSHANNKT+RRFLPNL  +TL S+ + +  +LRIS  ALRSV+
Sbjct: 12  MSRRCELTGKGPMTGNNVSHANNKTKRRFLPNLNDVTLQSETLGRGVKLRISAAALRSVD 71

Query: 61  RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEK 95
            +GGLD FL+ +K E+LS     ++ +I K  +  
Sbjct: 72  HRGGLDAFLAKAKDEDLSPNALKVKKEIAKAQASA 106


>gi|319406327|emb|CBI79964.1| Ribosomal protein L28 [Bartonella sp. AR 15-3]
          Length = 129

 Score =  135 bits (340), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 60/97 (61%), Positives = 74/97 (76%)

Query: 1   MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
           MSR CELT K V  GN VSHANNKTRRRFLPNLC +TLIS++++Q Y+LR+S  ALRSVE
Sbjct: 33  MSRACELTGKAVQYGNNVSHANNKTRRRFLPNLCNVTLISELLQQSYRLRVSASALRSVE 92

Query: 61  RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKSS 97
            +GGLD FL  +  + LS R R L+ QI+KK +EK +
Sbjct: 93  HRGGLDNFLIKADDKELSQRGRLLKRQIMKKKAEKVA 129


>gi|99080512|ref|YP_612666.1| 50S ribosomal protein L28 [Ruegeria sp. TM1040]
 gi|122398295|sp|Q1GIW2|RL28_SILST RecName: Full=50S ribosomal protein L28
 gi|99036792|gb|ABF63404.1| LSU ribosomal protein L28P [Ruegeria sp. TM1040]
          Length = 96

 Score =  133 bits (336), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 51/96 (53%), Positives = 68/96 (70%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT K  M+GN VSHANNKT+RRFLPNL  +TL S+ + +  +LRIS  ALRSV+
Sbjct: 1  MSRRCELTGKGPMTGNNVSHANNKTKRRFLPNLNDVTLQSETLGRGVKLRISAAALRSVD 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKS 96
           +GGLD FL+ +K E LSA    ++ +I K  + ++
Sbjct: 61 HRGGLDAFLAKAKDEELSAAALKVKKEIAKAQAAEA 96


>gi|259419342|ref|ZP_05743259.1| 50S ribosomal protein L28 [Silicibacter sp. TrichCH4B]
 gi|259345564|gb|EEW57418.1| 50S ribosomal protein L28 [Silicibacter sp. TrichCH4B]
          Length = 96

 Score =  133 bits (336), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 49/96 (51%), Positives = 66/96 (68%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT K  M+GN VSHANNKT+RRFLPNL  +TL S+ + +  +LRIS  ALRSV+
Sbjct: 1  MSRRCELTGKGPMTGNNVSHANNKTKRRFLPNLNDVTLQSETLGRGVKLRISAAALRSVD 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKS 96
           +GGLD FL+ +K   LS     ++ +I K  + ++
Sbjct: 61 HRGGLDAFLAKAKDAELSDAALKVKKEIAKAQAAQA 96


>gi|56695875|ref|YP_166226.1| 50S ribosomal protein L28 [Ruegeria pomeroyi DSS-3]
 gi|67461277|sp|Q5LUS9|RL28_SILPO RecName: Full=50S ribosomal protein L28
 gi|56677612|gb|AAV94278.1| ribosomal protein L28 [Ruegeria pomeroyi DSS-3]
          Length = 95

 Score =  132 bits (333), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 51/95 (53%), Positives = 66/95 (69%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT K  M+GN VSHANNKTRRRFLPNL  +TL S+ + +  +LRIS  ALRSV+
Sbjct: 1  MSRRCELTGKGPMTGNNVSHANNKTRRRFLPNLNDVTLQSETLGRGVKLRISAAALRSVD 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEK 95
           +GGLD FL+ +K E+LS     ++ +I K  +  
Sbjct: 61 HRGGLDAFLAKAKDEDLSDAALKVKKEIAKAQAAA 95


>gi|163737710|ref|ZP_02145127.1| GTP-binding protein LepA [Phaeobacter gallaeciensis BS107]
 gi|163744072|ref|ZP_02151439.1| ribosomal protein L28 [Phaeobacter gallaeciensis 2.10]
 gi|161382688|gb|EDQ07090.1| ribosomal protein L28 [Phaeobacter gallaeciensis 2.10]
 gi|161389236|gb|EDQ13588.1| GTP-binding protein LepA [Phaeobacter gallaeciensis BS107]
          Length = 96

 Score =  132 bits (333), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 48/96 (50%), Positives = 67/96 (69%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT K  M+GN VSHANNKT+RRFLPNL  +TL S+ + +  +LRIS  ALR+V+
Sbjct: 1  MSRRCELTGKGPMTGNNVSHANNKTKRRFLPNLNDVTLQSETLNRGIKLRISAAALRTVD 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKS 96
           +GGLD FL+ +K + LS     ++ +I K  + ++
Sbjct: 61 HRGGLDAFLAKAKDDELSNTALKVKKEIAKAQAAEA 96


>gi|197104188|ref|YP_002129565.1| 50S ribosomal protein L28 [Phenylobacterium zucineum HLK1]
 gi|226699143|sp|B4RFQ5|RL28_PHEZH RecName: Full=50S ribosomal protein L28
 gi|196477608|gb|ACG77136.1| 50S ribosomal protein L28 [Phenylobacterium zucineum HLK1]
          Length = 98

 Score =  132 bits (333), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 43/97 (44%), Positives = 66/97 (68%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CE+T    M G+ VSH+N KT+RRF+PNL ++T++SD + Q   LR++  ALR+V+
Sbjct: 1  MSRRCEITGVGPMVGHNVSHSNIKTKRRFMPNLTKVTVLSDALGQNVTLRVTNAALRTVD 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKSS 97
           +GGLD  L  ++ E LS R   ++ QI  K++E+ +
Sbjct: 61 AKGGLDAVLLKARDEVLSPRALKIKRQIKAKLAEQPA 97


>gi|310816617|ref|YP_003964581.1| 50S ribosomal protein L28 [Ketogulonicigenium vulgare Y25]
 gi|308755352|gb|ADO43281.1| 50S ribosomal protein L28 [Ketogulonicigenium vulgare Y25]
          Length = 98

 Score =  131 bits (331), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 47/88 (53%), Positives = 61/88 (69%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT K  M GN VSHANNKT+RRFLPNL  +TL SD++ + + LR+S   LRSV+
Sbjct: 1  MSRRCELTGKGPMVGNNVSHANNKTKRRFLPNLQDVTLQSDVLGRSFTLRVSAAGLRSVD 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQI 88
           +GGLD +L+ +K   LS     L+ +I
Sbjct: 61 HRGGLDAYLARAKDVELSDNALKLKKEI 88


>gi|254476141|ref|ZP_05089527.1| ribosomal protein L28 [Ruegeria sp. R11]
 gi|214030384|gb|EEB71219.1| ribosomal protein L28 [Ruegeria sp. R11]
          Length = 96

 Score =  131 bits (331), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 50/96 (52%), Positives = 67/96 (69%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT K  M+GN VSHANNKT+RRFLPNL  +TL S+ + +  +LRIS  ALRSV+
Sbjct: 1  MSRRCELTGKGPMTGNNVSHANNKTKRRFLPNLNDVTLQSETLGRGVKLRISAAALRSVD 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKS 96
           +GGLD FL+ +K E LS+    ++ +I K  +  +
Sbjct: 61 HRGGLDAFLAKAKDEELSSAALKVKKEIAKAQAANA 96


>gi|239833067|ref|ZP_04681396.1| ribosomal protein L28 [Ochrobactrum intermedium LMG 3301]
 gi|239825334|gb|EEQ96902.1| ribosomal protein L28 [Ochrobactrum intermedium LMG 3301]
          Length = 118

 Score =  130 bits (329), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 59/97 (60%), Positives = 71/97 (73%)

Query: 1   MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
           MSR CELT K+V  GN VSHANNKTRRRFLPNLC +TL+S+ + Q Y+LR+S  ALRSVE
Sbjct: 21  MSRACELTGKSVQYGNNVSHANNKTRRRFLPNLCNVTLMSETLGQSYRLRVSANALRSVE 80

Query: 61  RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKSS 97
            +GGLD FL  S  + LS R R L+ QI KK +E  +
Sbjct: 81  HRGGLDAFLVKSDDKELSQRARLLKRQIAKKQAEAVA 117


>gi|110678983|ref|YP_681990.1| ribosomal protein L28 [Roseobacter denitrificans OCh 114]
 gi|109455099|gb|ABG31304.1| ribosomal protein L28 [Roseobacter denitrificans OCh 114]
          Length = 120

 Score =  130 bits (329), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 49/91 (53%), Positives = 66/91 (72%)

Query: 1   MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
           MSRVCELT K  M+GN VSHANNKTRRRFLPNL  +TL S+ + + ++ RIS  ALR+V+
Sbjct: 22  MSRVCELTGKGPMTGNNVSHANNKTRRRFLPNLNDVTLQSEALGRGFKFRISAAALRTVD 81

Query: 61  RQGGLDRFLSNSKKENLSARMRTLRSQILKK 91
            +GGLD+F++ +K  +LSA    ++  I K 
Sbjct: 82  HRGGLDKFMAKAKDSDLSANALKVKKAISKA 112


>gi|260427227|ref|ZP_05781206.1| 50S ribosomal protein L28 [Citreicella sp. SE45]
 gi|260421719|gb|EEX14970.1| 50S ribosomal protein L28 [Citreicella sp. SE45]
          Length = 96

 Score =  130 bits (329), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 51/96 (53%), Positives = 68/96 (70%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVCELT K  M+G+ VSHANNKT+RRFLPNL  +TL S+ + +  +LRIS  ALRSV+
Sbjct: 1  MSRVCELTGKGPMTGHNVSHANNKTKRRFLPNLNDVTLQSETLGRGVKLRISASALRSVD 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKS 96
           +GGLD+FL+ +K   LS     L+ +I K  + K+
Sbjct: 61 HRGGLDKFLAKAKDTELSTNALKLKKEIAKAQAAKA 96


>gi|89055915|ref|YP_511366.1| 50S ribosomal protein L28 [Jannaschia sp. CCS1]
 gi|122497849|sp|Q28LS1|RL28_JANSC RecName: Full=50S ribosomal protein L28
 gi|88865464|gb|ABD56341.1| LSU ribosomal protein L28P [Jannaschia sp. CCS1]
          Length = 96

 Score =  130 bits (328), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 49/96 (51%), Positives = 73/96 (76%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVCELT K  M+GN VSHANNKT+RRFLPNL  +TL SD+++++++ RIS  ALR+V+
Sbjct: 1  MSRVCELTGKGPMTGNNVSHANNKTKRRFLPNLSDVTLGSDLLDRRFKFRISNAALRTVD 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKS 96
           +GGLD F++ +K + LS R   ++ +I+K  + ++
Sbjct: 61 HRGGLDAFMAKAKDDELSTRALKIKKEIVKAQAAQA 96


>gi|153008253|ref|YP_001369468.1| 50S ribosomal protein L28 [Ochrobactrum anthropi ATCC 49188]
 gi|166226592|sp|A6WXD5|RL28_OCHA4 RecName: Full=50S ribosomal protein L28
 gi|151560141|gb|ABS13639.1| ribosomal protein L28 [Ochrobactrum anthropi ATCC 49188]
          Length = 99

 Score =  130 bits (328), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 59/96 (61%), Positives = 71/96 (73%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT K+V  GN VSHANNKTRRRFLPNLC +TL+S+ + Q Y+LR+S  ALRSVE
Sbjct: 1  MSRACELTGKSVQYGNNVSHANNKTRRRFLPNLCNVTLMSETLGQSYRLRVSANALRSVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKS 96
           +GGLD FL  S  + LS R R L+ QI KK +E +
Sbjct: 61 HRGGLDAFLVKSDDKELSQRARLLKRQIAKKQAEAA 96


>gi|114706269|ref|ZP_01439171.1| 50S ribosomal protein L28 [Fulvimarina pelagi HTCC2506]
 gi|114538130|gb|EAU41252.1| 50S ribosomal protein L28 [Fulvimarina pelagi HTCC2506]
          Length = 100

 Score =  130 bits (328), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 64/96 (66%), Positives = 75/96 (78%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVCELT K VMSGN VSHANNKTRRRFLPNLC +TLISD + Q+Y+L++S  ALRSVE
Sbjct: 1  MSRVCELTGKGVMSGNNVSHANNKTRRRFLPNLCSVTLISDALGQRYRLKVSAHALRSVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKS 96
           +GGLD FL  S +  LS R R L+ QI KK++E S
Sbjct: 61 HRGGLDAFLLKSHENELSQRARLLKRQIAKKLAETS 96


>gi|114327278|ref|YP_744435.1| 50S ribosomal protein L28 [Granulibacter bethesdensis CGDNIH1]
 gi|114315452|gb|ABI61512.1| LSU ribosomal protein L28P [Granulibacter bethesdensis CGDNIH1]
          Length = 133

 Score =  130 bits (327), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 44/96 (45%), Positives = 63/96 (65%)

Query: 1   MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
           MSR C++T K V++GN VSHANNKTRRRFLPNL    L+SD +    +LR+S  A+R+VE
Sbjct: 34  MSRRCQITGKGVLTGNNVSHANNKTRRRFLPNLQVAGLLSDTLGTSVRLRLSTRAIRTVE 93

Query: 61  RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKS 96
           + GG+D FL  +    L      L+ +I +  ++K+
Sbjct: 94  KNGGIDAFLLGTPDRQLPTEALELKRRITRAQAKKA 129


>gi|17986340|ref|NP_538974.1| 50S ribosomal protein L28 [Brucella melitensis bv. 1 str. 16M]
 gi|23502863|ref|NP_698990.1| 50S ribosomal protein L28 [Brucella suis 1330]
 gi|62290860|ref|YP_222653.1| 50S ribosomal protein L28 [Brucella abortus bv. 1 str. 9-941]
 gi|82700772|ref|YP_415346.1| 50S ribosomal protein L28 [Brucella melitensis biovar Abortus
          2308]
 gi|161619931|ref|YP_001593818.1| 50S ribosomal protein L28 [Brucella canis ATCC 23365]
 gi|163844035|ref|YP_001628439.1| 50S ribosomal protein L28 [Brucella suis ATCC 23445]
 gi|189025077|ref|YP_001935845.1| 50S ribosomal protein L28 [Brucella abortus S19]
 gi|225628209|ref|ZP_03786244.1| ribosomal protein L28 [Brucella ceti str. Cudo]
 gi|225853449|ref|YP_002733682.1| 50S ribosomal protein L28 [Brucella melitensis ATCC 23457]
 gi|237816370|ref|ZP_04595363.1| ribosomal protein L28 [Brucella abortus str. 2308 A]
 gi|254690152|ref|ZP_05153406.1| 50S ribosomal protein L28 [Brucella abortus bv. 6 str. 870]
 gi|254694642|ref|ZP_05156470.1| 50S ribosomal protein L28 [Brucella abortus bv. 3 str. Tulya]
 gi|254696267|ref|ZP_05158095.1| 50S ribosomal protein L28 [Brucella abortus bv. 2 str. 86/8/59]
 gi|254700652|ref|ZP_05162480.1| 50S ribosomal protein L28 [Brucella suis bv. 5 str. 513]
 gi|254705022|ref|ZP_05166850.1| 50S ribosomal protein L28 [Brucella suis bv. 3 str. 686]
 gi|254707461|ref|ZP_05169289.1| 50S ribosomal protein L28 [Brucella pinnipedialis M163/99/10]
 gi|254708997|ref|ZP_05170808.1| 50S ribosomal protein L28 [Brucella pinnipedialis B2/94]
 gi|254713576|ref|ZP_05175387.1| 50S ribosomal protein L28 [Brucella ceti M644/93/1]
 gi|254716070|ref|ZP_05177881.1| 50S ribosomal protein L28 [Brucella ceti M13/05/1]
 gi|254731185|ref|ZP_05189763.1| 50S ribosomal protein L28 [Brucella abortus bv. 4 str. 292]
 gi|256030523|ref|ZP_05444137.1| 50S ribosomal protein L28 [Brucella pinnipedialis M292/94/1]
 gi|256045618|ref|ZP_05448496.1| 50S ribosomal protein L28 [Brucella melitensis bv. 1 str. Rev.1]
 gi|256059984|ref|ZP_05450168.1| 50S ribosomal protein L28 [Brucella neotomae 5K33]
 gi|256112342|ref|ZP_05453263.1| 50S ribosomal protein L28 [Brucella melitensis bv. 3 str. Ether]
 gi|256158509|ref|ZP_05456407.1| 50S ribosomal protein L28 [Brucella ceti M490/95/1]
 gi|256253928|ref|ZP_05459464.1| 50S ribosomal protein L28 [Brucella ceti B1/94]
 gi|256258406|ref|ZP_05463942.1| 50S ribosomal protein L28 [Brucella abortus bv. 9 str. C68]
 gi|256263069|ref|ZP_05465601.1| 50S ribosomal protein L28 [Brucella melitensis bv. 2 str. 63/9]
 gi|256370415|ref|YP_003107926.1| 50S ribosomal protein L28 [Brucella microti CCM 4915]
 gi|260169428|ref|ZP_05756239.1| 50S ribosomal protein L28 [Brucella sp. F5/99]
 gi|260546125|ref|ZP_05821865.1| LSU ribosomal protein L28P [Brucella abortus NCTC 8038]
 gi|260567510|ref|ZP_05837980.1| ribosomal protein L28 [Brucella suis bv. 4 str. 40]
 gi|260755689|ref|ZP_05868037.1| LSU ribosomal protein L28P [Brucella abortus bv. 6 str. 870]
 gi|260758914|ref|ZP_05871262.1| LSU ribosomal protein L28P [Brucella abortus bv. 4 str. 292]
 gi|260760637|ref|ZP_05872980.1| LSU ribosomal protein L28P [Brucella abortus bv. 2 str. 86/8/59]
 gi|260884715|ref|ZP_05896329.1| 50S ribosomal protein L28 [Brucella abortus bv. 9 str. C68]
 gi|261214964|ref|ZP_05929245.1| LSU ribosomal protein L28P [Brucella abortus bv. 3 str. Tulya]
 gi|261217836|ref|ZP_05932117.1| LSU ribosomal protein L28P [Brucella ceti M13/05/1]
 gi|261221066|ref|ZP_05935347.1| 50S ribosomal protein L28 [Brucella ceti B1/94]
 gi|261314949|ref|ZP_05954146.1| LSU ribosomal protein L28P [Brucella pinnipedialis M163/99/10]
 gi|261316494|ref|ZP_05955691.1| LSU ribosomal protein L28P [Brucella pinnipedialis B2/94]
 gi|261321314|ref|ZP_05960511.1| LSU ribosomal protein L28P [Brucella ceti M644/93/1]
 gi|261323957|ref|ZP_05963154.1| 50S ribosomal protein L28 [Brucella neotomae 5K33]
 gi|261751158|ref|ZP_05994867.1| LSU ribosomal protein L28P [Brucella suis bv. 5 str. 513]
 gi|261755721|ref|ZP_05999430.1| LSU ribosomal protein L28P [Brucella suis bv. 3 str. 686]
 gi|261758952|ref|ZP_06002661.1| ribosomal protein L28 [Brucella sp. F5/99]
 gi|265987567|ref|ZP_06100124.1| 50S ribosomal protein L28 [Brucella pinnipedialis M292/94/1]
 gi|265992039|ref|ZP_06104596.1| 50S ribosomal protein L28 [Brucella melitensis bv. 1 str. Rev.1]
 gi|265993775|ref|ZP_06106332.1| 50S ribosomal protein L28 [Brucella melitensis bv. 3 str. Ether]
 gi|265997026|ref|ZP_06109583.1| 50S ribosomal protein L28 [Brucella ceti M490/95/1]
 gi|294851247|ref|ZP_06791920.1| large subunit ribosomal protein L28 [Brucella sp. NVSL 07-0026]
 gi|297247245|ref|ZP_06930963.1| large subunit ribosomal protein L28 [Brucella abortus bv. 5 str.
          B3196]
 gi|54039146|sp|P66141|RL28_BRUSU RecName: Full=50S ribosomal protein L28
 gi|54041846|sp|P66140|RL28_BRUME RecName: Full=50S ribosomal protein L28
 gi|75496122|sp|Q57AP2|RL28_BRUAB RecName: Full=50S ribosomal protein L28
 gi|123547363|sp|Q2YR56|RL28_BRUA2 RecName: Full=50S ribosomal protein L28
 gi|189042425|sp|A9M9A0|RL28_BRUC2 RecName: Full=50S ribosomal protein L28
 gi|189042426|sp|B0CJB7|RL28_BRUSI RecName: Full=50S ribosomal protein L28
 gi|226738040|sp|B2S8R7|RL28_BRUA1 RecName: Full=50S ribosomal protein L28
 gi|254801345|sp|C0RFQ6|RL28_BRUMB RecName: Full=50S ribosomal protein L28
 gi|17981927|gb|AAL51238.1| lsu ribosomal protein l28p [Brucella melitensis bv. 1 str. 16M]
 gi|23348891|gb|AAN30905.1| ribosomal protein L28 [Brucella suis 1330]
 gi|62196992|gb|AAX75292.1| RpmB, ribosomal protein L28 [Brucella abortus bv. 1 str. 9-941]
 gi|82616873|emb|CAJ11972.1| Ribosomal protein L28:ATP/GTP-binding site motif A (P-loop)
          [Brucella melitensis biovar Abortus 2308]
 gi|161336742|gb|ABX63047.1| ribosomal protein L28 [Brucella canis ATCC 23365]
 gi|163674758|gb|ABY38869.1| ribosomal protein L28 [Brucella suis ATCC 23445]
 gi|189020649|gb|ACD73371.1| Ribosomal protein L28 [Brucella abortus S19]
 gi|225617034|gb|EEH14081.1| ribosomal protein L28 [Brucella ceti str. Cudo]
 gi|225641814|gb|ACO01728.1| ribosomal protein L28 [Brucella melitensis ATCC 23457]
 gi|237788437|gb|EEP62652.1| ribosomal protein L28 [Brucella abortus str. 2308 A]
 gi|256000578|gb|ACU48977.1| 50S ribosomal protein L28 [Brucella microti CCM 4915]
 gi|260096232|gb|EEW80108.1| LSU ribosomal protein L28P [Brucella abortus NCTC 8038]
 gi|260157028|gb|EEW92108.1| ribosomal protein L28 [Brucella suis bv. 4 str. 40]
 gi|260669232|gb|EEX56172.1| LSU ribosomal protein L28P [Brucella abortus bv. 4 str. 292]
 gi|260671069|gb|EEX57890.1| LSU ribosomal protein L28P [Brucella abortus bv. 2 str. 86/8/59]
 gi|260675797|gb|EEX62618.1| LSU ribosomal protein L28P [Brucella abortus bv. 6 str. 870]
 gi|260874243|gb|EEX81312.1| 50S ribosomal protein L28 [Brucella abortus bv. 9 str. C68]
 gi|260916571|gb|EEX83432.1| LSU ribosomal protein L28P [Brucella abortus bv. 3 str. Tulya]
 gi|260919650|gb|EEX86303.1| 50S ribosomal protein L28 [Brucella ceti B1/94]
 gi|260922925|gb|EEX89493.1| LSU ribosomal protein L28P [Brucella ceti M13/05/1]
 gi|261294004|gb|EEX97500.1| LSU ribosomal protein L28P [Brucella ceti M644/93/1]
 gi|261295717|gb|EEX99213.1| LSU ribosomal protein L28P [Brucella pinnipedialis B2/94]
 gi|261299937|gb|EEY03434.1| 50S ribosomal protein L28 [Brucella neotomae 5K33]
 gi|261303975|gb|EEY07472.1| LSU ribosomal protein L28P [Brucella pinnipedialis M163/99/10]
 gi|261738936|gb|EEY26932.1| ribosomal protein L28 [Brucella sp. F5/99]
 gi|261740911|gb|EEY28837.1| LSU ribosomal protein L28P [Brucella suis bv. 5 str. 513]
 gi|261745474|gb|EEY33400.1| LSU ribosomal protein L28P [Brucella suis bv. 3 str. 686]
 gi|262551494|gb|EEZ07484.1| 50S ribosomal protein L28 [Brucella ceti M490/95/1]
 gi|262764756|gb|EEZ10677.1| 50S ribosomal protein L28 [Brucella melitensis bv. 3 str. Ether]
 gi|263003105|gb|EEZ15398.1| 50S ribosomal protein L28 [Brucella melitensis bv. 1 str. Rev.1]
 gi|263092961|gb|EEZ17122.1| 50S ribosomal protein L28 [Brucella melitensis bv. 2 str. 63/9]
 gi|264659764|gb|EEZ30025.1| 50S ribosomal protein L28 [Brucella pinnipedialis M292/94/1]
 gi|294819836|gb|EFG36835.1| large subunit ribosomal protein L28 [Brucella sp. NVSL 07-0026]
 gi|297174414|gb|EFH33761.1| large subunit ribosomal protein L28 [Brucella abortus bv. 5 str.
          B3196]
 gi|326410012|gb|ADZ67077.1| Ribosomal protein L28 [Brucella melitensis M28]
 gi|326539729|gb|ADZ87944.1| ribosomal protein L28 [Brucella melitensis M5-90]
          Length = 97

 Score =  129 bits (326), Expect = 9e-29,   Method: Composition-based stats.
 Identities = 60/97 (61%), Positives = 72/97 (74%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT K+V  GN VSHANN+TRRRFLPNLC +TLIS+ + Q Y+LRIS  ALRSVE
Sbjct: 1  MSRACELTGKSVQYGNNVSHANNRTRRRFLPNLCNVTLISETLGQSYRLRISANALRSVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKSS 97
           +GGLD FL  S  + LS R R L+ QI KK +E ++
Sbjct: 61 HRGGLDAFLVKSDDKELSQRARLLKRQIAKKQAEAAA 97


>gi|159185825|ref|NP_356994.2| 50S ribosomal protein L28 [Agrobacterium tumefaciens str. C58]
 gi|332716407|ref|YP_004443873.1| 50S ribosomal protein L28 [Agrobacterium sp. H13-3]
 gi|22096068|sp|Q8U9V8|RL28_AGRT5 RecName: Full=50S ribosomal protein L28
 gi|159140959|gb|AAK89779.2| 50S ribosomal protein L28 [Agrobacterium tumefaciens str. C58]
 gi|325063092|gb|ADY66782.1| 50S ribosomal protein L28 [Agrobacterium sp. H13-3]
          Length = 96

 Score =  129 bits (326), Expect = 9e-29,   Method: Composition-based stats.
 Identities = 61/96 (63%), Positives = 74/96 (77%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVCELT K V +GN VSHANNKT+RRFLPNLC++TLISD + Q+++LR+S  ALRSVE
Sbjct: 1  MSRVCELTGKGVQTGNNVSHANNKTKRRFLPNLCQVTLISDALGQRFRLRVSAAALRSVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKS 96
           +GGLD FL  S +  LS R R LR QI KK +E +
Sbjct: 61 HRGGLDAFLLKSGENELSMRARLLRRQIAKKTAEAA 96


>gi|254718063|ref|ZP_05179874.1| 50S ribosomal protein L28 [Brucella sp. 83/13]
 gi|265983010|ref|ZP_06095745.1| LSU ribosomal protein L28P [Brucella sp. 83/13]
 gi|306837624|ref|ZP_07470495.1| ribosomal protein L28 [Brucella sp. NF 2653]
 gi|306842858|ref|ZP_07475496.1| ribosomal protein L28 [Brucella sp. BO2]
 gi|306843444|ref|ZP_07476045.1| ribosomal protein L28 [Brucella sp. BO1]
 gi|264661602|gb|EEZ31863.1| LSU ribosomal protein L28P [Brucella sp. 83/13]
 gi|306276135|gb|EFM57835.1| ribosomal protein L28 [Brucella sp. BO1]
 gi|306286980|gb|EFM58495.1| ribosomal protein L28 [Brucella sp. BO2]
 gi|306407331|gb|EFM63539.1| ribosomal protein L28 [Brucella sp. NF 2653]
          Length = 97

 Score =  129 bits (326), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 61/97 (62%), Positives = 72/97 (74%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT K+V  GN VSHANNKTRRRFLPNLC +TLIS+ + Q Y+LRIS  ALRSVE
Sbjct: 1  MSRACELTGKSVQYGNNVSHANNKTRRRFLPNLCNVTLISETLGQSYRLRISANALRSVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKSS 97
           +GGLD FL  S  + LS R R L+ QI KK +E ++
Sbjct: 61 HRGGLDAFLVKSDDKELSQRARLLKRQIAKKQAEAAA 97


>gi|75674604|ref|YP_317025.1| 50S ribosomal protein L28 [Nitrobacter winogradskyi Nb-255]
 gi|123614188|sp|Q3SVL8|RL28_NITWN RecName: Full=50S ribosomal protein L28
 gi|74419474|gb|ABA03673.1| LSU ribosomal protein L28P [Nitrobacter winogradskyi Nb-255]
          Length = 97

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 45/96 (46%), Positives = 63/96 (65%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT K  + G+KVSH+N KT+RRFLPNL  +T +S+ +    + R+S  ALRSV+
Sbjct: 1  MSRRCELTAKAPLVGHKVSHSNIKTKRRFLPNLVNVTFVSETLSSSVRFRVSTHALRSVD 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKS 96
           +GG D FL  ++   LS +   L+ QI KK + K+
Sbjct: 61 HRGGFDAFLLKARDSELSPKAIELKRQIQKKQAAKA 96


>gi|84514439|ref|ZP_01001803.1| ribosomal protein L28 [Loktanella vestfoldensis SKA53]
 gi|84511490|gb|EAQ07943.1| ribosomal protein L28 [Loktanella vestfoldensis SKA53]
          Length = 95

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 47/95 (49%), Positives = 65/95 (68%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT K  MSGN VSHA N TRRRFLPNL  +TL SD++ + ++L+IS  ALR+V+
Sbjct: 1  MSRRCELTGKGPMSGNNVSHAKNHTRRRFLPNLQDVTLQSDVLGRSFKLKISNAALRTVD 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEK 95
           +GGLD F++ +K+  LS     ++ +I K  +  
Sbjct: 61 HRGGLDAFMAKAKEAELSPDALKIKKEIAKATAAA 95


>gi|240851331|ref|YP_002972734.1| 50S ribosomal protein L28 [Bartonella grahamii as4aup]
 gi|240268454|gb|ACS52042.1| 50S ribosomal protein L28 [Bartonella grahamii as4aup]
          Length = 105

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 61/95 (64%), Positives = 75/95 (78%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT KTV+ GN VSHANNKTRRRFLPNLC +TLIS++++Q Y+LRIS  ALRSVE
Sbjct: 1  MSRACELTGKTVLYGNNVSHANNKTRRRFLPNLCNVTLISEVLQQSYRLRISASALRSVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEK 95
           +GGLD FL  +  + LS R R L+ QI+KK +E+
Sbjct: 61 HRGGLDAFLVKADDKELSQRARLLKRQIIKKKAEQ 95


>gi|86136561|ref|ZP_01055140.1| ribosomal protein L28 [Roseobacter sp. MED193]
 gi|85827435|gb|EAQ47631.1| ribosomal protein L28 [Roseobacter sp. MED193]
          Length = 96

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 48/96 (50%), Positives = 65/96 (67%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT K  M+GN VSHA N+TRRRFLPNL  +TL S+ + +  +L+IS  ALR+V+
Sbjct: 1  MSRRCELTGKGPMTGNNVSHAKNRTRRRFLPNLNDVTLQSETLGRGIKLKISAAALRTVD 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKS 96
           +GGLD FL+ +K E LS     ++ +I K  S  +
Sbjct: 61 HRGGLDAFLAKAKDEELSTAALKVKKEIAKAQSAAA 96


>gi|148559224|ref|YP_001259829.1| 50S ribosomal protein L28 [Brucella ovis ATCC 25840]
 gi|166226549|sp|A5VSY2|RL28_BRUO2 RecName: Full=50S ribosomal protein L28
 gi|148370481|gb|ABQ60460.1| 50S ribosomal protein L28 [Brucella ovis ATCC 25840]
          Length = 97

 Score =  128 bits (323), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 59/97 (60%), Positives = 71/97 (73%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT K+V  GN VSHANN+TR RFLPNLC +TLIS+ + Q Y+LRIS  ALRSVE
Sbjct: 1  MSRACELTGKSVQYGNNVSHANNRTRCRFLPNLCNVTLISETLGQSYRLRISANALRSVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKSS 97
           +GGLD FL  S  + LS R R L+ QI KK +E ++
Sbjct: 61 HRGGLDAFLVKSDDKELSQRARLLKRQIAKKQAEAAA 97


>gi|114764005|ref|ZP_01443246.1| ribosomal protein L28 [Pelagibaca bermudensis HTCC2601]
 gi|114543597|gb|EAU46611.1| ribosomal protein L28 [Roseovarius sp. HTCC2601]
          Length = 96

 Score =  128 bits (323), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 50/96 (52%), Positives = 68/96 (70%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVCELT K  M+G+ VSHANNKT+RRFLPNL  +TL S+ + +  +LRIS  ALRSV+
Sbjct: 1  MSRVCELTGKGPMTGHNVSHANNKTKRRFLPNLNDVTLQSETLGRGVKLRISASALRSVD 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKS 96
           +GGLD+FL  +K   LSA    ++ +I K  + ++
Sbjct: 61 HRGGLDKFLDKAKDAELSATALKVKKEIAKARAAQA 96


>gi|49474767|ref|YP_032809.1| 50S ribosomal protein L28 [Bartonella quintana str. Toulouse]
 gi|67461402|sp|Q6FYG6|RL28_BARQU RecName: Full=50S ribosomal protein L28
 gi|49240271|emb|CAF26742.1| 50s ribosomal protein l28 [Bartonella quintana str. Toulouse]
          Length = 97

 Score =  128 bits (323), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 60/97 (61%), Positives = 76/97 (78%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT KTV  GN VSHANNKTRRRFLPNLC +TLIS++++Q Y+LR+S  ALRSVE
Sbjct: 1  MSRACELTGKTVQYGNNVSHANNKTRRRFLPNLCNVTLISEVLQQSYRLRVSASALRSVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKSS 97
           +GGLD FL  +  + LS R R L+ QI+KK +E+++
Sbjct: 61 HRGGLDSFLVRADDKELSQRARLLKRQIVKKKAEQAA 97


>gi|227823244|ref|YP_002827216.1| 50S ribosomal protein L28 [Sinorhizobium fredii NGR234]
 gi|254801373|sp|C3MHW1|RL28_RHISN RecName: Full=50S ribosomal protein L28
 gi|227342245|gb|ACP26463.1| 50S ribosomal protein L28 [Sinorhizobium fredii NGR234]
          Length = 96

 Score =  128 bits (323), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 58/96 (60%), Positives = 73/96 (76%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT K V SG+ VSHANNKT+R+FLPNLC +TLISD + Q+++LR+S  ALRSVE
Sbjct: 1  MSRSCELTGKGVQSGHNVSHANNKTKRKFLPNLCNVTLISDALGQRFRLRVSAAALRSVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKS 96
           +GGLD FL  + +  LS R R LR QI+KK +E +
Sbjct: 61 HRGGLDAFLLKADENELSMRARLLRRQIVKKAAEAA 96


>gi|149913435|ref|ZP_01901968.1| ribosomal protein L28 [Roseobacter sp. AzwK-3b]
 gi|149812555|gb|EDM72384.1| ribosomal protein L28 [Roseobacter sp. AzwK-3b]
          Length = 96

 Score =  128 bits (323), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 51/96 (53%), Positives = 66/96 (68%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT K  MSG   SHANNKT+RR+LPNL  +TL S+I+ +  +LRIS  ALRSV+
Sbjct: 1  MSRRCELTGKGPMSGFNSSHANNKTKRRYLPNLQDVTLQSEILNRGVKLRISAAALRSVD 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKS 96
           +GGLD FL+ +K E LSA    L+ +I K  +  +
Sbjct: 61 HRGGLDAFLAKAKDEELSANALKLKKEISKAQAAAA 96


>gi|209551162|ref|YP_002283079.1| 50S ribosomal protein L28 [Rhizobium leguminosarum bv. trifolii
          WSM2304]
 gi|226699153|sp|B5ZRX6|RL28_RHILW RecName: Full=50S ribosomal protein L28
 gi|209536918|gb|ACI56853.1| ribosomal protein L28 [Rhizobium leguminosarum bv. trifolii
          WSM2304]
          Length = 99

 Score =  128 bits (323), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 61/96 (63%), Positives = 76/96 (79%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVCELT K V++GN VSHANNKT+RRFLPNLC++TLISD + Q+Y+LR+S  ALRSVE
Sbjct: 1  MSRVCELTGKAVLTGNNVSHANNKTKRRFLPNLCQVTLISDALNQRYRLRVSAAALRSVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKS 96
           +GGLD FL  + +  LS R R LR QI+KK +E +
Sbjct: 61 HRGGLDAFLLKASETELSMRARLLRRQIVKKTAEAA 96


>gi|190893654|ref|YP_001980196.1| 50S ribosomal protein L28 [Rhizobium etli CIAT 652]
 gi|218458580|ref|ZP_03498671.1| 50S ribosomal protein L28 [Rhizobium etli Kim 5]
 gi|218510181|ref|ZP_03508059.1| 50S ribosomal protein L28 [Rhizobium etli Brasil 5]
 gi|218517127|ref|ZP_03513967.1| 50S ribosomal protein L28 [Rhizobium etli 8C-3]
 gi|226699152|sp|B3PPE3|RL28_RHIE6 RecName: Full=50S ribosomal protein L28
 gi|190698933|gb|ACE93018.1| 50S ribosomal protein L28 [Rhizobium etli CIAT 652]
 gi|327188703|gb|EGE55902.1| 50S ribosomal protein L28 [Rhizobium etli CNPAF512]
          Length = 99

 Score =  128 bits (323), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 61/96 (63%), Positives = 76/96 (79%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVCELT K V++GN VSHANNKT+RRFLPNLC++TLISD + Q+Y+LR+S  ALRSVE
Sbjct: 1  MSRVCELTGKAVLTGNNVSHANNKTKRRFLPNLCQVTLISDALNQRYRLRVSAAALRSVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKS 96
           +GGLD FL  + +  LS R R LR QI+KK +E +
Sbjct: 61 HRGGLDAFLLKASENELSMRARLLRRQIVKKTAEAA 96


>gi|15966421|ref|NP_386774.1| 50S ribosomal protein L28 [Sinorhizobium meliloti 1021]
 gi|307300541|ref|ZP_07580321.1| ribosomal protein L28 [Sinorhizobium meliloti BL225C]
 gi|307318406|ref|ZP_07597841.1| ribosomal protein L28 [Sinorhizobium meliloti AK83]
 gi|20139560|sp|Q92MF4|RL28_RHIME RecName: Full=50S ribosomal protein L28
 gi|15075692|emb|CAC47247.1| Probable 50S ribosomal protein L28 [Sinorhizobium meliloti 1021]
 gi|306896088|gb|EFN26839.1| ribosomal protein L28 [Sinorhizobium meliloti AK83]
 gi|306904707|gb|EFN35291.1| ribosomal protein L28 [Sinorhizobium meliloti BL225C]
          Length = 96

 Score =  128 bits (323), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 59/96 (61%), Positives = 73/96 (76%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT K V SGN VSHANNKT+R+FLPNLC +TLISD + Q+++LR+S  ALRSVE
Sbjct: 1  MSRSCELTGKGVQSGNNVSHANNKTKRKFLPNLCNVTLISDALGQRFRLRVSAAALRSVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKS 96
           +GGLD FL  + +  LS R R LR QI+KK +E +
Sbjct: 61 HRGGLDAFLLKADENELSMRARLLRRQIVKKAAEAA 96


>gi|85713780|ref|ZP_01044770.1| ribosomal protein L28 [Nitrobacter sp. Nb-311A]
 gi|85699684|gb|EAQ37551.1| ribosomal protein L28 [Nitrobacter sp. Nb-311A]
          Length = 97

 Score =  128 bits (323), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 45/96 (46%), Positives = 63/96 (65%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT K  + G++VSH+N KT+RRFLPNL  +T +SD +    + R+S  ALRSV+
Sbjct: 1  MSRRCELTAKAPLVGHRVSHSNIKTKRRFLPNLVNVTFVSDTLASSVRFRVSTHALRSVD 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKS 96
           +GG D FL  +K   LS +   ++ QI KK + K+
Sbjct: 61 HRGGFDAFLLKAKDSELSPKAVEIKRQIQKKQAAKA 96


>gi|150397754|ref|YP_001328221.1| 50S ribosomal protein L28 [Sinorhizobium medicae WSM419]
 gi|166227338|sp|A6UCK6|RL28_SINMW RecName: Full=50S ribosomal protein L28
 gi|150029269|gb|ABR61386.1| ribosomal protein L28 [Sinorhizobium medicae WSM419]
          Length = 96

 Score =  128 bits (323), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 59/96 (61%), Positives = 73/96 (76%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT K V SGN VSHANNKT+R+FLPNLC +TLISD + Q+++LR+S  ALRSVE
Sbjct: 1  MSRSCELTGKGVQSGNNVSHANNKTKRKFLPNLCNVTLISDALGQRFRLRVSAAALRSVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKS 96
           +GGLD FL  + +  LS R R LR QI+KK +E +
Sbjct: 61 HRGGLDAFLLKADETELSMRARLLRRQIVKKAAEAA 96


>gi|319409404|emb|CBI83050.1| 50S ribosomal protein L28 [Bartonella schoenbuchensis R1]
          Length = 97

 Score =  128 bits (323), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 60/97 (61%), Positives = 75/97 (77%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT K V  GN VSHANNKTRRRFLPNLC +TLIS++++Q Y+LRIS  ALRSVE
Sbjct: 1  MSRACELTGKAVQYGNNVSHANNKTRRRFLPNLCNVTLISEVLQQSYRLRISAHALRSVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKSS 97
           +GGLD FL  +  + LS R R L+ QI+KK +E+++
Sbjct: 61 HRGGLDCFLVKADDKELSQRARLLKRQIMKKKAEQAA 97


>gi|89069017|ref|ZP_01156398.1| ribosomal protein L28 [Oceanicola granulosus HTCC2516]
 gi|89045386|gb|EAR51451.1| ribosomal protein L28 [Oceanicola granulosus HTCC2516]
          Length = 93

 Score =  128 bits (322), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 46/93 (49%), Positives = 64/93 (68%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT K  M+GN VSHA+NKTRRRFLPNL  +TL SD++ + ++ R+S  ALR+V+
Sbjct: 1  MSRRCELTGKGPMTGNNVSHAHNKTRRRFLPNLQDVTLQSDVLGRSFKFRVSSAALRTVD 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMS 93
           +GGLD F++ +K   LSA    ++  I    +
Sbjct: 61 HRGGLDAFMARAKDAELSAAALKVKKAIADANA 93


>gi|84687464|ref|ZP_01015341.1| ribosomal protein L28 [Maritimibacter alkaliphilus HTCC2654]
 gi|84664489|gb|EAQ10976.1| ribosomal protein L28 [Rhodobacterales bacterium HTCC2654]
          Length = 95

 Score =  128 bits (322), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 47/95 (49%), Positives = 67/95 (70%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVCELT K   +GN VSHANNKT+RRFLPNL  ++L+S+ + +  + RIS  ALR+V+
Sbjct: 1  MSRVCELTGKGPATGNNVSHANNKTKRRFLPNLNDVSLVSETLGRPIKFRISASALRTVD 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEK 95
           +GGLD+FL+ +K   LSA+   ++ +I K  +  
Sbjct: 61 HRGGLDKFLAKAKDAELSAKALKVKKEIAKAQASA 95


>gi|49476246|ref|YP_034287.1| 50S ribosomal protein L28 [Bartonella henselae str. Houston-1]
 gi|67461407|sp|Q6G5T1|RL28_BARHE RecName: Full=50S ribosomal protein L28
 gi|49239054|emb|CAF28355.1| 50S ribosomal protein l28 [Bartonella henselae str. Houston-1]
          Length = 97

 Score =  128 bits (322), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 61/97 (62%), Positives = 76/97 (78%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT KTV  GN VSHANNKTRRRFLPNLC +TLIS++++Q Y+LR+S  ALRSVE
Sbjct: 1  MSRACELTGKTVQYGNNVSHANNKTRRRFLPNLCNVTLISEVLQQSYRLRVSASALRSVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKSS 97
           +GGLD FL  +  + LS R R L+ QI+KK +EK++
Sbjct: 61 HRGGLDGFLVKADDKELSQRARLLKRQIVKKKAEKAA 97


>gi|254511086|ref|ZP_05123153.1| ribosomal protein L28 [Rhodobacteraceae bacterium KLH11]
 gi|221534797|gb|EEE37785.1| ribosomal protein L28 [Rhodobacteraceae bacterium KLH11]
          Length = 95

 Score =  128 bits (322), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 49/95 (51%), Positives = 65/95 (68%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT K  M+GN VSHA N+TRRRFLPNL  +TL S+ + +  +LRIS  ALRSV+
Sbjct: 1  MSRRCELTGKGPMTGNNVSHAKNRTRRRFLPNLNDVTLQSETLGRGVKLRISAAALRSVD 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEK 95
           +GGLD FL+ +K + LSA    ++ +I K  +  
Sbjct: 61 HRGGLDAFLAKAKDDELSANALKVKKEIAKAQASA 95


>gi|86359399|ref|YP_471291.1| 50S ribosomal protein L28 [Rhizobium etli CFN 42]
 gi|123510611|sp|Q2K3M2|RL28_RHIEC RecName: Full=50S ribosomal protein L28
 gi|86283501|gb|ABC92564.1| 50S ribosomal protein L28 [Rhizobium etli CFN 42]
          Length = 98

 Score =  128 bits (322), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 61/97 (62%), Positives = 77/97 (79%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVCELT K V++GN VSHANNKT+RRFLPNLC++TLISD + Q+Y+LR+S  ALRSVE
Sbjct: 1  MSRVCELTGKAVLTGNNVSHANNKTKRRFLPNLCQVTLISDALNQRYRLRVSAAALRSVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKSS 97
           +GGLD FL  + +  LS R R LR QI+KK +E ++
Sbjct: 61 HRGGLDAFLIKASENELSMRARLLRRQIVKKTAEAAA 97


>gi|296116557|ref|ZP_06835167.1| 50S ribosomal protein L28 [Gluconacetobacter hansenii ATCC 23769]
 gi|295976769|gb|EFG83537.1| 50S ribosomal protein L28 [Gluconacetobacter hansenii ATCC 23769]
          Length = 100

 Score =  127 bits (320), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 45/97 (46%), Positives = 66/97 (68%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR C++T K V++GN VSHANNK+RRRFLPNL   +L+SDI+    +LR+S   +R+VE
Sbjct: 1  MSRRCQITGKGVLTGNNVSHANNKSRRRFLPNLQETSLLSDILGAPVRLRLSTNGIRTVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKSS 97
            GGLD FL ++    L+    T++ +IL+    K++
Sbjct: 61 HNGGLDAFLLSTPNRKLTPEAMTVKRRILRVQVRKAA 97


>gi|159045123|ref|YP_001533917.1| 50S ribosomal protein L28 [Dinoroseobacter shibae DFL 12]
 gi|189029438|sp|A8LHY2|RL28_DINSH RecName: Full=50S ribosomal protein L28
 gi|157912883|gb|ABV94316.1| 50S ribosomal protein L28 [Dinoroseobacter shibae DFL 12]
          Length = 95

 Score =  127 bits (320), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 48/95 (50%), Positives = 65/95 (68%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT K V  GN VSHANNKT+RRFLPNL  +TL+S+ + + ++LRIS  ALR+V+
Sbjct: 1  MSRRCELTGKGVQVGNNVSHANNKTKRRFLPNLNDVTLMSETLGRGFKLRISAAALRTVD 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEK 95
           +GGLD FL+ +K   LS +   ++  I K  +  
Sbjct: 61 HRGGLDSFLAKAKDAELSEKALKIKKDIAKAQAAA 95


>gi|218682995|ref|ZP_03530596.1| 50S ribosomal protein L28 [Rhizobium etli CIAT 894]
          Length = 98

 Score =  127 bits (320), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 61/97 (62%), Positives = 77/97 (79%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVCELT K V++GN VSHANNKT+RRFLPNLC++TLISD + Q+Y+LR+S  ALRSVE
Sbjct: 1  MSRVCELTGKAVLTGNNVSHANNKTKRRFLPNLCQVTLISDALNQRYRLRVSAAALRSVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKSS 97
           +GGLD FL  + +  LS R R LR QI+KK +E ++
Sbjct: 61 HRGGLDAFLIKASENELSMRARLLRRQIVKKNAEAAA 97


>gi|154252158|ref|YP_001412982.1| 50S ribosomal protein L28 [Parvibaculum lavamentivorans DS-1]
 gi|171769596|sp|A7HTU2|RL28_PARL1 RecName: Full=50S ribosomal protein L28
 gi|154156108|gb|ABS63325.1| ribosomal protein L28 [Parvibaculum lavamentivorans DS-1]
          Length = 96

 Score =  127 bits (319), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 54/96 (56%), Positives = 67/96 (69%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CEL+ K VMSGN VSHAN KTRRRFLPNLC++TLISD + +++ LR+S  ALRSVE
Sbjct: 1  MSRRCELSGKAVMSGNNVSHANRKTRRRFLPNLCQVTLISDALGRQFSLRVSAHALRSVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKS 96
            GGLD FL  +    LS+R   L+  I K  +  +
Sbjct: 61 HNGGLDPFLLKASDAQLSSRALKLKRAIEKVQAVAA 96


>gi|84499546|ref|ZP_00997834.1| ribosomal protein L28 [Oceanicola batsensis HTCC2597]
 gi|84392690|gb|EAQ04901.1| ribosomal protein L28 [Oceanicola batsensis HTCC2597]
          Length = 95

 Score =  127 bits (319), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 49/93 (52%), Positives = 66/93 (70%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT K  M+GN VSHANNKTRRRFLPNL  ++L S+ + +  +LRIS  ALR+V+
Sbjct: 1  MSRRCELTGKGPMTGNNVSHANNKTRRRFLPNLNDVSLRSEALGRNIKLRISAAALRTVD 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMS 93
           +GGLD+FL+ +K   LSA    ++ +I K  +
Sbjct: 61 HRGGLDKFLAKAKDSELSANALKVKKEIAKVQA 93


>gi|149202032|ref|ZP_01879005.1| 50S ribosomal protein L28 [Roseovarius sp. TM1035]
 gi|149144130|gb|EDM32161.1| 50S ribosomal protein L28 [Roseovarius sp. TM1035]
          Length = 96

 Score =  127 bits (319), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 49/96 (51%), Positives = 65/96 (67%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT K  M GN  SHANNKTRRR+LPNL  +TL S+ + +  +LRIS  ALRSV+
Sbjct: 1  MSRRCELTGKGPMVGNNSSHANNKTRRRYLPNLNDVTLQSETLNRGIKLRISAHALRSVD 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKS 96
           +GGLD FL+ +K + LSA    ++ +I K  +  +
Sbjct: 61 HRGGLDAFLAKAKDDELSASALKVKKEIAKAQAATA 96


>gi|254461018|ref|ZP_05074434.1| ribosomal protein L28 [Rhodobacterales bacterium HTCC2083]
 gi|206677607|gb|EDZ42094.1| ribosomal protein L28 [Rhodobacteraceae bacterium HTCC2083]
          Length = 95

 Score =  127 bits (319), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 46/95 (48%), Positives = 63/95 (66%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT K  M+GN VSHA N+TRRRFLPNL  +TL S+I+ +  +L+I   ALR+V+
Sbjct: 1  MSRRCELTGKGPMTGNNVSHAKNRTRRRFLPNLNDVTLQSEILGRGIKLKICAAALRTVD 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEK 95
           +GGLD+F + SK   LS     ++ +I K  +  
Sbjct: 61 HRGGLDQFFAKSKDSELSDSALKVKKEIAKAQAAA 95


>gi|254440022|ref|ZP_05053516.1| ribosomal protein L28, putative [Octadecabacter antarcticus 307]
 gi|198255468|gb|EDY79782.1| ribosomal protein L28, putative [Octadecabacter antarcticus 307]
          Length = 96

 Score =  127 bits (319), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 46/96 (47%), Positives = 64/96 (66%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT K  MSGN VSHA N+TRRRFLPNL  ++L+S+ + + ++ RIS  ALR+V+
Sbjct: 1  MSRRCELTGKGPMSGNNVSHAKNRTRRRFLPNLQDVSLMSESLGRSFKFRISNAALRTVD 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKS 96
           +GGLD F + SK   LS     ++  I K  + ++
Sbjct: 61 HRGGLDAFFAKSKDAELSPSALKVKKDIAKAATAEA 96


>gi|260575323|ref|ZP_05843323.1| ribosomal protein L28 [Rhodobacter sp. SW2]
 gi|259022583|gb|EEW25879.1| ribosomal protein L28 [Rhodobacter sp. SW2]
          Length = 94

 Score =  127 bits (319), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 53/94 (56%), Positives = 70/94 (74%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVCEL+ K  MSGN VSHANNK+RRRFLPNL  +TLISD++ Q ++LRIS  ALRSV+
Sbjct: 1  MSRVCELSGKGPMSGNTVSHANNKSRRRFLPNLNEVTLISDVLGQSFKLRISAHALRSVD 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSE 94
           +GGLD FL+ +K + LS +   ++ +I K  + 
Sbjct: 61 HRGGLDAFLAKAKDDELSDKALKIKKEISKVQAA 94


>gi|85703478|ref|ZP_01034582.1| ribosomal protein L28 [Roseovarius sp. 217]
 gi|85672406|gb|EAQ27263.1| ribosomal protein L28 [Roseovarius sp. 217]
          Length = 96

 Score =  127 bits (319), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 49/93 (52%), Positives = 64/93 (68%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT K  M GN  SHANNKTRRR+LPNL  +TL S+ + +  +LRIS  ALRSV+
Sbjct: 1  MSRRCELTGKGPMVGNNSSHANNKTRRRYLPNLNDVTLQSETLNRGIKLRISAHALRSVD 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMS 93
           +GGLD FL+ +K + LSA    ++ +I K  +
Sbjct: 61 HRGGLDAFLAKAKDDELSATALKVKKEIAKAQA 93


>gi|110635403|ref|YP_675611.1| 50S ribosomal protein L28 [Mesorhizobium sp. BNC1]
 gi|122965640|sp|Q11DS9|RL28_MESSB RecName: Full=50S ribosomal protein L28
 gi|110286387|gb|ABG64446.1| LSU ribosomal protein L28P [Chelativorans sp. BNC1]
          Length = 98

 Score =  127 bits (319), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 60/95 (63%), Positives = 73/95 (76%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT K VMSGN VSHANNKTRRRFLPNLC +TL+S+ + Q Y+LR+S  ALRSVE
Sbjct: 1  MSRACELTGKAVMSGNNVSHANNKTRRRFLPNLCDVTLMSEALGQSYRLRVSANALRSVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEK 95
           +GGLD FL  +K   LS R R L+ Q+ KK++E+
Sbjct: 61 HRGGLDAFLLKAKSNELSQRARLLKKQVAKKLTEQ 95


>gi|126731524|ref|ZP_01747330.1| ribosomal protein L28 [Sagittula stellata E-37]
 gi|126708060|gb|EBA07120.1| ribosomal protein L28 [Sagittula stellata E-37]
          Length = 95

 Score =  126 bits (318), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 50/92 (54%), Positives = 65/92 (70%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVCELT K  M GN VSHANNKT+RR+LPNL  +TL S+ + +  +LRIS  ALRSV+
Sbjct: 1  MSRVCELTGKGPMVGNNVSHANNKTKRRYLPNLNDVTLQSETLGRGVKLRISAHALRSVD 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKM 92
           +GGLD+FL+ +K   LS R   ++ +I K  
Sbjct: 61 HRGGLDKFLAKAKDTELSDRALKVKKEIAKAQ 92


>gi|163747248|ref|ZP_02154603.1| ribosomal protein L28 [Oceanibulbus indolifex HEL-45]
 gi|161379523|gb|EDQ03937.1| ribosomal protein L28 [Oceanibulbus indolifex HEL-45]
          Length = 99

 Score =  126 bits (318), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 47/93 (50%), Positives = 65/93 (69%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT K  M+GN VSHANN+TRRRFLPNL  ++L S+ + + ++LRIS  ALR+V+
Sbjct: 1  MSRRCELTGKGPMTGNNVSHANNRTRRRFLPNLNDVSLQSEALGRAFKLRISAAALRTVD 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMS 93
           +GGLD+FL+ +K   LS     ++  I K  +
Sbjct: 61 HRGGLDKFLAKAKDVELSDNALKIKKAIAKSSA 93


>gi|163852395|ref|YP_001640438.1| ribosomal protein L28 [Methylobacterium extorquens PA1]
 gi|218531154|ref|YP_002421970.1| 50S ribosomal protein L28 [Methylobacterium chloromethanicum CM4]
 gi|240139729|ref|YP_002964206.1| 50S ribosomal protein L28 [Methylobacterium extorquens AM1]
 gi|254562142|ref|YP_003069237.1| 50S ribosomal protein L28 [Methylobacterium extorquens DM4]
 gi|226732834|sp|A9W6T5|RL28_METEP RecName: Full=50S ribosomal protein L28
 gi|254801367|sp|B7KT12|RL28_METC4 RecName: Full=50S ribosomal protein L28
 gi|163664000|gb|ABY31367.1| ribosomal protein L28 [Methylobacterium extorquens PA1]
 gi|218523457|gb|ACK84042.1| ribosomal protein L28 [Methylobacterium chloromethanicum CM4]
 gi|240009703|gb|ACS40929.1| 50S ribosomal protein L28 [Methylobacterium extorquens AM1]
 gi|254269420|emb|CAX25386.1| 50S ribosomal protein L28 [Methylobacterium extorquens DM4]
          Length = 101

 Score =  126 bits (318), Expect = 9e-28,   Method: Composition-based stats.
 Identities = 49/97 (50%), Positives = 69/97 (71%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT K V  G+ VSH+N KT+ RFLPNLC +TL SD + ++ +LR++  ALRSVE
Sbjct: 1  MSRRCELTGKAVQVGHLVSHSNRKTKCRFLPNLCNVTLQSDTLNRRVRLRVTAHALRSVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKSS 97
           +GGLD FL  +++  LS   R L+ +I KK++E ++
Sbjct: 61 HRGGLDAFLVKAREIELSQTARLLKREIEKKIAEPAT 97


>gi|39933570|ref|NP_945846.1| 50S ribosomal protein L28 [Rhodopseudomonas palustris CGA009]
 gi|192288924|ref|YP_001989529.1| 50S ribosomal protein L28 [Rhodopseudomonas palustris TIE-1]
 gi|67461434|sp|Q6NCH9|RL28_RHOPA RecName: Full=50S ribosomal protein L28; AltName: Full=RRP-L28
 gi|226699155|sp|B3QAG7|RL28_RHOPT RecName: Full=50S ribosomal protein L28
 gi|39647416|emb|CAE25937.1| 50S ribosomal protein L28 [Rhodopseudomonas palustris CGA009]
 gi|192282673|gb|ACE99053.1| ribosomal protein L28 [Rhodopseudomonas palustris TIE-1]
          Length = 101

 Score =  126 bits (318), Expect = 9e-28,   Method: Composition-based stats.
 Identities = 45/93 (48%), Positives = 64/93 (68%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT K    G+KVSH+N KT+RRFLPNL  +T +SD + +  +LR+S  AL+SV+
Sbjct: 1  MSRRCELTAKGAQVGHKVSHSNIKTKRRFLPNLVNVTFLSDTLGRAVRLRVSTNALKSVD 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMS 93
           +GGLD +L  +++  LS +   L+  I KKM+
Sbjct: 61 HRGGLDAYLLKAREAELSPKAVELKRAIAKKMA 93


>gi|83859714|ref|ZP_00953234.1| ribosomal protein L28 [Oceanicaulis alexandrii HTCC2633]
 gi|83852073|gb|EAP89927.1| ribosomal protein L28 [Oceanicaulis alexandrii HTCC2633]
          Length = 95

 Score =  126 bits (318), Expect = 9e-28,   Method: Composition-based stats.
 Identities = 47/95 (49%), Positives = 66/95 (69%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT    +SGN VSHANNKT+RRFLPNLC++TL S+ + + ++LRI+  ALRSV+
Sbjct: 1  MSRRCELTGTGPVSGNNVSHANNKTKRRFLPNLCQVTLASEALGRSFRLRIAAKALRSVD 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEK 95
            GGLD+FL  ++ E LS     ++ ++ K  +  
Sbjct: 61 HVGGLDQFLLKARDEQLSGNALKIKRELKKAAAAA 95


>gi|103488227|ref|YP_617788.1| 50S ribosomal protein L28 [Sphingopyxis alaskensis RB2256]
 gi|123379514|sp|Q1GPG7|RL28_SPHAL RecName: Full=50S ribosomal protein L28
 gi|98978304|gb|ABF54455.1| LSU ribosomal protein L28P [Sphingopyxis alaskensis RB2256]
          Length = 97

 Score =  126 bits (318), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 49/97 (50%), Positives = 68/97 (70%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR+CELT K    G+ VSHANNKT+R FLPNL  +TL+SD + +  +LR+S   LRSVE
Sbjct: 1  MSRICELTGKGRQIGHNVSHANNKTKRTFLPNLQNVTLLSDALGKSVKLRVSTHGLRSVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKSS 97
            GGLD +L  +  + LSA  R L+ ++ KK++EK++
Sbjct: 61 HNGGLDNWLMKTGDDQLSANARKLKKEVAKKLAEKAA 97


>gi|119385160|ref|YP_916216.1| 50S ribosomal protein L28 [Paracoccus denitrificans PD1222]
 gi|166226595|sp|A1B4S6|RL28_PARDP RecName: Full=50S ribosomal protein L28
 gi|119374927|gb|ABL70520.1| LSU ribosomal protein L28P [Paracoccus denitrificans PD1222]
          Length = 91

 Score =  126 bits (318), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 53/91 (58%), Positives = 67/91 (73%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVCELT K  MSGN VSHANNKTRRRFLPNL  ++L+S+ + + YQLRIS  ALRSV+
Sbjct: 1  MSRVCELTGKGPMSGNNVSHANNKTRRRFLPNLNEVSLLSEKLGRSYQLRISAAALRSVD 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKK 91
           +GGLD FL+ +K   LS R   ++ ++ K 
Sbjct: 61 HRGGLDAFLAKAKDAELSDRALKIKRELAKA 91


>gi|114769311|ref|ZP_01446937.1| ribosomal protein L28 [alpha proteobacterium HTCC2255]
 gi|114550228|gb|EAU53109.1| ribosomal protein L28 [alpha proteobacterium HTCC2255]
          Length = 96

 Score =  126 bits (318), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 46/96 (47%), Positives = 65/96 (67%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT K  M+GN VSHA N+TRRRFLPNL  +TL SD++ Q ++ +IS  ALR+V+
Sbjct: 1  MSRRCELTGKGPMTGNNVSHAKNRTRRRFLPNLNDVTLASDVLGQAFKFKISAAALRTVD 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKS 96
           +GGLD F++ +K   LS +   ++  I K  +  +
Sbjct: 61 HRGGLDAFMAKAKDAELSEKALKVKRDIAKATAPAA 96


>gi|254451826|ref|ZP_05065263.1| ribosomal protein L28 [Octadecabacter antarcticus 238]
 gi|198266232|gb|EDY90502.1| ribosomal protein L28 [Octadecabacter antarcticus 238]
          Length = 96

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 47/96 (48%), Positives = 65/96 (67%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT K  MSGN VSHA N+TRRRFLPNL  ++L+SD + + ++ RIS  ALR+V+
Sbjct: 1  MSRRCELTGKGPMSGNNVSHAKNRTRRRFLPNLQDVSLMSDSLGRSFKFRISNAALRTVD 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKS 96
           +GGLD F + SK   LS     ++  I+K  + ++
Sbjct: 61 HRGGLDAFFAKSKDAELSPAALKVKKDIVKAATVEA 96


>gi|77462563|ref|YP_352067.1| 50S ribosomal protein L28 [Rhodobacter sphaeroides 2.4.1]
 gi|126461497|ref|YP_001042611.1| 50S ribosomal protein L28 [Rhodobacter sphaeroides ATCC 17029]
 gi|123592686|sp|Q3J4W8|RL28_RHOS4 RecName: Full=50S ribosomal protein L28
 gi|166226609|sp|A3PHM3|RL28_RHOS1 RecName: Full=50S ribosomal protein L28
 gi|77386981|gb|ABA78166.1| LSU ribosomal protein L28P [Rhodobacter sphaeroides 2.4.1]
 gi|126103161|gb|ABN75839.1| LSU ribosomal protein L28P [Rhodobacter sphaeroides ATCC 17029]
          Length = 96

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 52/96 (54%), Positives = 72/96 (75%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVCEL+ K  M+GN VSHANNK+RRRFLPNL  +TLISD++ Q ++LRIS  ALR+V+
Sbjct: 1  MSRVCELSGKAPMTGNTVSHANNKSRRRFLPNLNDVTLISDVLGQSFKLRISAAALRTVD 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKS 96
           +GGLD FL+ +K + LS + R ++ +I K  +  +
Sbjct: 61 HRGGLDAFLAKAKDDELSVKARAIKKEIEKAQATAA 96


>gi|296447501|ref|ZP_06889424.1| ribosomal protein L28 [Methylosinus trichosporium OB3b]
 gi|296254968|gb|EFH02072.1| ribosomal protein L28 [Methylosinus trichosporium OB3b]
          Length = 98

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 51/97 (52%), Positives = 67/97 (69%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT K V +GN VSH+N KTR RFLPNL  +TL SD + +  +LR+S  ALRSVE
Sbjct: 1  MSRRCELTGKGVQTGNLVSHSNRKTRTRFLPNLVNVTLASDALARSVRLRVSAAALRSVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKSS 97
           +GGLD FL  +++  LS   R L+ +I KK++  +S
Sbjct: 61 HRGGLDAFLLKARETELSDDARALKREIAKKLATAAS 97


>gi|319407804|emb|CBI81455.1| 50S ribosomal protein L28 [Bartonella sp. 1-1C]
          Length = 97

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 62/97 (63%), Positives = 75/97 (77%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVCELT K V  GN VSHANNKTRRRFLPNLC +TLIS++++Q Y+LRIS  ALRSVE
Sbjct: 1  MSRVCELTGKAVQYGNNVSHANNKTRRRFLPNLCNVTLISELLQQSYRLRISANALRSVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKSS 97
           +GGLD FL  +  + LS R R L+ QI+KK +EK +
Sbjct: 61 HRGGLDNFLVKADDKELSQRGRLLKRQIMKKKAEKVA 97


>gi|222149976|ref|YP_002550933.1| 50S ribosomal protein L28 [Agrobacterium vitis S4]
 gi|254801494|sp|B9JTL3|RL28_AGRVS RecName: Full=50S ribosomal protein L28
 gi|221736958|gb|ACM37921.1| 50S ribosomal protein L28 [Agrobacterium vitis S4]
          Length = 96

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 60/96 (62%), Positives = 72/96 (75%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT K V SGN VSHANNKTRR+FLPNLC +TLISD + Q+Y+LR+S  ALRSVE
Sbjct: 1  MSRSCELTGKGVQSGNNVSHANNKTRRKFLPNLCDVTLISDALGQRYRLRVSAAALRSVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKS 96
           +GGLD FL  + +  LS R R LR QI+KK +  +
Sbjct: 61 HRGGLDAFLLKANETELSMRARLLRRQIVKKTAVAA 96


>gi|319899448|ref|YP_004159545.1| 50S ribosomal protein L28 [Bartonella clarridgeiae 73]
 gi|319403416|emb|CBI76984.1| 50S ribosomal protein L28 [Bartonella clarridgeiae 73]
          Length = 97

 Score =  125 bits (316), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 60/97 (61%), Positives = 74/97 (76%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT K V  GN VSHANNKTRRRFLPNLC +TLIS++++Q Y+LRIS  ALRSVE
Sbjct: 1  MSRACELTGKAVQYGNNVSHANNKTRRRFLPNLCNVTLISEVLQQSYRLRISANALRSVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKSS 97
           +GGLD FL  +  + LS R R L+ QI+KK +E+ +
Sbjct: 61 HRGGLDGFLVKADDKELSQRARLLKRQIIKKKAEQVA 97


>gi|118592089|ref|ZP_01549483.1| 50S ribosomal protein L28 [Stappia aggregata IAM 12614]
 gi|118435385|gb|EAV42032.1| 50S ribosomal protein L28 [Stappia aggregata IAM 12614]
          Length = 98

 Score =  125 bits (316), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 47/97 (48%), Positives = 70/97 (72%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+R CEL+ K VM+GN VSHANN++RRRFLPNLC ++LISD + + ++L++   ALRSVE
Sbjct: 1  MARRCELSGKDVMTGNNVSHANNRSRRRFLPNLCNVSLISDTLGETFKLKVCAHALRSVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKSS 97
           +GGLD +L  +   +LS   R ++  I +K +E ++
Sbjct: 61 HRGGLDAYLMKASDADLSDAARKIKVDIKRKQAEAAA 97


>gi|90420223|ref|ZP_01228131.1| 50S ribosomal protein L28 [Aurantimonas manganoxydans SI85-9A1]
 gi|90335557|gb|EAS49307.1| 50S ribosomal protein L28 [Aurantimonas manganoxydans SI85-9A1]
          Length = 98

 Score =  125 bits (316), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 61/97 (62%), Positives = 75/97 (77%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT K V SGN VSHANN+TRR+FLPNLC++TLISD M Q+Y+LRIS  ALRSVE
Sbjct: 1  MSRACELTGKAVQSGNNVSHANNRTRRKFLPNLCQVTLISDAMGQRYRLRISAHALRSVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKSS 97
           +GGLD FL+ +    LS R R L+ QI KK++E ++
Sbjct: 61 HRGGLDAFLAKADAAELSQRARLLKRQIAKKIAETAA 97


>gi|92116123|ref|YP_575852.1| 50S ribosomal protein L28 [Nitrobacter hamburgensis X14]
 gi|122418709|sp|Q1QQV5|RL28_NITHX RecName: Full=50S ribosomal protein L28
 gi|91799017|gb|ABE61392.1| LSU ribosomal protein L28P [Nitrobacter hamburgensis X14]
          Length = 97

 Score =  125 bits (316), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 44/96 (45%), Positives = 63/96 (65%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT K  M G+KVSH+N KT+RRFLPNL  +T +S+ +    +LR+S  AL+SV+
Sbjct: 1  MSRRCELTAKAPMVGHKVSHSNIKTKRRFLPNLVNVTFLSEALASPVRLRVSTHALKSVD 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKS 96
           +GG D FL  +K   LS +   ++ +I KK +  +
Sbjct: 61 HRGGFDAFLLKAKNAELSPKAIEIKRRIEKKQAANA 96


>gi|188582402|ref|YP_001925847.1| 50S ribosomal protein L28 [Methylobacterium populi BJ001]
 gi|226732836|sp|B1ZHJ4|RL28_METPB RecName: Full=50S ribosomal protein L28
 gi|179345900|gb|ACB81312.1| ribosomal protein L28 [Methylobacterium populi BJ001]
          Length = 101

 Score =  125 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 49/97 (50%), Positives = 68/97 (70%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT K V  G+ VSH+N KT+ RFLPNLC +TL SD + ++ +LR++  ALRSVE
Sbjct: 1  MSRRCELTGKAVQVGHLVSHSNRKTKCRFLPNLCNVTLQSDALNRRVRLRVTAHALRSVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKSS 97
           +GGLD FL  +++  LS   R L+  I KK++E ++
Sbjct: 61 HRGGLDAFLIKAREIELSQTARLLKRDIEKKIAETAT 97


>gi|299132820|ref|ZP_07026015.1| ribosomal protein L28 [Afipia sp. 1NLS2]
 gi|298592957|gb|EFI53157.1| ribosomal protein L28 [Afipia sp. 1NLS2]
          Length = 97

 Score =  125 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 48/97 (49%), Positives = 64/97 (65%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT K    G++VSH+N KT+RRFLPNLC +TLIS+ + Q  +LR+S  AL+SV+
Sbjct: 1  MSRRCELTAKGPQVGHRVSHSNIKTKRRFLPNLCNVTLISETLGQSVRLRVSTNALKSVD 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKSS 97
            GGLD FL  +    LS +   L+ QI KK    ++
Sbjct: 61 HNGGLDAFLLKANVATLSPKAADLKRQIEKKKLAAAN 97


>gi|58038593|ref|YP_190557.1| 50S ribosomal protein L28 [Gluconobacter oxydans 621H]
 gi|67461239|sp|Q5FUP5|RL28_GLUOX RecName: Full=50S ribosomal protein L28
 gi|58001007|gb|AAW59901.1| LSU ribosomal protein L28P [Gluconobacter oxydans 621H]
          Length = 100

 Score =  125 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 45/97 (46%), Positives = 64/97 (65%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR C++T K V++GN VSHANNK+RRRFLPNL   TLISDI+    ++R+S   +R+VE
Sbjct: 1  MSRRCQITGKGVLTGNNVSHANNKSRRRFLPNLQETTLISDILGASVRMRLSTDGIRTVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKSS 97
            GGLD FL  +    L    + ++ +IL+    K++
Sbjct: 61 HNGGLDSFLLGTPNRKLPTEAQVIKRRILRVQERKAA 97


>gi|91974765|ref|YP_567424.1| 50S ribosomal protein L28 [Rhodopseudomonas palustris BisB5]
 gi|123722228|sp|Q13EG6|RL28_RHOPS RecName: Full=50S ribosomal protein L28
 gi|91681221|gb|ABE37523.1| LSU ribosomal protein L28P [Rhodopseudomonas palustris BisB5]
          Length = 101

 Score =  125 bits (314), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 46/97 (47%), Positives = 66/97 (68%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT K V +G+KVSH+N KT+RRFLPNL  +T +SD + +  +LR+S  AL+SV+
Sbjct: 1  MSRRCELTAKGVQTGHKVSHSNIKTKRRFLPNLVNVTFLSDALGRPVRLRVSTNALKSVD 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKSS 97
           +GGLD FL+ +    LS +   L+  I KK + + +
Sbjct: 61 HRGGLDAFLAKASIAELSPKAAELKRAIAKKKAGEPA 97


>gi|148555241|ref|YP_001262823.1| 50S ribosomal protein L28 [Sphingomonas wittichii RW1]
 gi|166228155|sp|A5V8R9|RL28_SPHWW RecName: Full=50S ribosomal protein L28
 gi|148500431|gb|ABQ68685.1| LSU ribosomal protein L28P [Sphingomonas wittichii RW1]
          Length = 97

 Score =  125 bits (314), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 49/97 (50%), Positives = 63/97 (64%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR+CELT K    G+ VSHANNKT+R FLPNL  +TLISD + +  +LR+S   LRSVE
Sbjct: 1  MSRICELTGKGRQVGHNVSHANNKTKRTFLPNLQNVTLISDSLGKGVKLRVSTHGLRSVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKSS 97
            GGLD +L  +  + LS R R L+  I KK    ++
Sbjct: 61 HVGGLDNWLLKTSDDLLSLRARRLKRDIAKKQQAVAA 97


>gi|170750100|ref|YP_001756360.1| ribosomal protein L28 [Methylobacterium radiotolerans JCM 2831]
 gi|226732837|sp|B1LW27|RL28_METRJ RecName: Full=50S ribosomal protein L28
 gi|170656622|gb|ACB25677.1| ribosomal protein L28 [Methylobacterium radiotolerans JCM 2831]
          Length = 100

 Score =  125 bits (314), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 48/97 (49%), Positives = 68/97 (70%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+R CELT K V  G+ VSH+N KT+ RFLPNLC +TL SD + ++ +LR++  ALRSVE
Sbjct: 1  MARRCELTGKAVQVGHLVSHSNRKTKCRFLPNLCNVTLQSDALGKRVRLRVTAHALRSVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKSS 97
           +GGLD FL  + + +LS   R L+ +I KK++E  +
Sbjct: 61 HRGGLDAFLIKAGEGDLSQTARLLKREIHKKLAETPA 97


>gi|83949729|ref|ZP_00958462.1| ribosomal protein L28 [Roseovarius nubinhibens ISM]
 gi|83837628|gb|EAP76924.1| ribosomal protein L28 [Roseovarius nubinhibens ISM]
          Length = 96

 Score =  125 bits (314), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 48/96 (50%), Positives = 63/96 (65%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT K  M GN  SHANNKTRRR+LPNL  +TL S+ + +  +LRIS  ALRSV+
Sbjct: 1  MSRRCELTGKGPMVGNNSSHANNKTRRRYLPNLNDVTLQSETLSRGIKLRISAHALRSVD 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKS 96
           +GGLD FL+ +K   LS     ++ +I K  +  +
Sbjct: 61 HRGGLDAFLAKAKDSELSTTALKVKKEIAKAQAANA 96


>gi|255263970|ref|ZP_05343312.1| 50S ribosomal protein L28 [Thalassiobium sp. R2A62]
 gi|255106305|gb|EET48979.1| 50S ribosomal protein L28 [Thalassiobium sp. R2A62]
          Length = 93

 Score =  125 bits (314), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 46/93 (49%), Positives = 62/93 (66%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT K  M+GN VSHA N+TRRRFLPNL  +TL S+ + + ++ RIS  ALR+V+
Sbjct: 1  MSRRCELTGKGPMTGNNVSHAKNRTRRRFLPNLQDVTLASETLGRSFKFRISNAALRTVD 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMS 93
           +GGLD F + SK   LS     ++ +I K  +
Sbjct: 61 HRGGLDGFFAKSKDVELSDAALKVKKEIAKAQA 93


>gi|121602432|ref|YP_988415.1| 50S ribosomal protein L28 [Bartonella bacilliformis KC583]
 gi|166226544|sp|A1UR12|RL28_BARBK RecName: Full=50S ribosomal protein L28
 gi|120614609|gb|ABM45210.1| ribosomal protein L28 [Bartonella bacilliformis KC583]
          Length = 98

 Score =  124 bits (313), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 61/97 (62%), Positives = 77/97 (79%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT KTV  GN VSHANNKTRRRFLPNLC +TLIS++M+Q Y+LRIS  A+RSVE
Sbjct: 1  MSRACELTGKTVQYGNNVSHANNKTRRRFLPNLCNVTLISEVMQQSYRLRISANAVRSVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKSS 97
           +GGLD FL+ +  + LS R R L+ QI+KK +E+++
Sbjct: 61 HRGGLDNFLTKADDKELSQRARLLKRQIVKKKAEQAA 97


>gi|241760862|ref|ZP_04758951.1| ribosomal protein L28 [Zymomonas mobilis subsp. mobilis ATCC
          10988]
 gi|260753168|ref|YP_003226061.1| 50S ribosomal protein L28 [Zymomonas mobilis subsp. mobilis NCIMB
          11163]
 gi|283856227|ref|YP_162029.2| 50S ribosomal protein L28 [Zymomonas mobilis subsp. mobilis ZM4]
 gi|48474640|sp|Q9FDL9|RL28_ZYMMO RecName: Full=50S ribosomal protein L28
 gi|9931340|gb|AAG02150.1|AF212041_6 50S ribosomal protein L28 [Zymomonas mobilis subsp. mobilis ZM4]
 gi|241374481|gb|EER63942.1| ribosomal protein L28 [Zymomonas mobilis subsp. mobilis ATCC
          10988]
 gi|258552531|gb|ACV75477.1| ribosomal protein L28 [Zymomonas mobilis subsp. mobilis NCIMB
          11163]
 gi|283775222|gb|AAV88918.2| ribosomal protein L28 [Zymomonas mobilis subsp. mobilis ZM4]
          Length = 95

 Score =  124 bits (313), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 48/95 (50%), Positives = 63/95 (66%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR+CELT K    GN VSHANN+T+R FLPNL  +TLISD + +   LR+S   LRSVE
Sbjct: 1  MSRICELTGKGRQVGNNVSHANNRTKRTFLPNLQNVTLISDALGKGVTLRVSTHGLRSVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEK 95
            GGLD +L  +K E LS R   ++ ++ KK++  
Sbjct: 61 HVGGLDNWLLKTKNEKLSTRALKVKREVAKKLAAA 95


>gi|146279144|ref|YP_001169303.1| 50S ribosomal protein L28 [Rhodobacter sphaeroides ATCC 17025]
 gi|166226610|sp|A4WX84|RL28_RHOS5 RecName: Full=50S ribosomal protein L28
 gi|145557385|gb|ABP71998.1| LSU ribosomal protein L28P [Rhodobacter sphaeroides ATCC 17025]
          Length = 96

 Score =  124 bits (313), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 51/96 (53%), Positives = 71/96 (73%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVCEL+ K  M+GN VSHANNK+RRRFLPNL  +TLISD++ Q ++LRIS  ALR+V+
Sbjct: 1  MSRVCELSGKAPMTGNTVSHANNKSRRRFLPNLNDVTLISDVLGQSFKLRISAAALRTVD 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKS 96
           +GGLD FL+ ++ E LS +   ++ +I K  +  +
Sbjct: 61 HRGGLDAFLAKARDEELSLKALAIKKEIEKVRATAA 96


>gi|163734100|ref|ZP_02141541.1| ribosomal protein L28 [Roseobacter litoralis Och 149]
 gi|161392636|gb|EDQ16964.1| ribosomal protein L28 [Roseobacter litoralis Och 149]
          Length = 99

 Score =  124 bits (313), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 49/91 (53%), Positives = 65/91 (71%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVCELT K  M+GN VSHANNKTRRRFLPNL  +TL S+ + + ++ RIS  ALR+V+
Sbjct: 1  MSRVCELTGKGPMTGNNVSHANNKTRRRFLPNLNDVTLQSETLGRAFKFRISAAALRTVD 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKK 91
           +GGLD+F+  +K  +LSA    ++  I K 
Sbjct: 61 HRGGLDKFMEKAKDSDLSANALKVKKAIGKA 91


>gi|163869259|ref|YP_001610515.1| 50S ribosomal protein L28 [Bartonella tribocorum CIP 105476]
 gi|161018962|emb|CAK02520.1| 50S ribosomal protein L28 [Bartonella tribocorum CIP 105476]
          Length = 105

 Score =  124 bits (313), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 61/97 (62%), Positives = 76/97 (78%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT KTV+ GN VSHANNKTRRRFLPNLC +TLIS++++Q Y+LRIS  ALRSVE
Sbjct: 1  MSRACELTGKTVLYGNNVSHANNKTRRRFLPNLCNVTLISEVLQQSYRLRISANALRSVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKSS 97
           +GGLD FL  +  + LS R R L+ QI+KK +E+ +
Sbjct: 61 HRGGLDGFLVKADDKELSQRARLLKRQIVKKKAEQEN 97


>gi|144898657|emb|CAM75521.1| 50S ribosomal protein L28 [Magnetospirillum gryphiswaldense
          MSR-1]
          Length = 100

 Score =  124 bits (312), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 41/97 (42%), Positives = 63/97 (64%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+R C +T K V++GN VSHANNK+RRRFLPNL   +++SD + Q  +L++S   L+++E
Sbjct: 1  MARRCSITGKGVLTGNNVSHANNKSRRRFLPNLQETSVLSDALGQMVRLKVSTRGLKTIE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKSS 97
            GGLD FL  +    L    R L+ ++ K ++ K +
Sbjct: 61 HNGGLDAFLLGTNDSRLPDEARRLKKRVAKALATKQA 97


>gi|330994027|ref|ZP_08317957.1| 50S ribosomal protein L28 [Gluconacetobacter sp. SXCC-1]
 gi|329758973|gb|EGG75487.1| 50S ribosomal protein L28 [Gluconacetobacter sp. SXCC-1]
          Length = 99

 Score =  124 bits (312), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 43/97 (44%), Positives = 66/97 (68%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR C++T K V++GN VSHANNK+RRRFLPNL   +L+SDI+     +R++   +R+VE
Sbjct: 1  MSRRCQITGKGVLTGNNVSHANNKSRRRFLPNLQETSLLSDILGAAVPMRMTTNGIRTVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKSS 97
            GGLD FL ++    L+    T++ +IL+   +K++
Sbjct: 61 HNGGLDSFLLSTPNRKLTPEALTVKRRILRVQEKKAA 97


>gi|209883222|ref|YP_002287079.1| 50S ribosomal protein L28 [Oligotropha carboxidovorans OM5]
 gi|226732842|sp|B6J9Z3|RL28_OLICO RecName: Full=50S ribosomal protein L28
 gi|209871418|gb|ACI91214.1| 50S ribosomal protein L28 [Oligotropha carboxidovorans OM5]
          Length = 97

 Score =  124 bits (312), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 49/97 (50%), Positives = 65/97 (67%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT K    G+KVSH+N K++RRFLPNLC +TL+S+ + Q  +LR+S  AL+SV+
Sbjct: 1  MSRRCELTAKGPQVGHKVSHSNIKSKRRFLPNLCNVTLMSETLGQSVRLRVSTNALKSVD 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKSS 97
            GGLD FL  +   NLS +   L+ QI KK    +S
Sbjct: 61 HNGGLDAFLLKANIANLSPKAADLKRQIEKKKLAAAS 97


>gi|297183663|gb|ADI19788.1| ribosomal protein l28 [uncultured alpha proteobacterium
           EB000_37G09]
          Length = 116

 Score =  124 bits (312), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 44/94 (46%), Positives = 64/94 (68%)

Query: 1   MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
           MS+ C++T K VMSGN VSHA N+TRRRFLPNL + ++ S+I+ +   +R+S  A+R+VE
Sbjct: 23  MSKRCQITGKGVMSGNNVSHAKNRTRRRFLPNLQQTSMSSEILGRTISMRVSTSAIRTVE 82

Query: 61  RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSE 94
           + GGLD FL  ++   L+   R L+ +IL   S 
Sbjct: 83  KHGGLDTFLLQARNSELADEARALKREILAVASA 116


>gi|328541960|ref|YP_004302069.1| 50S ribosomal protein L28 [polymorphum gilvum SL003B-26A1]
 gi|326411710|gb|ADZ68773.1| 50S ribosomal protein L28 [Polymorphum gilvum SL003B-26A1]
          Length = 96

 Score =  124 bits (312), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 53/96 (55%), Positives = 72/96 (75%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+R CELT K VMSGN VSHANNKTRRRFLPNLC ++LISD + + Y+LRIS  ALRSVE
Sbjct: 1  MARRCELTGKDVMSGNNVSHANNKTRRRFLPNLCNVSLISDALGETYKLRISAHALRSVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKS 96
           +GGLD FL  +    LS + R +++++ ++ ++ +
Sbjct: 61 HRGGLDAFLLKASDTELSNKARLIKAEVKRRQADAA 96


>gi|294678645|ref|YP_003579260.1| 50S ribosomal protein L28 [Rhodobacter capsulatus SB 1003]
 gi|294477465|gb|ADE86853.1| 50S ribosomal protein L28 [Rhodobacter capsulatus SB 1003]
          Length = 95

 Score =  123 bits (311), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 50/80 (62%), Positives = 62/80 (77%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVCELT K  MSGN +SHANNKTRRRFLPNL  +TLISD++ Q +QLR+S   LR+V+
Sbjct: 1  MSRVCELTGKGPMSGNNISHANNKTRRRFLPNLNEVTLISDVLGQSFQLRVSAAGLRTVD 60

Query: 61 RQGGLDRFLSNSKKENLSAR 80
           +GGLD FL+ +  + LSA 
Sbjct: 61 HRGGLDAFLAKASDDELSAN 80


>gi|294085472|ref|YP_003552232.1| 50S ribosomal protein L28P [Candidatus Puniceispirillum marinum
          IMCC1322]
 gi|292665047|gb|ADE40148.1| LSU ribosomal protein L28P [Candidatus Puniceispirillum marinum
          IMCC1322]
          Length = 95

 Score =  123 bits (311), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 43/94 (45%), Positives = 70/94 (74%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M++ C++T KTVM+GN VSHANN+TRRRFLPNL + ++ S+I+++K  LRIS  A+R+VE
Sbjct: 1  MAKRCQITGKTVMAGNNVSHANNRTRRRFLPNLQQASMQSEILDRKISLRISTSAIRTVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSE 94
          + GG+D FL  ++   L+   R+L+ +++   ++
Sbjct: 61 KHGGIDAFLMQARNSELADEARSLKREMMAVQAK 94


>gi|162148837|ref|YP_001603298.1| 50S ribosomal protein L28 [Gluconacetobacter diazotrophicus PAl
          5]
 gi|209545415|ref|YP_002277644.1| 50S ribosomal protein L28 [Gluconacetobacter diazotrophicus PAl
          5]
 gi|189029443|sp|A9HS05|RL28_GLUDA RecName: Full=50S ribosomal protein L28
 gi|161787414|emb|CAP57009.1| putative 50S ribosomal protein L28 [Gluconacetobacter
          diazotrophicus PAl 5]
 gi|209533092|gb|ACI53029.1| ribosomal protein L28 [Gluconacetobacter diazotrophicus PAl 5]
          Length = 100

 Score =  123 bits (311), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 45/96 (46%), Positives = 65/96 (67%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR C++T K V++GN VSHANNK+RRRFLPNL   +L+SDI+    +LR+S   +R+VE
Sbjct: 1  MSRRCQITGKGVLTGNNVSHANNKSRRRFLPNLQETSLLSDILGSAVRLRLSTNGIRTVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKS 96
            GGLD FL ++    L    + L+ +IL+   +K+
Sbjct: 61 HNGGLDAFLLSTPNRKLPTEAQALKRRILRAKEKKA 96


>gi|170741827|ref|YP_001770482.1| 50S ribosomal protein L28 [Methylobacterium sp. 4-46]
 gi|226732838|sp|B0UCJ9|RL28_METS4 RecName: Full=50S ribosomal protein L28
 gi|168196101|gb|ACA18048.1| ribosomal protein L28 [Methylobacterium sp. 4-46]
          Length = 96

 Score =  123 bits (311), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 51/96 (53%), Positives = 71/96 (73%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT K V++G+ VSH+N KT+RRFLPNLC +TL+SD + +  +LRIS  ALRSVE
Sbjct: 1  MSRRCELTGKAVLTGHLVSHSNRKTKRRFLPNLCNVTLLSDTLGRSVRLRISANALRSVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKS 96
           +GGLD FL  + +++LS   R L+ +I KK++  +
Sbjct: 61 HRGGLDAFLVKAGEQDLSQNARLLKREIEKKLAAAA 96


>gi|307942521|ref|ZP_07657869.1| 50S ribosomal protein L28 [Roseibium sp. TrichSKD4]
 gi|307774160|gb|EFO33373.1| 50S ribosomal protein L28 [Roseibium sp. TrichSKD4]
          Length = 129

 Score =  123 bits (311), Expect = 7e-27,   Method: Composition-based stats.
 Identities = 50/97 (51%), Positives = 71/97 (73%)

Query: 1   MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
           M+R CEL+ K VM+GN VSHANNK+RRRFLPNLC ++L+SD + + ++LRIS  ALRSVE
Sbjct: 32  MARRCELSGKDVMTGNNVSHANNKSRRRFLPNLCNVSLLSDTLGETFKLRISAHALRSVE 91

Query: 61  RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKSS 97
            +GGLD +L  +    LS + R ++  I +K +E ++
Sbjct: 92  HRGGLDNYLMKATDAQLSDKARQVKVAIKRKQAEAAA 128


>gi|90422067|ref|YP_530437.1| 50S ribosomal protein L28 [Rhodopseudomonas palustris BisB18]
 gi|122477466|sp|Q21BW8|RL28_RHOPB RecName: Full=50S ribosomal protein L28
 gi|90104081|gb|ABD86118.1| LSU ribosomal protein L28P [Rhodopseudomonas palustris BisB18]
          Length = 101

 Score =  123 bits (310), Expect = 7e-27,   Method: Composition-based stats.
 Identities = 46/92 (50%), Positives = 62/92 (67%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT K    G+KVSH+N KT+RRFLPNL  +T +SD + +  +LR+S  AL+SV+
Sbjct: 1  MSRRCELTAKGAQVGHKVSHSNIKTKRRFLPNLVNVTFLSDALGRPVRLRVSTNALKSVD 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKM 92
           +GGLD FL  +K   LS +   ++ QI KK 
Sbjct: 61 HRGGLDGFLLKAKDAELSPKAVDIKRQIQKKK 92


>gi|326385791|ref|ZP_08207420.1| ribosomal protein L28 [Novosphingobium nitrogenifigens DSM 19370]
 gi|326209770|gb|EGD60558.1| ribosomal protein L28 [Novosphingobium nitrogenifigens DSM 19370]
          Length = 95

 Score =  123 bits (310), Expect = 8e-27,   Method: Composition-based stats.
 Identities = 42/95 (44%), Positives = 63/95 (66%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR+CELT K    G+ VSHANNKT+R FLPNL  +TL+S+ +++ ++ R+S   LRSVE
Sbjct: 1  MSRICELTGKGRQIGHNVSHANNKTKRVFLPNLQNVTLLSEKLDRSFRFRVSTHGLRSVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEK 95
            GGLD +L  ++   LS R   ++ ++ K ++  
Sbjct: 61 HNGGLDNWLLKARDTELSTRALKVKRELKKAVAAA 95


>gi|241206565|ref|YP_002977661.1| 50S ribosomal protein L28 [Rhizobium leguminosarum bv. trifolii
          WSM1325]
 gi|240860455|gb|ACS58122.1| ribosomal protein L28 [Rhizobium leguminosarum bv. trifolii
          WSM1325]
          Length = 98

 Score =  123 bits (309), Expect = 9e-27,   Method: Composition-based stats.
 Identities = 57/88 (64%), Positives = 70/88 (79%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVCELT K V++GN VSHANNKT+RRFLPNLC++TLISD + Q+Y+LR+S  ALR+VE
Sbjct: 1  MSRVCELTGKAVLTGNNVSHANNKTKRRFLPNLCQVTLISDALNQRYRLRVSAAALRTVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQI 88
           +GGLD FL  + +  LS R R LR QI
Sbjct: 61 HRGGLDAFLLKASENELSMRARLLRRQI 88


>gi|220924387|ref|YP_002499689.1| 50S ribosomal protein L28 [Methylobacterium nodulans ORS 2060]
 gi|254801368|sp|B8ICZ4|RL28_METNO RecName: Full=50S ribosomal protein L28
 gi|219948994|gb|ACL59386.1| ribosomal protein L28 [Methylobacterium nodulans ORS 2060]
          Length = 96

 Score =  123 bits (309), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 52/96 (54%), Positives = 72/96 (75%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT K V++G+ VSH+N KT+RRFLPNLC++TL+SD + +  +LRIS  ALRSVE
Sbjct: 1  MSRRCELTGKAVLTGHLVSHSNRKTKRRFLPNLCKVTLLSDTLGRSVRLRISANALRSVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKS 96
           +GGLD FL  + ++ LS   R L+ +I KK++E +
Sbjct: 61 HRGGLDAFLVKAGEQELSQNARLLKREIEKKLAEAA 96


>gi|148258718|ref|YP_001243303.1| 50S ribosomal protein L28 [Bradyrhizobium sp. BTAi1]
 gi|166226547|sp|A5ETA3|RL28_BRASB RecName: Full=50S ribosomal protein L28
 gi|146410891|gb|ABQ39397.1| LSU ribosomal protein L28P [Bradyrhizobium sp. BTAi1]
          Length = 102

 Score =  123 bits (309), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 43/86 (50%), Positives = 57/86 (66%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT K    G+KVSH+N KT+RRFLPNLC +T ISD + +  +LR+S  A++SV+
Sbjct: 1  MSRRCELTAKGPQVGHKVSHSNIKTKRRFLPNLCNVTFISDALGRNVRLRVSTNAIKSVD 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRS 86
            GGLD +L  +    LS R   L+ 
Sbjct: 61 HNGGLDAYLLKANAATLSPRALELKR 86


>gi|296532524|ref|ZP_06895238.1| 50S ribosomal protein L28 [Roseomonas cervicalis ATCC 49957]
 gi|296267150|gb|EFH13061.1| 50S ribosomal protein L28 [Roseomonas cervicalis ATCC 49957]
          Length = 103

 Score =  123 bits (309), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 41/88 (46%), Positives = 55/88 (62%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+R C +T K V++GN VSHANNKTRRRFLPNL   +  SD++    Q+R+S   +R+VE
Sbjct: 1  MARRCGITGKGVLTGNNVSHANNKTRRRFLPNLQETSFFSDVLGTSVQIRLSTNGIRTVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQI 88
            GGLD FL  +    L      L+ +I
Sbjct: 61 HNGGLDSFLLGTPDRKLPTEALVLKRRI 88


>gi|83943974|ref|ZP_00956431.1| ribosomal protein L28 [Sulfitobacter sp. EE-36]
 gi|83954547|ref|ZP_00963258.1| ribosomal protein L28 [Sulfitobacter sp. NAS-14.1]
 gi|83840831|gb|EAP80002.1| ribosomal protein L28 [Sulfitobacter sp. NAS-14.1]
 gi|83845221|gb|EAP83101.1| ribosomal protein L28 [Sulfitobacter sp. EE-36]
          Length = 99

 Score =  122 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 46/97 (47%), Positives = 65/97 (67%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVCELT K  M+GN VSHA N+TRRRFLPNL  +TL S+ + + ++ RIS  ALR+V+
Sbjct: 1  MSRVCELTGKGPMTGNNVSHAKNRTRRRFLPNLNDVTLQSEALGRGFKFRISAAALRTVD 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKSS 97
           +GGLD+F++ +K   LS     ++  I K  +   +
Sbjct: 61 HRGGLDKFMAKAKDTELSVNALKVKKAIAKSSATAEA 97


>gi|316931526|ref|YP_004106508.1| 50S ribosomal protein L28 [Rhodopseudomonas palustris DX-1]
 gi|315599240|gb|ADU41775.1| ribosomal protein L28 [Rhodopseudomonas palustris DX-1]
          Length = 101

 Score =  122 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 42/88 (47%), Positives = 57/88 (64%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT K    G+KVSH+N KT+RRFLPNL  +T  SD + +  +LR+S  AL+SV+
Sbjct: 1  MSRRCELTAKGAQVGHKVSHSNIKTKRRFLPNLVNVTFQSDTLGRSVRLRVSTNALKSVD 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQI 88
           +GGLD +L  +    LS +   L+  I
Sbjct: 61 HRGGLDAYLLKASDAELSPKAVELKRAI 88


>gi|258542744|ref|YP_003188177.1| 50S ribosomal protein L28 [Acetobacter pasteurianus IFO 3283-01]
 gi|329114656|ref|ZP_08243415.1| 50S ribosomal protein L28 [Acetobacter pomorum DM001]
 gi|256633822|dbj|BAH99797.1| LSU ribosomal protein L28P [Acetobacter pasteurianus IFO 3283-01]
 gi|256636881|dbj|BAI02850.1| LSU ribosomal protein L28P [Acetobacter pasteurianus IFO 3283-03]
 gi|256639934|dbj|BAI05896.1| LSU ribosomal protein L28P [Acetobacter pasteurianus IFO 3283-07]
 gi|256642990|dbj|BAI08945.1| LSU ribosomal protein L28P [Acetobacter pasteurianus IFO 3283-22]
 gi|256646045|dbj|BAI11993.1| LSU ribosomal protein L28P [Acetobacter pasteurianus IFO 3283-26]
 gi|256649098|dbj|BAI15039.1| LSU ribosomal protein L28P [Acetobacter pasteurianus IFO 3283-32]
 gi|256652085|dbj|BAI18019.1| LSU ribosomal protein L28P [Acetobacter pasteurianus IFO
          3283-01-42C]
 gi|256655142|dbj|BAI21069.1| LSU ribosomal protein L28P [Acetobacter pasteurianus IFO 3283-12]
 gi|326696136|gb|EGE47818.1| 50S ribosomal protein L28 [Acetobacter pomorum DM001]
          Length = 101

 Score =  122 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 39/90 (43%), Positives = 61/90 (67%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR C++T K V++GN VSHANNK+RRRFLPNL   +L+S+ +    ++R+S   LR++E
Sbjct: 1  MSRRCQITGKGVLTGNNVSHANNKSRRRFLPNLQDASLVSETLGSAVRMRVSARGLRTIE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILK 90
            GGLD FL ++    L    + ++ ++L+
Sbjct: 61 HNGGLDAFLLSTPNRKLPEEAQVIKRRVLR 90


>gi|289609991|emb|CBI60347.1| unnamed protein product [Sordaria macrospora]
          Length = 97

 Score =  122 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 45/87 (51%), Positives = 61/87 (70%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR+CELT K    G+ VSHANNKT+R FLPNL  +TL+S+ +E+  +LR+S   LRSVE
Sbjct: 1  MSRICELTGKGRQVGHNVSHANNKTKRTFLPNLQNVTLMSEALERSIRLRVSTHGLRSVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQ 87
            GGLD +L  ++ ++LS R R L+  
Sbjct: 61 HVGGLDNWLLKTRDDDLSLRARRLKRD 87


>gi|222087370|ref|YP_002545907.1| ribosomal protein L28 [Agrobacterium radiobacter K84]
 gi|254801493|sp|B9JBS8|RL28_AGRRK RecName: Full=50S ribosomal protein L28
 gi|221724818|gb|ACM27974.1| ribosomal protein L28 [Agrobacterium radiobacter K84]
          Length = 101

 Score =  122 bits (307), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 58/91 (63%), Positives = 72/91 (79%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR+CELT K V+ GN VSHANNKT+RRFLPNLC++TLISD++ Q+Y+LR+S   LRSVE
Sbjct: 1  MSRMCELTGKAVLVGNNVSHANNKTKRRFLPNLCQVTLISDVLGQRYRLRVSAAGLRSVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKK 91
           +GGLD FL  + +  LS R R LR QI+KK
Sbjct: 61 HRGGLDAFLLKASENELSQRARLLRRQIIKK 91


>gi|323137532|ref|ZP_08072609.1| ribosomal protein L28 [Methylocystis sp. ATCC 49242]
 gi|322397158|gb|EFX99682.1| ribosomal protein L28 [Methylocystis sp. ATCC 49242]
          Length = 97

 Score =  122 bits (307), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 52/97 (53%), Positives = 66/97 (68%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT K V +GN VSH+N KTR RFLPNL  +TL S+ + +  +LRIS  ALRSVE
Sbjct: 1  MSRRCELTGKGVQTGNLVSHSNRKTRTRFLPNLVNVTLASEALARSVRLRISAAALRSVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKSS 97
           +GGLD FL  ++ E LS   R L+ +I KK S  ++
Sbjct: 61 HRGGLDAFLVKARDEELSQNARVLKREIEKKQSAATA 97


>gi|13473066|ref|NP_104633.1| 50S ribosomal protein L28 [Mesorhizobium loti MAFF303099]
 gi|260466651|ref|ZP_05812838.1| ribosomal protein L28 [Mesorhizobium opportunistum WSM2075]
 gi|20139637|sp|Q98FZ7|RL28_RHILO RecName: Full=50S ribosomal protein L28
 gi|14023814|dbj|BAB50419.1| 50S ribosomal protein L28 [Mesorhizobium loti MAFF303099]
 gi|259029514|gb|EEW30803.1| ribosomal protein L28 [Mesorhizobium opportunistum WSM2075]
          Length = 98

 Score =  122 bits (307), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 57/97 (58%), Positives = 72/97 (74%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT K V +GN VSHANNKT+RRFLPNL  +TLIS+ + Q  +LRIS  ALRSVE
Sbjct: 1  MSRTCELTAKAVQTGNNVSHANNKTKRRFLPNLVNVTLISEALNQNVRLRISANALRSVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKSS 97
           +GGLD FL+ +  + LS R R L+ QI KK++E+ +
Sbjct: 61 HRGGLDAFLAKADVKELSQRARLLKKQIAKKLAEQVA 97


>gi|163796313|ref|ZP_02190274.1| LSU ribosomal protein L28P [alpha proteobacterium BAL199]
 gi|159178455|gb|EDP62997.1| LSU ribosomal protein L28P [alpha proteobacterium BAL199]
          Length = 99

 Score =  122 bits (307), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 46/92 (50%), Positives = 64/92 (69%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+R CELT K V++GN VSHANN+TRRRFLPN+    L+SD++ Q  +L++   A+R+VE
Sbjct: 1  MARRCELTGKGVLTGNNVSHANNRTRRRFLPNIQETALLSDVLGQMVRLKLCTGAIRTVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKM 92
            GGLD FL+ +K  +LS   R L+ +I K  
Sbjct: 61 HNGGLDAFLAKAKVSDLSQEARRLKKRIEKVQ 92


>gi|319781255|ref|YP_004140731.1| ribosomal protein L28 [Mesorhizobium ciceri biovar biserrulae
          WSM1271]
 gi|317167143|gb|ADV10681.1| ribosomal protein L28 [Mesorhizobium ciceri biovar biserrulae
          WSM1271]
          Length = 98

 Score =  122 bits (307), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 59/97 (60%), Positives = 73/97 (75%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT K VMSGN VSHANNKT+RRFLPNL  +TLIS+ + Q  +LRIS  ALRSVE
Sbjct: 1  MSRTCELTAKAVMSGNNVSHANNKTKRRFLPNLVNVTLISEALNQNVRLRISANALRSVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKSS 97
           +GGLD FL+ +  + LS R R L+ QI KK +E+++
Sbjct: 61 HRGGLDAFLAKADVKELSQRARLLKKQIAKKTAEQAA 97


>gi|304321693|ref|YP_003855336.1| 50S ribosomal protein L28 [Parvularcula bermudensis HTCC2503]
 gi|303300595|gb|ADM10194.1| ribosomal protein L28 [Parvularcula bermudensis HTCC2503]
          Length = 94

 Score =  122 bits (307), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 49/94 (52%), Positives = 67/94 (71%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVCE T K  ++G+ VSHANNKT+RRF PNLC++TL S+ + ++++ RI+  ALRSV+
Sbjct: 1  MSRVCEFTGKRPITGHNVSHANNKTKRRFEPNLCKVTLESERLSRRFKFRITAHALRSVD 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSE 94
            GGLD FL  +K E LS R R L+ +I+   S 
Sbjct: 61 HVGGLDAFLLKAKDERLSDRARRLKREIVAAASA 94


>gi|115522159|ref|YP_779070.1| 50S ribosomal protein L28 [Rhodopseudomonas palustris BisA53]
 gi|122298122|sp|Q07VE4|RL28_RHOP5 RecName: Full=50S ribosomal protein L28
 gi|115516106|gb|ABJ04090.1| LSU ribosomal protein L28P [Rhodopseudomonas palustris BisA53]
          Length = 101

 Score =  122 bits (306), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 48/92 (52%), Positives = 63/92 (68%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT K    G+KVSH+N KT+RRFLPNL  IT ISD + ++ +LR+S  AL+SV+
Sbjct: 1  MSRRCELTAKGAQVGHKVSHSNIKTKRRFLPNLVNITFISDALGRQVRLRVSTNALKSVD 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKM 92
           +GGLD FL  +K   LS +   ++ QI KK 
Sbjct: 61 HRGGLDGFLLKAKDAELSPKAVDIKRQIEKKK 92


>gi|126725204|ref|ZP_01741047.1| 50S ribosomal protein L28 [Rhodobacterales bacterium HTCC2150]
 gi|126706368|gb|EBA05458.1| 50S ribosomal protein L28 [Rhodobacterales bacterium HTCC2150]
          Length = 99

 Score =  122 bits (306), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 52/88 (59%), Positives = 62/88 (70%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVCELT K  MSGN VSHA N+TRRRFLPNL  ITL SD   Q YQLRIS  ALR+V+
Sbjct: 4  MSRVCELTGKGPMSGNNVSHAKNRTRRRFLPNLNAITLQSDATGQSYQLRISAAALRTVD 63

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQI 88
           +GGLD F++ +K   LS +   ++  I
Sbjct: 64 HRGGLDAFMAKAKDTELSTKALKIKKDI 91


>gi|163759938|ref|ZP_02167022.1| 50S ribosomal protein L28 [Hoeflea phototrophica DFL-43]
 gi|162282896|gb|EDQ33183.1| 50S ribosomal protein L28 [Hoeflea phototrophica DFL-43]
          Length = 98

 Score =  122 bits (306), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 62/97 (63%), Positives = 73/97 (75%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT K V SGN VSHANN+TRRRFLPNLC +TLISD M Q+Y+LRIS  ALR+VE
Sbjct: 1  MSRSCELTGKAVQSGNNVSHANNRTRRRFLPNLCNVTLISDAMGQRYRLRISANALRTVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKSS 97
           +GGLD FL+ +K   LS R R L+ QI KK+ E  +
Sbjct: 61 HRGGLDAFLAKAKDGELSMRARLLKRQIAKKLEENKA 97


>gi|332185549|ref|ZP_08387297.1| ribosomal protein L28 [Sphingomonas sp. S17]
 gi|332014527|gb|EGI56584.1| ribosomal protein L28 [Sphingomonas sp. S17]
          Length = 102

 Score =  121 bits (305), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 50/92 (54%), Positives = 64/92 (69%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR+CELT K    GN VSHANNKT+R FLPNL  +TLISD +E+  +LR+S   LRSVE
Sbjct: 1  MSRICELTGKGRQVGNNVSHANNKTKRTFLPNLQNVTLISDALEKSVRLRVSTHGLRSVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKM 92
            GGLD +L  +  + LS R R L+  ++KK+
Sbjct: 61 HNGGLDNWLVKTSDDQLSLRARRLKRDVVKKL 92


>gi|254486876|ref|ZP_05100081.1| ribosomal protein L28 [Roseobacter sp. GAI101]
 gi|214043745|gb|EEB84383.1| ribosomal protein L28 [Roseobacter sp. GAI101]
          Length = 100

 Score =  121 bits (304), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 46/91 (50%), Positives = 63/91 (69%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVCELT K  M+GN VSHA N+TRRRFLPNL  +TL S+ + + ++ RIS  ALR+V+
Sbjct: 1  MSRVCELTGKGPMTGNNVSHAKNRTRRRFLPNLNDVTLQSESLGRSFKFRISAAALRTVD 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKK 91
           +GGLD+F++ +K   LS     ++  I K 
Sbjct: 61 HRGGLDKFMAKAKDTELSGNALKVKKAIAKS 91


>gi|146337760|ref|YP_001202808.1| 50S ribosomal protein L28 [Bradyrhizobium sp. ORS278]
 gi|166226548|sp|A4YKZ2|RL28_BRASO RecName: Full=50S ribosomal protein L28
 gi|146190566|emb|CAL74568.1| 50S ribosomal protein L28 [Bradyrhizobium sp. ORS278]
          Length = 102

 Score =  121 bits (304), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 43/86 (50%), Positives = 57/86 (66%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT K    G+KVSH+N KT+RRFLPNLC +T ISD + +  +LR+S  A++SV+
Sbjct: 1  MSRRCELTAKGPQVGHKVSHSNIKTKRRFLPNLCNVTFISDALGRNVRLRVSTNAIKSVD 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRS 86
            GGLD +L  +    LS R   L+ 
Sbjct: 61 HNGGLDAYLMKANAAALSPRALELKR 86


>gi|254472185|ref|ZP_05085585.1| ribosomal protein L28 [Pseudovibrio sp. JE062]
 gi|211958468|gb|EEA93668.1| ribosomal protein L28 [Pseudovibrio sp. JE062]
          Length = 95

 Score =  121 bits (304), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 53/95 (55%), Positives = 71/95 (74%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+R CELT K VM+GN VSHANNK+RRRFLPNLC ++L+SD + + Y+LRIS  ALRSVE
Sbjct: 1  MARRCELTGKDVMTGNNVSHANNKSRRRFLPNLCNVSLMSDTLGETYKLRISAHALRSVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEK 95
           +GGLD FL  + +  LS + R LR++I ++ +  
Sbjct: 61 HRGGLDAFLMKAAEAELSPKARLLRTEIKRRQAAA 95


>gi|27375273|ref|NP_766802.1| 50S ribosomal protein L28 [Bradyrhizobium japonicum USDA 110]
 gi|67461519|sp|Q89XZ3|RL28_BRAJA RecName: Full=50S ribosomal protein L28
 gi|27348409|dbj|BAC45427.1| 50S ribosomal protein L28 [Bradyrhizobium japonicum USDA 110]
          Length = 102

 Score =  121 bits (304), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 46/96 (47%), Positives = 64/96 (66%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT K  + G+KVSH+N KT+RRFLPNL  +T IS+ +E+  +LR+S  A++SV+
Sbjct: 1  MSRRCELTAKGPLVGHKVSHSNIKTKRRFLPNLVNVTFISEALERNVRLRVSTNAVKSVD 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKS 96
            GGLD FL  +  + LS R   L+  I KK+   +
Sbjct: 61 HNGGLDAFLLKASADALSPRALELKRAIQKKVGVTA 96


>gi|288957262|ref|YP_003447603.1| large subunit ribosomal protein L28 [Azospirillum sp. B510]
 gi|288909570|dbj|BAI71059.1| large subunit ribosomal protein L28 [Azospirillum sp. B510]
          Length = 99

 Score =  120 bits (303), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 44/97 (45%), Positives = 62/97 (63%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+R C +T K    GN VSHANNK RRRF PNL   +L+SD + Q  +LR+S  A+RS+E
Sbjct: 1  MARRCSVTGKGTQFGNNVSHANNKNRRRFQPNLQETSLLSDSLGQLVRLRLSVNAIRSIE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKSS 97
           +GGLD FL ++K   LS   R ++ +I K   ++ +
Sbjct: 61 HKGGLDAFLLDAKDAVLSLDARRIKRRISKAQEKQQA 97


>gi|23016453|ref|ZP_00056209.1| COG0227: Ribosomal protein L28 [Magnetospirillum magnetotacticum
          MS-1]
          Length = 101

 Score =  120 bits (303), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 45/96 (46%), Positives = 63/96 (65%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+R C +T K V++GN VSHANNKTRRRFLPNL   +L+SD +    +LRIS   L+++E
Sbjct: 1  MARRCAITGKGVLTGNNVSHANNKTRRRFLPNLQEASLLSDALGHAVRLRISTNGLKTIE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKS 96
            GG+D FL +     LSA  R L+ +I + ++ K 
Sbjct: 61 HNGGIDSFLLSVATTKLSAEARRLKKRIERALASKQ 96


>gi|85709871|ref|ZP_01040936.1| ribosomal protein L28 [Erythrobacter sp. NAP1]
 gi|85688581|gb|EAQ28585.1| ribosomal protein L28 [Erythrobacter sp. NAP1]
          Length = 95

 Score =  120 bits (303), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 44/95 (46%), Positives = 64/95 (67%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR+CELT K    GN VSHANNKT+R FLPNL  +TL+S+ +++ ++ R+S   LRSVE
Sbjct: 1  MSRICELTGKGRQVGNNVSHANNKTKRVFLPNLQNVTLMSEKLDRSFKFRVSTHGLRSVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEK 95
            GGLD +L  +K + LS R   ++ ++ K ++  
Sbjct: 61 HNGGLDNWLLKTKDDKLSTRALKVKRELKKAVAAA 95


>gi|85375365|ref|YP_459427.1| 50S ribosomal protein L28 [Erythrobacter litoralis HTCC2594]
 gi|122543434|sp|Q2N6R1|RL28_ERYLH RecName: Full=50S ribosomal protein L28
 gi|84788448|gb|ABC64630.1| ribosomal protein L28 [Erythrobacter litoralis HTCC2594]
          Length = 99

 Score =  120 bits (303), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 44/97 (45%), Positives = 66/97 (68%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR+CELT K    G+ VSHANNKT+R FLPNL  +TL+S+ +++ ++ R+S   LRSVE
Sbjct: 1  MSRICELTGKGRQVGHNVSHANNKTKRVFLPNLQNVTLLSEKLDRGFKFRVSTQGLRSVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKSS 97
            GGLD +L  +K + LS+    ++ ++ K M+E  +
Sbjct: 61 HNGGLDNWLLKTKDDKLSSNALKVKRELKKAMNEADA 97


>gi|154246139|ref|YP_001417097.1| 50S ribosomal protein L28 [Xanthobacter autotrophicus Py2]
 gi|226699185|sp|A7IHE7|RL28_XANP2 RecName: Full=50S ribosomal protein L28
 gi|154160224|gb|ABS67440.1| ribosomal protein L28 [Xanthobacter autotrophicus Py2]
          Length = 100

 Score =  120 bits (303), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 45/88 (51%), Positives = 64/88 (72%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR C+LT K V+SG+ VSH+N+KT+RRFLPNLC +TL S+ +++  +LR+S  AL+SV+
Sbjct: 1  MSRRCDLTGKGVLSGHTVSHSNHKTKRRFLPNLCNVTLESETLKRTIRLRVSANALKSVD 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQI 88
           +GGLD FL  ++ E LS R    +  I
Sbjct: 61 HRGGLDAFLKKARDEELSPRALDFKRLI 88


>gi|304394146|ref|ZP_07376069.1| 50S ribosomal protein L28 [Ahrensia sp. R2A130]
 gi|303293586|gb|EFL87963.1| 50S ribosomal protein L28 [Ahrensia sp. R2A130]
          Length = 96

 Score =  120 bits (302), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 53/96 (55%), Positives = 72/96 (75%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT K VM+GN VSHANNKTRRRFLPNL  +TL+S+ +E+  ++RI+  ALR+VE
Sbjct: 1  MSRKCELTGKAVMTGNNVSHANNKTRRRFLPNLVNVTLLSEALEKGVRMRIAASALRTVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKS 96
           +GGLD FL   K+ NLS +   +R ++ KK++E +
Sbjct: 61 HRGGLDAFLMKEKEVNLSPKAALIRKEVAKKLAEAA 96


>gi|158422171|ref|YP_001523463.1| 50S ribosomal protein L28 [Azorhizobium caulinodans ORS 571]
 gi|172048038|sp|A8IMG3|RL28_AZOC5 RecName: Full=50S ribosomal protein L28
 gi|158329060|dbj|BAF86545.1| ribosomal protein L28 [Azorhizobium caulinodans ORS 571]
          Length = 99

 Score =  120 bits (302), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 47/90 (52%), Positives = 69/90 (76%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR C+LT K V++G+ VSH+N KT+RRFLPNLC +TL SD++++  ++RIS  AL+SV+
Sbjct: 1  MSRRCDLTGKAVLTGHLVSHSNRKTKRRFLPNLCNVTLQSDVLQRSIRVRISANALKSVD 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILK 90
           +GGLD FL  ++ E L+ R+  L+ QI+K
Sbjct: 61 HRGGLDAFLLKARDEELAPRVLELKRQIVK 90


>gi|296282926|ref|ZP_06860924.1| 50S ribosomal protein L28 [Citromicrobium bathyomarinum JL354]
          Length = 96

 Score =  120 bits (302), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 45/96 (46%), Positives = 65/96 (67%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR+CELT K    G+ VSHANNKT+R FLPNL  +TL+S+ +++ ++ R+S   LRSVE
Sbjct: 1  MSRICELTGKGRQVGHNVSHANNKTKRVFLPNLQNVTLMSEKLDRSFKFRVSTQGLRSVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKS 96
            GGLD +L  +K E LSAR   ++ ++ K  +  +
Sbjct: 61 HNGGLDNWLLKTKDEKLSARALKVKRELKKAAAPAA 96


>gi|307293959|ref|ZP_07573803.1| ribosomal protein L28 [Sphingobium chlorophenolicum L-1]
 gi|306880110|gb|EFN11327.1| ribosomal protein L28 [Sphingobium chlorophenolicum L-1]
          Length = 97

 Score =  119 bits (300), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 46/88 (52%), Positives = 59/88 (67%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR+CELT K    G+ VSHANNKT+R FLPNL  ++LIS+ +E   +LR+S   LRSVE
Sbjct: 1  MSRICELTGKGRQVGHNVSHANNKTKRVFLPNLQNVSLISEALETTVKLRVSTHGLRSVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQI 88
            GGLD +L  +  E LS + R L+  I
Sbjct: 61 HNGGLDNWLLKTSDEKLSLKARRLKRDI 88


>gi|294012907|ref|YP_003546367.1| ribosomal protein L28 [Sphingobium japonicum UT26S]
 gi|292676237|dbj|BAI97755.1| ribosomal protein L28 [Sphingobium japonicum UT26S]
          Length = 97

 Score =  119 bits (300), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 45/88 (51%), Positives = 59/88 (67%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR+CELT K    G+ VSHANNKT+R FLPNL  ++LIS+ +E   +LR+S   LRSVE
Sbjct: 1  MSRICELTGKGRQVGHNVSHANNKTKRVFLPNLQNVSLISEALETTVKLRVSTHGLRSVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQI 88
            GGLD +L  +  + LS + R L+  I
Sbjct: 61 HNGGLDNWLLKTSDDKLSLKARRLKRDI 88


>gi|319404842|emb|CBI78443.1| 50S ribosomal protein L28 [Bartonella rochalimae ATCC BAA-1498]
          Length = 95

 Score =  119 bits (300), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 59/95 (62%), Positives = 72/95 (75%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT K V  GN VSHANNKTRRRFLPNLC +TLIS++++Q Y+LRIS  ALRSVE
Sbjct: 1  MSRACELTGKAVQYGNNVSHANNKTRRRFLPNLCNVTLISELLQQSYRLRISANALRSVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEK 95
           +GGLD FL  +  + LS R R L+ QI+KK  ++
Sbjct: 61 HRGGLDNFLIKADDKELSQRGRLLKRQIMKKKLKE 95


>gi|217976519|ref|YP_002360666.1| 50S ribosomal protein L28 [Methylocella silvestris BL2]
 gi|254801369|sp|B8EQN3|RL28_METSB RecName: Full=50S ribosomal protein L28
 gi|217501895|gb|ACK49304.1| ribosomal protein L28 [Methylocella silvestris BL2]
          Length = 96

 Score =  119 bits (300), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 51/96 (53%), Positives = 70/96 (72%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR C+LT K V +GN VSH+N+KTR RFLPNLC +TLISD++++K + R++  ALRSVE
Sbjct: 1  MSRRCDLTGKAVQTGNLVSHSNHKTRTRFLPNLCNVTLISDVLQRKVRFRVAVAALRSVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKS 96
           +GGLD FL+ +    LS   R ++ +ILKK +  S
Sbjct: 61 HRGGLDAFLAKADDAELSLGARAIKREILKKQAAAS 96


>gi|87198247|ref|YP_495504.1| 50S ribosomal protein L28 [Novosphingobium aromaticivorans DSM
          12444]
 gi|123491021|sp|Q2GBV3|RL28_NOVAD RecName: Full=50S ribosomal protein L28
 gi|87133928|gb|ABD24670.1| LSU ribosomal protein L28P [Novosphingobium aromaticivorans DSM
          12444]
          Length = 94

 Score =  119 bits (299), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 43/94 (45%), Positives = 62/94 (65%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR+CELT K    G+ VSHANNKT+R FLPNL  +TL+S+ +++ ++ R+S   LRSVE
Sbjct: 1  MSRICELTGKGRQVGHNVSHANNKTKRLFLPNLQNVTLLSEKLDRSFKFRVSTHGLRSVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSE 94
            GGLD +L       LSAR   ++ +++K  + 
Sbjct: 61 HNGGLDNWLLKQSDTKLSARALKVKRELVKASAA 94


>gi|295691053|ref|YP_003594746.1| 50S 50S ribosomal protein L28 [Caulobacter segnis ATCC 21756]
 gi|295432956|gb|ADG12128.1| ribosomal protein L28 [Caulobacter segnis ATCC 21756]
          Length = 145

 Score =  118 bits (298), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 43/84 (51%), Positives = 56/84 (66%)

Query: 1   MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
           MSR CELT    M G+ VSH+N KT+RRFLP L   TL S+ + Q ++LRIS  ALR+++
Sbjct: 47  MSRRCELTGIGPMVGHNVSHSNIKTKRRFLPALSPATLQSESLGQSFKLRISNAALRTLD 106

Query: 61  RQGGLDRFLSNSKKENLSARMRTL 84
            +GGLD FL  +K E LS R   +
Sbjct: 107 FKGGLDTFLLGAKDEQLSPRALKI 130


>gi|86747672|ref|YP_484168.1| 50S ribosomal protein L28 [Rhodopseudomonas palustris HaA2]
 gi|123293234|sp|Q2J2Q3|RL28_RHOP2 RecName: Full=50S ribosomal protein L28
 gi|86570700|gb|ABD05257.1| LSU ribosomal protein L28P [Rhodopseudomonas palustris HaA2]
          Length = 101

 Score =  118 bits (298), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 43/84 (51%), Positives = 58/84 (69%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT K V +G+KVSH+N KT+RRFLPNL  +T +SD + +  +LR+S  AL+SV+
Sbjct: 1  MSRRCELTAKGVQTGHKVSHSNIKTKRRFLPNLVNVTFLSDALGRPVRLRVSTNALKSVD 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTL 84
           +GGLD FL  +    LS +   L
Sbjct: 61 HRGGLDAFLLKASVAELSPKAAEL 84


>gi|329848403|ref|ZP_08263431.1| ribosomal protein L28 [Asticcacaulis biprosthecum C19]
 gi|328843466|gb|EGF93035.1| ribosomal protein L28 [Asticcacaulis biprosthecum C19]
          Length = 96

 Score =  118 bits (298), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 46/96 (47%), Positives = 65/96 (67%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT    M G+ VSH+N KT+RRFLP+L +  L S+ + Q Y+L+IS  ALR+++
Sbjct: 1  MSRRCELTGVGPMVGHSVSHSNVKTKRRFLPSLRQTALQSEALGQAYRLKISNAALRTLD 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKS 96
           +GGLD FL  +   +LS R R L+ QI  K++ K+
Sbjct: 61 FRGGLDAFLVKADDADLSLRARRLKKQIKDKLAAKA 96


>gi|94498764|ref|ZP_01305312.1| ribosomal protein L28 [Sphingomonas sp. SKA58]
 gi|94421773|gb|EAT06826.1| ribosomal protein L28 [Sphingomonas sp. SKA58]
          Length = 97

 Score =  118 bits (298), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 45/89 (50%), Positives = 60/89 (67%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR+CELT K    G+ VSHANNKT+R FLPNL  ++LIS+ +E   +LR+S   LRSVE
Sbjct: 1  MSRICELTGKGRQVGHNVSHANNKTKRVFLPNLQNVSLISEALETTVKLRVSTHGLRSVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQIL 89
            GGLD +L  +  + LS + R L+  I+
Sbjct: 61 HNGGLDNWLVKTSDDKLSLKARRLKRDIV 89


>gi|114570840|ref|YP_757520.1| 50S ribosomal protein L28P [Maricaulis maris MCS10]
 gi|122315437|sp|Q0AMB1|RL28_MARMM RecName: Full=50S ribosomal protein L28
 gi|114341302|gb|ABI66582.1| LSU ribosomal protein L28P [Maricaulis maris MCS10]
          Length = 94

 Score =  117 bits (295), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 44/94 (46%), Positives = 65/94 (69%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+R CELT   V++GN VSHA NK+RRRFLPNLC +TL S+ + + ++LR++  ALRSV+
Sbjct: 1  MARRCELTGTGVLTGNNVSHAQNKSRRRFLPNLCDVTLASEKLGRGFKLRVAAKALRSVD 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSE 94
            GGLD +L  ++ E LS +   ++  + K M+ 
Sbjct: 61 HVGGLDVYLLKARDEKLSDKALKIKRDLKKAMAA 94


>gi|149185198|ref|ZP_01863515.1| ribosomal protein L28 [Erythrobacter sp. SD-21]
 gi|148831309|gb|EDL49743.1| ribosomal protein L28 [Erythrobacter sp. SD-21]
          Length = 95

 Score =  117 bits (295), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 44/94 (46%), Positives = 62/94 (65%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR+CELT K    GN VSHANNKT+R FLPNL  +TL+S+ +++ ++ R+S   LRSVE
Sbjct: 1  MSRICELTGKGRQVGNNVSHANNKTKRVFLPNLQNVTLMSEKLDRSFKFRVSTQGLRSVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSE 94
            GGLD +L  +  E LSA    ++ ++ K  + 
Sbjct: 61 HNGGLDNWLMKTSDEKLSANALKVKRELKKAAAA 94


>gi|302382242|ref|YP_003818065.1| ribosomal protein L28 [Brevundimonas subvibrioides ATCC 15264]
 gi|302192870|gb|ADL00442.1| ribosomal protein L28 [Brevundimonas subvibrioides ATCC 15264]
          Length = 98

 Score =  117 bits (294), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 44/97 (45%), Positives = 66/97 (68%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT    M GN VSH+N KT+RRFLP+L ++ L S+ + Q Y LRIS  ALR+++
Sbjct: 1  MSRRCELTGIGPMVGNLVSHSNVKTKRRFLPSLKKVKLASEALGQSYTLRISNAALRTLD 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKSS 97
           +GGLD F+  +  E LS   + ++ Q+  K++E+++
Sbjct: 61 FKGGLDPFIVKADDEKLSVAAQRIKRQVKAKLAEQAA 97


>gi|16124914|ref|NP_419478.1| 50S ribosomal protein L28 [Caulobacter crescentus CB15]
 gi|221233636|ref|YP_002516072.1| 50S ribosomal protein L28 [Caulobacter crescentus NA1000]
 gi|20139681|sp|Q9AAE1|RL28_CAUCR RecName: Full=50S ribosomal protein L28
 gi|254801349|sp|B8H0R5|RL28_CAUCN RecName: Full=50S ribosomal protein L28
 gi|13421878|gb|AAK22646.1| ribosomal protein L28 [Caulobacter crescentus CB15]
 gi|220962808|gb|ACL94164.1| LSU ribosomal protein L28P [Caulobacter crescentus NA1000]
          Length = 99

 Score =  117 bits (293), Expect = 7e-25,   Method: Composition-based stats.
 Identities = 43/84 (51%), Positives = 56/84 (66%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT    M G+ VSH+N KT+RRFLP L   TL S+ + Q ++LRIS  ALR+++
Sbjct: 1  MSRRCELTGIGPMVGHNVSHSNIKTKRRFLPALSPATLQSESLGQSFKLRISNAALRTLD 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTL 84
           +GGLD FL  +K E LS R   +
Sbjct: 61 FKGGLDTFLLGAKDEQLSPRALKI 84


>gi|209966402|ref|YP_002299317.1| ribosomal protein L28 [Rhodospirillum centenum SW]
 gi|226699154|sp|B6IW31|RL28_RHOCS RecName: Full=50S ribosomal protein L28
 gi|209959868|gb|ACJ00505.1| ribosomal protein L28 [Rhodospirillum centenum SW]
          Length = 99

 Score =  116 bits (292), Expect = 8e-25,   Method: Composition-based stats.
 Identities = 42/97 (43%), Positives = 62/97 (63%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR C +T K V +GN VSHANNK+RRR+LPNL   +L+SD + +  +LR+S   +R++E
Sbjct: 1  MSRKCAVTGKGVQTGNNVSHANNKSRRRWLPNLQETSLLSDTLGRMVRLRLSTNGIRTIE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKSS 97
           +GGLD  L +     L+   R ++ QI K +  K +
Sbjct: 61 HKGGLDAALLDIPDARLNQDARRVKKQIQKAIEAKKA 97


>gi|315498114|ref|YP_004086918.1| ribosomal protein l28 [Asticcacaulis excentricus CB 48]
 gi|315416126|gb|ADU12767.1| ribosomal protein L28 [Asticcacaulis excentricus CB 48]
          Length = 98

 Score =  116 bits (292), Expect = 9e-25,   Method: Composition-based stats.
 Identities = 43/88 (48%), Positives = 58/88 (65%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT    M G+ VSH+N KT+RRFLP+L    L S+ + Q ++L+IS  ALR+++
Sbjct: 1  MSRRCELTGVGPMVGHSVSHSNIKTKRRFLPSLRETALQSEALGQSFRLKISNAALRTLD 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQI 88
           +GGLD FL  +    LS R R L+ QI
Sbjct: 61 FKGGLDAFLVKADDTELSLRARRLKKQI 88


>gi|312113448|ref|YP_004011044.1| ribosomal protein L28 [Rhodomicrobium vannielii ATCC 17100]
 gi|311218577|gb|ADP69945.1| ribosomal protein L28 [Rhodomicrobium vannielii ATCC 17100]
          Length = 102

 Score =  116 bits (292), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 49/90 (54%), Positives = 65/90 (72%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT K  + G+ VSH+N KT+RR+LPNLC +TLISD + +  +LRIS  ALRSVE
Sbjct: 1  MSRQCELTGKGGLVGHLVSHSNIKTKRRYLPNLCNVTLISDSLGRGVRLRISANALRSVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILK 90
           +GGLD FL  ++ E LS + R L+ ++ K
Sbjct: 61 HRGGLDAFLLKARDEELSLKARRLKKEVSK 90


>gi|298293653|ref|YP_003695592.1| ribosomal protein L28 [Starkeya novella DSM 506]
 gi|296930164|gb|ADH90973.1| ribosomal protein L28 [Starkeya novella DSM 506]
          Length = 102

 Score =  116 bits (291), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 46/91 (50%), Positives = 66/91 (72%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT K V++GN VSH+N KTRRRFLPNL  +TL SD++++  +LR+S  AL++V+
Sbjct: 1  MSRRCELTGKAVLTGNLVSHSNRKTRRRFLPNLVNVTLTSDVLKRSVKLRVSANALKTVD 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKK 91
           +GGLD FL  ++ E LS +   L+  ++K 
Sbjct: 61 HRGGLDAFLIKARTEELSPKAAELKRAVVKA 91


>gi|167648087|ref|YP_001685750.1| 50S ribosomal protein L28 [Caulobacter sp. K31]
 gi|189042427|sp|B0SXP0|RL28_CAUSK RecName: Full=50S ribosomal protein L28
 gi|167350517|gb|ABZ73252.1| ribosomal protein L28 [Caulobacter sp. K31]
          Length = 101

 Score =  115 bits (290), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 43/82 (52%), Positives = 55/82 (67%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT    M G+ VSH+N KT+RRFLP L   +L SD + Q ++LRIS  ALR+++
Sbjct: 1  MSRRCELTGIGPMVGHNVSHSNIKTKRRFLPALSPASLQSDSLGQTFKLRISNAALRTLD 60

Query: 61 RQGGLDRFLSNSKKENLSARMR 82
           +GGLD FL  +K E LS R  
Sbjct: 61 FRGGLDVFLLGAKDEQLSPRAL 82


>gi|114799496|ref|YP_762169.1| 50S ribosomal protein [Hyphomonas neptunium ATCC 15444]
 gi|122941994|sp|Q0BWH4|RL28_HYPNA RecName: Full=50S ribosomal protein L28
 gi|114739670|gb|ABI77795.1| 50S ribosomal protein [Hyphomonas neptunium ATCC 15444]
          Length = 94

 Score =  115 bits (288), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 44/91 (48%), Positives = 65/91 (71%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT    M GN VSH+  KT+RR+LPNL ++TL S+ ++Q +++RI+  ALR+V+
Sbjct: 1  MSRECELTGTKPMVGNIVSHSQIKTKRRYLPNLVQVTLRSEALDQNFRMRIAAKALRTVD 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKK 91
          + GGLD FL+ +K+E LS +   ++  I KK
Sbjct: 61 KLGGLDAFLAKAKEEGLSTKALKIKRDIAKK 91


>gi|300024668|ref|YP_003757279.1| ribosomal protein L28 [Hyphomicrobium denitrificans ATCC 51888]
 gi|299526489|gb|ADJ24958.1| ribosomal protein L28 [Hyphomicrobium denitrificans ATCC 51888]
          Length = 97

 Score =  114 bits (286), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 47/97 (48%), Positives = 66/97 (68%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+R CELT    +SG   SHA NKT+R+F PNL  +TL+SD + +K +LRIS  AL+SVE
Sbjct: 1  MTRRCELTGTLPLSGQLRSHAENKTKRKFRPNLHNVTLLSDALGRKVRLRISARALKSVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKSS 97
           +GGLD FL  +K + LSA    L+ ++ K  +EK++
Sbjct: 61 HRGGLDAFLLKAKNDELSAACLKLKRELQKAQAEKAA 97


>gi|83591550|ref|YP_425302.1| 50S ribosomal protein L28 [Rhodospirillum rubrum ATCC 11170]
 gi|123527567|sp|Q2RXY0|RL28_RHORT RecName: Full=50S ribosomal protein L28
 gi|83574464|gb|ABC21015.1| LSU ribosomal protein L28P [Rhodospirillum rubrum ATCC 11170]
          Length = 99

 Score =  113 bits (285), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 39/90 (43%), Positives = 63/90 (70%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR C +T K V +GN VSH+N K+RRRFLPNL   +L+SD++ +  ++R+S   LR+VE
Sbjct: 1  MSRRCAVTGKGVQTGNNVSHSNIKSRRRFLPNLQVNSLMSDLLREPVRMRLSAHGLRTVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILK 90
           +GG+D FL ++    L+  +R ++ +++K
Sbjct: 61 HRGGIDAFLLSTPSVELTVELRKVKRRMVK 90


>gi|182680325|ref|YP_001834471.1| 50S ribosomal protein L28 [Beijerinckia indica subsp. indica ATCC
          9039]
 gi|226738033|sp|B2IEP2|RL28_BEII9 RecName: Full=50S ribosomal protein L28
 gi|182636208|gb|ACB96982.1| ribosomal protein L28 [Beijerinckia indica subsp. indica ATCC
          9039]
          Length = 98

 Score =  113 bits (285), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 45/89 (50%), Positives = 62/89 (69%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT K V++GN VSH+N KTR RFLPNLC +TLISD ++++   R++   LRSVE
Sbjct: 1  MSRRCELTGKAVLTGNLVSHSNRKTRTRFLPNLCNVTLISDTLQRRIHFRVAAATLRSVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQIL 89
           +GGLD FL  +    LS    +++ +I+
Sbjct: 61 HRGGLDAFLVKAADAQLSPGALSVKREIV 89


>gi|15603977|ref|NP_220492.1| 50S ribosomal protein L28 [Rickettsia prowazekii str. Madrid E]
 gi|6225989|sp|Q9ZE48|RL28_RICPR RecName: Full=50S ribosomal protein L28
 gi|3860668|emb|CAA14569.1| 50S RIBOSOMAL PROTEIN L28 (rpmB) [Rickettsia prowazekii]
 gi|292571691|gb|ADE29606.1| 50S ribosomal protein L28 [Rickettsia prowazekii Rp22]
          Length = 97

 Score =  113 bits (285), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 41/96 (42%), Positives = 60/96 (62%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT   V+ GN VSH+  KTRRRF PNL  I   SDI ++ Y+L ++   +RSVE
Sbjct: 1  MSRKCELTGVGVLYGNNVSHSQRKTRRRFEPNLRSIKFRSDITDEVYRLSVNARCIRSVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKS 96
          + GG D ++  +  + LS+  R ++ +I+   + KS
Sbjct: 61 KAGGFDAYILKANDDILSSAARAIKQKIIHIKAAKS 96


>gi|254293143|ref|YP_003059166.1| ribosomal protein L28 [Hirschia baltica ATCC 49814]
 gi|254041674|gb|ACT58469.1| ribosomal protein L28 [Hirschia baltica ATCC 49814]
          Length = 98

 Score =  113 bits (283), Expect = 9e-24,   Method: Composition-based stats.
 Identities = 43/88 (48%), Positives = 66/88 (75%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT K  ++GN VSH+N +T+RRFLPNL +++L S+ + Q+++LRI+  ALR+V+
Sbjct: 1  MSRECELTGKKPITGNNVSHSNLRTKRRFLPNLVKVSLRSEALGQEFKLRIAASALRTVD 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQI 88
          ++GGLD FL+   +E LSA+   ++  I
Sbjct: 61 KRGGLDAFLAKETEEKLSAKAAKIKRDI 88


>gi|51473250|ref|YP_067007.1| 50S ribosomal protein L28 [Rickettsia typhi str. Wilmington]
 gi|67461384|sp|Q68XW7|RL28_RICTY RecName: Full=50S ribosomal protein L28
 gi|51459562|gb|AAU03525.1| 50S ribosomal protein L28 [Rickettsia typhi str. Wilmington]
          Length = 97

 Score =  113 bits (283), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 39/96 (40%), Positives = 61/96 (63%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT  +V+ GN VSH+  KTRRRF PNL  +   SDI ++ Y+L ++   +RSVE
Sbjct: 1  MSRKCELTGVSVLYGNNVSHSQRKTRRRFEPNLRSVKFRSDITDEVYRLSVNARCIRSVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKS 96
          + GG D ++  +  + LS+  R ++ +I+   + +S
Sbjct: 61 KAGGFDEYILKANNDVLSSTARAIKQKIIDIKAVES 96


>gi|148261685|ref|YP_001235812.1| 50S ribosomal protein L28 [Acidiphilium cryptum JF-5]
 gi|326405178|ref|YP_004285260.1| 50S ribosomal protein L28 [Acidiphilium multivorum AIU301]
 gi|166226532|sp|A5G211|RL28_ACICJ RecName: Full=50S ribosomal protein L28
 gi|146403366|gb|ABQ31893.1| LSU ribosomal protein L28P [Acidiphilium cryptum JF-5]
 gi|325052040|dbj|BAJ82378.1| 50S ribosomal protein L28 [Acidiphilium multivorum AIU301]
          Length = 100

 Score =  112 bits (281), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 41/84 (48%), Positives = 58/84 (69%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+R C++T K+V+SGN VSHANNK+RRRFLPNL    L SD +    +LR++   L ++E
Sbjct: 1  MTRRCDITGKSVLSGNNVSHANNKSRRRFLPNLQDSALQSDALGHSVKLRVTPRGLATIE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTL 84
          ++GGLD FL ++    L+   RTL
Sbjct: 61 QKGGLDAFLLDTPNRKLTDEARTL 84


>gi|330813137|ref|YP_004357376.1| LSU ribosomal protein L28p [Candidatus Pelagibacter sp. IMCC9063]
 gi|327486232|gb|AEA80637.1| LSU ribosomal protein L28p [Candidatus Pelagibacter sp. IMCC9063]
          Length = 116

 Score =  110 bits (277), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 42/91 (46%), Positives = 66/91 (72%)

Query: 1   MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
           M++VCELT K  MSGN VSH+NNKT+R+F PNL +++L S+++ +    +IS  AL++V+
Sbjct: 24  MAKVCELTGKRPMSGNTVSHSNNKTKRKFYPNLKKVSLRSELLNKNISFKISTRALKAVD 83

Query: 61  RQGGLDRFLSNSKKENLSARMRTLRSQILKK 91
            +GG+D FL  +K   L+ R++ ++ QIL K
Sbjct: 84  FRGGIDEFLIRAKNAKLALRVKKIKKQILSK 114


>gi|56416932|ref|YP_154006.1| 50S ribosomal protein L28 [Anaplasma marginale str. St. Maries]
 gi|222475298|ref|YP_002563715.1| 50S ribosomal protein L28 (rpmB) [Anaplasma marginale str. Florida]
 gi|56388164|gb|AAV86751.1| 50S ribosomal protein L28 [Anaplasma marginale str. St. Maries]
 gi|222419436|gb|ACM49459.1| 50S ribosomal protein L28 (rpmB) [Anaplasma marginale str. Florida]
          Length = 134

 Score =  110 bits (277), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 33/96 (34%), Positives = 61/96 (63%)

Query: 2   SRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVER 61
           SRVC++T      GNKVSH+N KT+R +L NL  +TL+S+++ +K++++++   LR++  
Sbjct: 33  SRVCDVTGLAKSFGNKVSHSNRKTKRSYLVNLHNVTLVSEVLGRKFKMKVAARTLRTINY 92

Query: 62  QGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKSS 97
           +GG D +L N+    LS   + ++ +I   ++   S
Sbjct: 93  KGGFDLYLLNTASRKLSDEAQKIKRKIRAAIASGKS 128


>gi|254258430|ref|ZP_04949484.1| 50S ribosomal protein L28 [Burkholderia pseudomallei 1710a]
 gi|254217119|gb|EET06503.1| 50S ribosomal protein L28 [Burkholderia pseudomallei 1710a]
          Length = 454

 Score =  110 bits (276), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 33/75 (44%), Positives = 48/75 (64%), Gaps = 1/75 (1%)

Query: 1   MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
           M+RVC++T K  MSGN VSHANNKT+RRFLPNL       +   +  +LR+S   LR ++
Sbjct: 378 MARVCQVTGKAPMSGNNVSHANNKTKRRFLPNLQNRRFWVESENRWVRLRVSNAGLRLID 437

Query: 61  RQGGLDRFLSNSKKE 75
           + G +D  L++ +  
Sbjct: 438 KNG-IDSVLADLRAR 451


>gi|254466084|ref|ZP_05079495.1| ribosomal protein L28 [Rhodobacterales bacterium Y4I]
 gi|206686992|gb|EDZ47474.1| ribosomal protein L28 [Rhodobacterales bacterium Y4I]
          Length = 84

 Score =  110 bits (276), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 43/84 (51%), Positives = 61/84 (72%)

Query: 13 MSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFLSNS 72
          M+GN VSHANNKT+RRFLPNL  +TL S+++ +  +LRIS  ALRSV+ +GGLD FL+ +
Sbjct: 1  MTGNNVSHANNKTKRRFLPNLNDVTLQSEVLGRGVKLRISAAALRSVDHRGGLDAFLAKA 60

Query: 73 KKENLSARMRTLRSQILKKMSEKS 96
          K E LSA    ++ +I K  + ++
Sbjct: 61 KDEELSANALKVKKEIAKAQAAQA 84


>gi|15892059|ref|NP_359773.1| 50S ribosomal protein L28 [Rickettsia conorii str. Malish 7]
 gi|34580910|ref|ZP_00142390.1| 50S ribosomal protein L28 [Rickettsia sibirica 246]
 gi|157964165|ref|YP_001498989.1| 50S ribosomal protein L28 [Rickettsia massiliae MTU5]
 gi|229586339|ref|YP_002844840.1| 50S ribosomal protein L28 [Rickettsia africae ESF-5]
 gi|239947148|ref|ZP_04698901.1| 50S ribosomal protein L28 [Rickettsia endosymbiont of Ixodes
          scapularis]
 gi|20139556|sp|Q92JD1|RL28_RICCN RecName: Full=50S ribosomal protein L28
 gi|166987915|sp|A8F0K6|RL28_RICM5 RecName: Full=50S ribosomal protein L28
 gi|259646748|sp|C3PMD7|RL28_RICAE RecName: Full=50S ribosomal protein L28
 gi|15619179|gb|AAL02674.1| 50S ribosomal protein L28 [Rickettsia conorii str. Malish 7]
 gi|28262295|gb|EAA25799.1| 50S ribosomal protein L28 [Rickettsia sibirica 246]
 gi|157843941|gb|ABV84442.1| 50S ribosomal protein L28 [Rickettsia massiliae MTU5]
 gi|228021389|gb|ACP53097.1| 50S ribosomal protein L28 [Rickettsia africae ESF-5]
 gi|239921424|gb|EER21448.1| 50S ribosomal protein L28 [Rickettsia endosymbiont of Ixodes
          scapularis]
          Length = 97

 Score =  110 bits (276), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 39/96 (40%), Positives = 58/96 (60%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT   V+ GN VSH+  KTRRRF PNL  +   SDI   +Y+L ++   + SVE
Sbjct: 1  MSRKCELTGVGVLYGNNVSHSQRKTRRRFEPNLRSVKFTSDITAGEYRLSVNARCISSVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKS 96
          + GG D ++  +    LS+  R ++ +I++  + KS
Sbjct: 61 KAGGFDAYILKADDNVLSSNARAIKKKIIQTKTAKS 96


>gi|67458475|ref|YP_246099.1| 50S ribosomal protein L28 [Rickettsia felis URRWXCal2]
 gi|75537055|sp|Q4UNC4|RL28_RICFE RecName: Full=50S ribosomal protein L28
 gi|67004008|gb|AAY60934.1| 50S ribosomal protein L28 [Rickettsia felis URRWXCal2]
          Length = 97

 Score =  110 bits (275), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 40/96 (41%), Positives = 59/96 (61%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT   V+ GN VSH+  KTRRRF PNL  +   SDI   +Y+L ++   + SVE
Sbjct: 1  MSRKCELTGVGVLYGNNVSHSQRKTRRRFEPNLRSVKFTSDITAGEYRLSVNARCISSVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKS 96
          + GG D ++  +    LS+  RT++ +I++  + KS
Sbjct: 61 KAGGFDAYILKADDNVLSSNARTIKKKIIQTKTAKS 96


>gi|91206094|ref|YP_538449.1| 50S ribosomal protein L28 [Rickettsia bellii RML369-C]
 gi|157826473|ref|YP_001495537.1| 50S ribosomal protein L28 [Rickettsia bellii OSU 85-389]
 gi|122425214|sp|Q1RH04|RL28_RICBR RecName: Full=50S ribosomal protein L28
 gi|166226612|sp|A8GUK4|RL28_RICB8 RecName: Full=50S ribosomal protein L28
 gi|91069638|gb|ABE05360.1| 50S ribosomal protein L28 [Rickettsia bellii RML369-C]
 gi|157801777|gb|ABV78500.1| 50S ribosomal protein L28 [Rickettsia bellii OSU 85-389]
          Length = 97

 Score =  110 bits (275), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 40/96 (41%), Positives = 58/96 (60%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT   V+ GN VSH+  KTRRRF PNL  +  ISDI   +Y+L +S   + SVE
Sbjct: 1  MSRKCELTGVGVLYGNNVSHSQRKTRRRFEPNLRSVKFISDITTAEYRLSVSARCISSVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKS 96
          + GG D ++  +  + LS   + ++ +I++    KS
Sbjct: 61 KAGGFDAYMLKANNDALSTTAKAIKKKIIQTKMAKS 96


>gi|157828010|ref|YP_001494252.1| 50S ribosomal protein L28 [Rickettsia rickettsii str. 'Sheila
          Smith']
 gi|165932708|ref|YP_001649497.1| 50S ribosomal protein L28 [Rickettsia rickettsii str. Iowa]
 gi|166226614|sp|A8GQR9|RL28_RICRS RecName: Full=50S ribosomal protein L28
 gi|189029452|sp|B0BW65|RL28_RICRO RecName: Full=50S ribosomal protein L28
 gi|157800491|gb|ABV75744.1| 50S ribosomal protein L28 [Rickettsia rickettsii str. 'Sheila
          Smith']
 gi|165907795|gb|ABY72091.1| LSU ribosomal protein L28P [Rickettsia rickettsii str. Iowa]
          Length = 97

 Score =  109 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 39/96 (40%), Positives = 57/96 (59%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT   V+ GN VSH+  KTRRRF PNL  +   SDI   +Y+L ++   + SVE
Sbjct: 1  MSRKCELTGVGVLYGNNVSHSQRKTRRRFEPNLRSVKFTSDITAGEYRLSVNARCISSVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKS 96
          + GG D ++  +    LS   R ++ +I++  + KS
Sbjct: 61 KAGGFDAYILKADDNVLSGNARAIKKKIIQTKTAKS 96


>gi|157825271|ref|YP_001492991.1| 50S ribosomal protein L28 [Rickettsia akari str. Hartford]
 gi|166226611|sp|A8GM58|RL28_RICAH RecName: Full=50S ribosomal protein L28
 gi|157799229|gb|ABV74483.1| 50S ribosomal protein L28 [Rickettsia akari str. Hartford]
          Length = 97

 Score =  109 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 40/96 (41%), Positives = 58/96 (60%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT   V+ GN VSH+  KTRRRF PNL  +   SDI   KY+L ++   + SVE
Sbjct: 1  MSRKCELTGVGVLYGNNVSHSQRKTRRRFEPNLRSVKFTSDITAGKYRLSVNARCISSVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKS 96
          + GG D ++  +    LS+  R ++ +I++  + KS
Sbjct: 61 KAGGFDAYILQADDNVLSSNARAIKKKIIQTKTAKS 96


>gi|238650564|ref|YP_002916416.1| 50S ribosomal protein L28 [Rickettsia peacockii str. Rustic]
 gi|259646749|sp|C4K1B7|RL28_RICPU RecName: Full=50S ribosomal protein L28
 gi|238624662|gb|ACR47368.1| 50S ribosomal protein L28 [Rickettsia peacockii str. Rustic]
          Length = 97

 Score =  108 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 39/96 (40%), Positives = 58/96 (60%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT   V+ GN VSH+  KTRRRF PNL  +   SDI   +Y+L ++   + SVE
Sbjct: 1  MSRKCELTGVGVLYGNNVSHSQRKTRRRFKPNLRSVKFTSDITAGEYRLSVNARCISSVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKS 96
          + GG D ++  +    LS+  R ++ +I++  + KS
Sbjct: 61 KAGGFDAYILKADDNVLSSNARAIKKKIIQTKTAKS 96


>gi|269958654|ref|YP_003328441.1| 50S ribosomal protein L28 [Anaplasma centrale str. Israel]
 gi|269848483|gb|ACZ49127.1| 50S ribosomal protein L28 [Anaplasma centrale str. Israel]
          Length = 117

 Score =  108 bits (271), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 32/96 (33%), Positives = 61/96 (63%)

Query: 2   SRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVER 61
           SRVC++T      GN+VSH+N KT+R +L NL  +TL+S+++ +K++++++   LR++  
Sbjct: 16  SRVCDVTGLAKSFGNRVSHSNRKTKRSYLVNLHNVTLVSEVLGRKFKMKVAARTLRTINY 75

Query: 62  QGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKSS 97
           +GG D +L N+    LS   + ++ +I   ++   S
Sbjct: 76  KGGFDLYLLNTASRKLSDEAQKIKRKIRAAIASGKS 111


>gi|255003282|ref|ZP_05278246.1| 50S ribosomal protein L28 (rpmB) [Anaplasma marginale str. Puerto
           Rico]
          Length = 117

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 33/96 (34%), Positives = 61/96 (63%)

Query: 2   SRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVER 61
           SRVC++T      GNKVSH+N KT+R +L NL  +TL+S+++ +K++++++   LR++  
Sbjct: 16  SRVCDVTGLAKSFGNKVSHSNRKTKRSYLVNLHNVTLVSEVLGRKFKMKVAARTLRTINY 75

Query: 62  QGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKSS 97
           +GG D +L N+    LS   + ++ +I   ++   S
Sbjct: 76  KGGFDLYLLNTASRKLSDEAQKIKRKIRAAIASGKS 111


>gi|254995116|ref|ZP_05277306.1| 50S ribosomal protein L28 (rpmB) [Anaplasma marginale str.
          Mississippi]
 gi|255004409|ref|ZP_05279210.1| 50S ribosomal protein L28 (rpmB) [Anaplasma marginale str.
          Virginia]
          Length = 103

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 33/97 (34%), Positives = 62/97 (63%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T      GN+VSH+N KT+R +L NL  +TL+S+++ +K++++++   LR++ 
Sbjct: 1  MSRVCDVTGLAKSFGNRVSHSNRKTKRSYLVNLHNVTLVSEVLGRKFKMKVAARTLRTIN 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKSS 97
           +GG D +L N+    LS   + ++ +I   ++   S
Sbjct: 61 YKGGFDLYLLNTASRKLSDEAQKIKRKIRAAIASGKS 97


>gi|58617277|ref|YP_196476.1| 50S ribosomal protein L28 [Ehrlichia ruminantium str. Gardel]
 gi|75432681|sp|Q5FFP1|RL28_EHRRG RecName: Full=50S ribosomal protein L28
 gi|58416889|emb|CAI28002.1| 50S ribosomal protein L28 [Ehrlichia ruminantium str. Gardel]
          Length = 100

 Score =  107 bits (269), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 38/94 (40%), Positives = 62/94 (65%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T +T   GNKVSH+N KT+R +L NL  +TL SD++ +K++ +IS   LR+++
Sbjct: 1  MSRVCDITGQTKSFGNKVSHSNRKTKRTYLVNLHNVTLFSDVLNRKFRFKISSRTLRTID 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSE 94
           +GG D +L  +    LS + + ++  I K  +E
Sbjct: 61 YKGGFDLYLLETSSRKLSDKAQKIKKMIKKATAE 94


>gi|67461310|sp|Q5PAC9|RL28_ANAMM RecName: Full=50S ribosomal protein L28
          Length = 103

 Score =  107 bits (269), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 34/97 (35%), Positives = 62/97 (63%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T      GNKVSH+N KT+R +L NL  +TL+S+++ +K++++++   LR++ 
Sbjct: 1  MSRVCDVTGLAKSFGNKVSHSNRKTKRSYLVNLHNVTLVSEVLGRKFKMKVAARTLRTIN 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKSS 97
           +GG D +L N+    LS   + ++ +I   ++   S
Sbjct: 61 YKGGFDLYLLNTASRKLSDEAQKIKRKIRAAIASGKS 97


>gi|57239262|ref|YP_180398.1| 50S ribosomal protein L28 [Ehrlichia ruminantium str.
          Welgevonden]
 gi|58579225|ref|YP_197437.1| 50S ribosomal protein L28 [Ehrlichia ruminantium str.
          Welgevonden]
 gi|81557296|sp|Q5HAZ6|RL28_EHRRW RecName: Full=50S ribosomal protein L28
 gi|57161341|emb|CAH58264.1| 50S ribosomal protein L28 [Ehrlichia ruminantium str.
          Welgevonden]
 gi|58417851|emb|CAI27055.1| 50S ribosomal protein L28 [Ehrlichia ruminantium str.
          Welgevonden]
          Length = 100

 Score =  107 bits (268), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 39/96 (40%), Positives = 64/96 (66%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T +T   GNKVSH+N KT+R +L NL  +TL SD++ +K++ +IS   LR+++
Sbjct: 1  MSRVCDITGQTKSFGNKVSHSNRKTKRTYLVNLHNVTLFSDVLNRKFRFKISSRTLRTID 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKS 96
           +GGLD +L  +    LS + + ++  I K  +E +
Sbjct: 61 YKGGLDLYLLETSSRKLSDKAQKIKKMIKKATAENA 96


>gi|157803281|ref|YP_001491830.1| 50S ribosomal protein L28 [Rickettsia canadensis str. McKiel]
 gi|166226613|sp|A8EXG2|RL28_RICCK RecName: Full=50S ribosomal protein L28
 gi|157784544|gb|ABV73045.1| 50S ribosomal protein L28 [Rickettsia canadensis str. McKiel]
          Length = 97

 Score =  107 bits (268), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 38/96 (39%), Positives = 57/96 (59%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR C+LT   V+ GN VSH+  KTRRRF PNL  +   SDI    Y+L ++   + SVE
Sbjct: 1  MSRKCDLTGVGVLYGNNVSHSQRKTRRRFEPNLRSVKFKSDITSGAYRLLVNARCISSVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKS 96
          + GG D ++  +    LS+  R ++ +I++  + KS
Sbjct: 61 KAGGFDAYILKADDNVLSSAARAIKKKIIQTKTAKS 96


>gi|315121776|ref|YP_004062265.1| 50S ribosomal protein L28 [Candidatus Liberibacter solanacearum
          CLso-ZC1]
 gi|313495178|gb|ADR51777.1| 50S ribosomal protein L28 [Candidatus Liberibacter solanacearum
          CLso-ZC1]
          Length = 103

 Score =  107 bits (267), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 82/97 (84%), Positives = 90/97 (92%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVCELT+KTVMSGNKVS +NNKT+RRFLPNLCRITLISDIM Q+YQLRISK ALRSVE
Sbjct: 1  MSRVCELTRKTVMSGNKVSRSNNKTKRRFLPNLCRITLISDIMGQQYQLRISKHALRSVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKSS 97
          RQGGLD+FL +SKKENLS R R LRSQI+KK+SEKSS
Sbjct: 61 RQGGLDQFLLHSKKENLSDRTRLLRSQIIKKISEKSS 97


>gi|148284100|ref|YP_001248190.1| 50S ribosomal protein L28 [Orientia tsutsugamushi str. Boryong]
 gi|166226593|sp|A5CC87|RL28_ORITB RecName: Full=50S ribosomal protein L28
 gi|146739539|emb|CAM79268.1| 50S ribosomal protein L28 [Orientia tsutsugamushi str. Boryong]
          Length = 96

 Score =  106 bits (266), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 65/97 (67%), Gaps = 1/97 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVCELT  +V SG+ VSH+  KT+R+FLPNL  ++L SD +++ ++ ++   A+R+++
Sbjct: 1  MSRVCELTGVSVQSGHNVSHSQRKTKRKFLPNLQNVSLFSDSLKKAFKFKVVARAIRTLD 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKSS 97
          + GGLD +L ++  + LS     ++  I+K    KSS
Sbjct: 61 KVGGLDCYLLSASDKILSKFAIEVKK-IIKNNGSKSS 96


>gi|33593074|ref|NP_880718.1| 50S ribosomal protein L28 [Bordetella pertussis Tohama I]
 gi|33596368|ref|NP_884011.1| 50S ribosomal protein L28 [Bordetella parapertussis 12822]
 gi|33602345|ref|NP_889905.1| 50S ribosomal protein L28 [Bordetella bronchiseptica RB50]
 gi|187478973|ref|YP_786997.1| 50S ribosomal protein L28 [Bordetella avium 197N]
 gi|67461507|sp|Q7VWY1|RL28_BORPE RecName: Full=50S ribosomal protein L28
 gi|67461508|sp|Q7W9L9|RL28_BORPA RecName: Full=50S ribosomal protein L28
 gi|67461509|sp|Q7WH39|RL28_BORBR RecName: Full=50S ribosomal protein L28
 gi|123514301|sp|Q2KXH8|RL28_BORA1 RecName: Full=50S ribosomal protein L28
 gi|33563449|emb|CAE42330.1| 50S ribosomal protein L28 [Bordetella pertussis Tohama I]
 gi|33566137|emb|CAE37038.1| 50S ribosomal protein L28 [Bordetella parapertussis]
 gi|33576784|emb|CAE33863.1| 50S ribosomal protein L28 [Bordetella bronchiseptica RB50]
 gi|115423559|emb|CAJ50095.1| 50S ribosomal protein L28 [Bordetella avium 197N]
 gi|332382486|gb|AEE67333.1| 50S ribosomal protein L28 [Bordetella pertussis CS]
          Length = 78

 Score =  106 bits (266), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 31/75 (41%), Positives = 49/75 (65%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVC++T K  M GN VSHANNKT+RRFLPNL       +   +  +LR++  A+R+++
Sbjct: 1  MARVCQVTGKGPMVGNNVSHANNKTKRRFLPNLQSRRFWVESENRWVRLRVTAKAIRTID 60

Query: 61 RQGGLDRFLSNSKKE 75
          + G +D  L++ +  
Sbjct: 61 KNG-IDAVLADLRAR 74


>gi|317405790|gb|EFV86080.1| 50S ribosomal protein L28 [Achromobacter xylosoxidans C54]
          Length = 78

 Score =  106 bits (266), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 32/75 (42%), Positives = 48/75 (64%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVC++T K  M GN VSHANNKT+RRFLPNL       +   +  +LR+S  A+R+++
Sbjct: 1  MARVCQVTGKGPMVGNNVSHANNKTKRRFLPNLQSRRFWVESENRWVRLRVSAKAIRTID 60

Query: 61 RQGGLDRFLSNSKKE 75
          + G +D  L+  +  
Sbjct: 61 KNG-IDAVLAEMRAR 74


>gi|116205609|ref|XP_001228615.1| hypothetical protein CHGG_10688 [Chaetomium globosum CBS 148.51]
 gi|88176816|gb|EAQ84284.1| hypothetical protein CHGG_10688 [Chaetomium globosum CBS 148.51]
          Length = 254

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 27/90 (30%), Positives = 47/90 (52%), Gaps = 4/90 (4%)

Query: 11  TVMSGNKVSHANN-KTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFL 69
            +  GN VS  NN KTRR++ PN+    L S  +    + R++   LR+V++ GGLD +L
Sbjct: 84  RIRFGNNVSERNNIKTRRQWRPNVHHKRLWSASLGVFVRTRVTARVLRTVDKAGGLDEYL 143

Query: 70  SNS---KKENLSARMRTLRSQILKKMSEKS 96
                 +  +L      LR +I++  + ++
Sbjct: 144 LGRTPQRVRDLGPWGWKLRWRIMQTPAVRA 173


>gi|237811180|ref|YP_002895631.1| ribosomal protein L28 [Burkholderia pseudomallei MSHR346]
 gi|237503801|gb|ACQ96119.1| ribosomal protein L28 [Burkholderia pseudomallei MSHR346]
          Length = 163

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 33/75 (44%), Positives = 48/75 (64%), Gaps = 1/75 (1%)

Query: 1   MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
           M+RVC++T K  MSGN VSHANNKT+RRFLPNL       +   +  +LR+S   LR ++
Sbjct: 87  MARVCQVTGKAPMSGNNVSHANNKTKRRFLPNLQNRRFWVESENRWVRLRVSNAGLRLID 146

Query: 61  RQGGLDRFLSNSKKE 75
           + G +D  L++ +  
Sbjct: 147 KNG-IDSVLADLRAR 160


>gi|218661315|ref|ZP_03517245.1| 50S ribosomal protein L28 [Rhizobium etli IE4771]
          Length = 85

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 51/82 (62%), Positives = 64/82 (78%)

Query: 15 GNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFLSNSKK 74
          GN VSHANNKT+RRFLPNLC++TLISD + Q+Y+LR+S  ALRSVE +GGLD FL  + +
Sbjct: 1  GNNVSHANNKTKRRFLPNLCQVTLISDALNQRYRLRVSAAALRSVEHRGGLDAFLLKASE 60

Query: 75 ENLSARMRTLRSQILKKMSEKS 96
            LS R R LR QI+KK +E +
Sbjct: 61 NELSMRARLLRRQIVKKTAEAA 82


>gi|88608656|ref|YP_506211.1| ribosomal protein L28 [Neorickettsia sennetsu str. Miyayama]
 gi|123492103|sp|Q2GE85|RL28_NEOSM RecName: Full=50S ribosomal protein L28
 gi|88600825|gb|ABD46293.1| ribosomal protein L28 [Neorickettsia sennetsu str. Miyayama]
          Length = 102

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 41/93 (44%), Positives = 66/93 (70%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS  C+LT     +GN VSH+N KT++RF+PNL R+T+ SD+++QK++ ++S   +R+++
Sbjct: 1  MSNSCDLTGHGWQNGNMVSHSNRKTKKRFMPNLQRVTVFSDVLKQKFRFKVSAKTIRTID 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMS 93
           +GGLD FL N+K   LS     L+ +I+KK+S
Sbjct: 61 FKGGLDDFLRNTKNSKLSKSALVLKKRIMKKVS 93


>gi|311107980|ref|YP_003980833.1| 50S ribosomal protein L28 [Achromobacter xylosoxidans A8]
 gi|310762669|gb|ADP18118.1| ribosomal protein L28 [Achromobacter xylosoxidans A8]
          Length = 78

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 32/75 (42%), Positives = 48/75 (64%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVC++T K  M GN VSHANNKT+RRFLPNL       +   +  +LR+S  A+R+++
Sbjct: 1  MARVCQVTGKGPMVGNNVSHANNKTKRRFLPNLQSRRFWVESENRWVRLRVSAKAIRTID 60

Query: 61 RQGGLDRFLSNSKKE 75
          + G +D  L+  +  
Sbjct: 61 KNG-IDAVLAEMRAR 74


>gi|239814289|ref|YP_002943199.1| 50S ribosomal protein L28 [Variovorax paradoxus S110]
 gi|319792070|ref|YP_004153710.1| ribosomal protein l28 [Variovorax paradoxus EPS]
 gi|259646753|sp|C5CRK1|RL28_VARPS RecName: Full=50S ribosomal protein L28
 gi|239800866|gb|ACS17933.1| ribosomal protein L28 [Variovorax paradoxus S110]
 gi|315594533|gb|ADU35599.1| ribosomal protein L28 [Variovorax paradoxus EPS]
          Length = 77

 Score =  105 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 33/75 (44%), Positives = 48/75 (64%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVC++T K  M GN VSHANNKT+RRFLPNL       +   +  +LR+S  ALR ++
Sbjct: 1  MARVCDVTGKGPMVGNNVSHANNKTKRRFLPNLQYRRFWVETENRWVRLRVSSAALRLID 60

Query: 61 RQGGLDRFLSNSKKE 75
          + G +D  L++ +  
Sbjct: 61 KNG-IDAVLADLRAR 74


>gi|169862685|ref|XP_001837968.1| 50S ribosomal protein L24 [Coprinopsis cinerea okayama7#130]
 gi|116500955|gb|EAU83850.1| 50S ribosomal protein L24 [Coprinopsis cinerea okayama7#130]
          Length = 192

 Score =  105 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 28/89 (31%), Positives = 55/89 (61%)

Query: 9   KKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRF 68
            K++  GN V  + +KTRR +LPN+ R  L S+++ +K +++++  ALR++++ GGLD +
Sbjct: 25  GKSIQYGNNVPFSKHKTRRTWLPNVQRKRLDSEVLGEKVRIKVTTRALRTIKKYGGLDNY 84

Query: 69  LSNSKKENLSARMRTLRSQILKKMSEKSS 97
           L  ++   LS     L+ +I    ++K +
Sbjct: 85  LKGTQSHKLSFAGLDLKLKIKDAEAKKLA 113


>gi|121599881|ref|YP_993944.1| 50S ribosomal protein L28 [Burkholderia mallei SAVP1]
 gi|217419760|ref|ZP_03451266.1| 50S ribosomal protein L28 [Burkholderia pseudomallei 576]
 gi|238562658|ref|ZP_00440037.2| 50S ribosomal protein L28 [Burkholderia mallei GB8 horse 4]
 gi|242314284|ref|ZP_04813300.1| 50S ribosomal protein L28 [Burkholderia pseudomallei 1106b]
 gi|251766709|ref|ZP_04819772.1| 50S ribosomal protein L28 [Burkholderia mallei PRL-20]
 gi|262193282|ref|YP_001081631.2| 50S ribosomal protein L28 [Burkholderia mallei NCTC 10247]
 gi|121228691|gb|ABM51209.1| 50S ribosomal protein L28 [Burkholderia mallei SAVP1]
 gi|217397064|gb|EEC37080.1| 50S ribosomal protein L28 [Burkholderia pseudomallei 576]
 gi|238522152|gb|EEP85598.1| 50S ribosomal protein L28 [Burkholderia mallei GB8 horse 4]
 gi|242137523|gb|EES23925.1| 50S ribosomal protein L28 [Burkholderia pseudomallei 1106b]
 gi|243064992|gb|EES47178.1| 50S ribosomal protein L28 [Burkholderia mallei PRL-20]
 gi|261835068|gb|ABO05945.2| 50S ribosomal protein L28 [Burkholderia mallei NCTC 10247]
          Length = 163

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 33/75 (44%), Positives = 48/75 (64%), Gaps = 1/75 (1%)

Query: 1   MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
           M+RVC++T K  MSGN VSHANNKT+RRFLPNL       +   +  +LR+S   LR ++
Sbjct: 87  MARVCQVTGKAPMSGNNVSHANNKTKRRFLPNLQNRRFWVESENRWVRLRVSNAGLRLID 146

Query: 61  RQGGLDRFLSNSKKE 75
           + G +D  L++ +  
Sbjct: 147 KNG-IDSVLADLRAR 160


>gi|254500400|ref|ZP_05112551.1| ribosomal protein L28, putative [Labrenzia alexandrii DFL-11]
 gi|222436471|gb|EEE43150.1| ribosomal protein L28, putative [Labrenzia alexandrii DFL-11]
          Length = 87

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 41/85 (48%), Positives = 60/85 (70%)

Query: 13 MSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFLSNS 72
          M+GN VSHANNK+RRRFLPNLC ++L+SD + + ++L++S  ALRSVE +GGLD +L  +
Sbjct: 1  MTGNNVSHANNKSRRRFLPNLCNVSLMSDTLGETFKLKVSAHALRSVEHRGGLDAYLMKA 60

Query: 73 KKENLSARMRTLRSQILKKMSEKSS 97
              LS   R ++  I +K  E ++
Sbjct: 61 SDAELSDNARKIKVSIKRKQEEAAA 85


>gi|254196472|ref|ZP_04902896.1| 50S ribosomal protein L28 [Burkholderia pseudomallei S13]
 gi|169653215|gb|EDS85908.1| 50S ribosomal protein L28 [Burkholderia pseudomallei S13]
          Length = 163

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 33/75 (44%), Positives = 48/75 (64%), Gaps = 1/75 (1%)

Query: 1   MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
           M+RVC++T K  MSGN VSHANNKT+RRFLPNL       +   +  +LR+S   LR ++
Sbjct: 87  MARVCQVTGKAPMSGNNVSHANNKTKRRFLPNLQNRRFWVESENRWVRLRVSNAGLRLID 146

Query: 61  RQGGLDRFLSNSKKE 75
           + G +D  L++ +  
Sbjct: 147 KNG-IDSVLADLRAR 160


>gi|221638418|ref|YP_002524680.1| 50S ribosomal protein L28 [Rhodobacter sphaeroides KD131]
 gi|332557448|ref|ZP_08411770.1| 50S ribosomal protein L28 [Rhodobacter sphaeroides WS8N]
 gi|221159199|gb|ACM00179.1| 50S ribosomal protein L28 [Rhodobacter sphaeroides KD131]
 gi|332275160|gb|EGJ20475.1| 50S ribosomal protein L28 [Rhodobacter sphaeroides WS8N]
          Length = 84

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 44/84 (52%), Positives = 63/84 (75%)

Query: 13 MSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFLSNS 72
          M+GN VSHANNK+RRRFLPNL  +TLISD++ Q ++LRIS  ALR+V+ +GGLD FL+ +
Sbjct: 1  MTGNTVSHANNKSRRRFLPNLNDVTLISDVLGQSFKLRISAAALRTVDHRGGLDAFLAKA 60

Query: 73 KKENLSARMRTLRSQILKKMSEKS 96
          K + LS + R ++ +I K  +  +
Sbjct: 61 KDDELSVKARAIKKEIEKAQATAA 84


>gi|257094340|ref|YP_003167981.1| 50S ribosomal protein L28 [Candidatus Accumulibacter phosphatis
          clade IIA str. UW-1]
 gi|257046864|gb|ACV36052.1| ribosomal protein L28 [Candidatus Accumulibacter phosphatis clade
          IIA str. UW-1]
          Length = 77

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 31/75 (41%), Positives = 49/75 (65%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVC++T K  M+GN VSHANN+T+RRFLPNL       +   +  +LR+S   LR+++
Sbjct: 1  MARVCQVTGKGPMAGNNVSHANNRTKRRFLPNLQYRRFWIEGENRWVRLRVSNAGLRTID 60

Query: 61 RQGGLDRFLSNSKKE 75
          + G +D  L++ +  
Sbjct: 61 KNG-IDVVLADLRAR 74


>gi|189184694|ref|YP_001938479.1| 50S ribosomal protein L28 [Orientia tsutsugamushi str. Ikeda]
 gi|226699054|sp|B3CV48|RL28_ORITI RecName: Full=50S ribosomal protein L28
 gi|189181465|dbj|BAG41245.1| 50S ribosomal protein L28 [Orientia tsutsugamushi str. Ikeda]
          Length = 95

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 36/94 (38%), Positives = 62/94 (65%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVCELT  +V SG+ VSH+  KT+R+FLPNL  ++L SD +++ ++ ++   A+R+++
Sbjct: 1  MSRVCELTGVSVQSGHNVSHSQRKTKRKFLPNLQNVSLFSDSLKKAFKFKVVARAMRTLD 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSE 94
          + GGLD +L ++  + LS     ++  I    S+
Sbjct: 61 KVGGLDCYLLSASDKTLSKSAIEVKKIIKNNESK 94


>gi|73667160|ref|YP_303176.1| 50S ribosomal protein L28 [Ehrlichia canis str. Jake]
 gi|123614861|sp|Q3YRS7|RL28_EHRCJ RecName: Full=50S ribosomal protein L28
 gi|72394301|gb|AAZ68578.1| LSU ribosomal protein L28P [Ehrlichia canis str. Jake]
          Length = 100

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 34/94 (36%), Positives = 63/94 (67%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T +    GNKVSH+N KT+R +L NL  +TL+SDI+ +K++ ++S   LR+++
Sbjct: 1  MSRVCDITGQGKSFGNKVSHSNRKTKRTYLVNLHNVTLLSDILNRKFKFKVSSRTLRTID 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSE 94
           +GG D +L N+    L+ + + ++  +   +++
Sbjct: 61 YKGGFDLYLLNTSSRKLTDKAQKIKKLVKNAVAK 94


>gi|163857625|ref|YP_001631923.1| 50S ribosomal protein L28 [Bordetella petrii DSM 12804]
 gi|226738038|sp|A9HWU4|RL28_BORPD RecName: Full=50S ribosomal protein L28
 gi|163261353|emb|CAP43655.1| 50S ribosomal protein L28 [Bordetella petrii]
          Length = 78

 Score =  104 bits (261), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 32/75 (42%), Positives = 49/75 (65%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVC++T K  M+GN VSHANNKT+RRFLPNL       +   +  +LR+S  A+R ++
Sbjct: 1  MARVCQVTGKGPMTGNNVSHANNKTKRRFLPNLQSRRFWVESENRWVRLRVSAKAIRIID 60

Query: 61 RQGGLDRFLSNSKKE 75
          + G +D  L++ +  
Sbjct: 61 KNG-IDAVLADLRAR 74


>gi|297182661|gb|ADI18819.1| ribosomal protein l28 [uncultured SAR11 cluster bacterium
           HF4000_37C10]
          Length = 108

 Score =  104 bits (261), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 46/91 (50%), Positives = 65/91 (71%)

Query: 1   MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
           MSR CELT K+ + G+KVSHANNKT+R+F PNL ++T  S I+ +  +L++S  ALR+V+
Sbjct: 17  MSRKCELTGKSPLKGHKVSHANNKTKRKFFPNLKKVTFKSKILRRNIKLQVSNAALRTVD 76

Query: 61  RQGGLDRFLSNSKKENLSARMRTLRSQILKK 91
            +GGLD FL   K   LS R + L++QI+ K
Sbjct: 77  YKGGLDNFLKTVKTHKLSKRAKGLKNQIITK 107


>gi|121606104|ref|YP_983433.1| 50S ribosomal protein L28 [Polaromonas naphthalenivorans CJ2]
 gi|166226597|sp|A1VS84|RL28_POLNA RecName: Full=50S ribosomal protein L28
 gi|120595073|gb|ABM38512.1| LSU ribosomal protein L28P [Polaromonas naphthalenivorans CJ2]
          Length = 77

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 31/75 (41%), Positives = 47/75 (62%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVC++T K  M GN VSHANNKT+RRF+PNL    +  +   +  +LRI+   LR ++
Sbjct: 1  MARVCQVTGKGPMVGNNVSHANNKTKRRFMPNLQYRRIWVESENRWVRLRITAAGLRLID 60

Query: 61 RQGGLDRFLSNSKKE 75
          + G +D  L + +  
Sbjct: 61 KNG-IDAVLVDLRAR 74


>gi|260220651|emb|CBA28404.1| 50S ribosomal protein L28 [Curvibacter putative symbiont of Hydra
          magnipapillata]
          Length = 93

 Score =  103 bits (259), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 34/75 (45%), Positives = 47/75 (62%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVCE+T K  M GN VSHANNKT+RRFLPNL       +   +  +LRIS   LR ++
Sbjct: 17 MARVCEVTGKGPMVGNNVSHANNKTKRRFLPNLQYRRFWVESENRWVRLRISNAGLRLID 76

Query: 61 RQGGLDRFLSNSKKE 75
          + G +D  L++ +  
Sbjct: 77 KNG-IDSVLADLRAR 90


>gi|121608722|ref|YP_996529.1| 50S ribosomal protein L28 [Verminephrobacter eiseniae EF01-2]
 gi|166228170|sp|A1WIQ4|RL28_VEREI RecName: Full=50S ribosomal protein L28
 gi|121553362|gb|ABM57511.1| LSU ribosomal protein L28P [Verminephrobacter eiseniae EF01-2]
          Length = 77

 Score =  103 bits (259), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 34/75 (45%), Positives = 48/75 (64%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVC++T K  M GN VSHANNKTRRRFLPNL       +   +  +LR+S  ALR ++
Sbjct: 1  MARVCDVTGKKPMVGNNVSHANNKTRRRFLPNLQYRRFWVETENRWVRLRVSSAALRLID 60

Query: 61 RQGGLDRFLSNSKKE 75
          + G +D  L++ +  
Sbjct: 61 KNG-IDAVLADLRAR 74


>gi|296136855|ref|YP_003644097.1| ribosomal protein L28 [Thiomonas intermedia K12]
 gi|294341024|emb|CAZ89419.1| 50S ribosomal protein L28 [Thiomonas sp. 3As]
 gi|295796977|gb|ADG31767.1| ribosomal protein L28 [Thiomonas intermedia K12]
          Length = 77

 Score =  103 bits (258), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 31/75 (41%), Positives = 48/75 (64%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVC++T K  M GN VSHANNKT+RRFLPNL       +   +  +LR++   LR+++
Sbjct: 1  MARVCQVTGKGPMVGNNVSHANNKTKRRFLPNLQYRRFWVESENRFVRLRVTSSGLRTID 60

Query: 61 RQGGLDRFLSNSKKE 75
          ++G +D  L+  +  
Sbjct: 61 KKG-IDVVLAELRSR 74


>gi|88607418|ref|YP_504966.1| 50S ribosomal protein L28 [Anaplasma phagocytophilum HZ]
 gi|123495525|sp|Q2GKY5|RL28_ANAPZ RecName: Full=50S ribosomal protein L28
 gi|88598481|gb|ABD43951.1| ribosomal protein L28 [Anaplasma phagocytophilum HZ]
          Length = 103

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 34/93 (36%), Positives = 64/93 (68%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T  +   GNKVSH+N KT+R +L NL  +TL+S+++ +K++++++   LR+++
Sbjct: 1  MSRVCDITGASKSFGNKVSHSNRKTKRSYLVNLHNVTLVSEVLGRKFRVKVASRTLRTID 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMS 93
           +GGLD +L N+    L+   R ++ +I   ++
Sbjct: 61 YKGGLDLYLLNTSSRKLTEVARKIKRKIKVAIA 93


>gi|121595684|ref|YP_987580.1| 50S ribosomal protein L28 [Acidovorax sp. JS42]
 gi|221068788|ref|ZP_03544893.1| ribosomal protein L28 [Comamonas testosteroni KF-1]
 gi|222111892|ref|YP_002554156.1| 50S ribosomal protein l28 [Acidovorax ebreus TPSY]
 gi|264677019|ref|YP_003276925.1| ribosomal protein L28 [Comamonas testosteroni CNB-2]
 gi|299532561|ref|ZP_07045951.1| 50S ribosomal protein L28 [Comamonas testosteroni S44]
 gi|319761898|ref|YP_004125835.1| ribosomal protein l28 [Alicycliphilus denitrificans BC]
 gi|330826250|ref|YP_004389553.1| 50S ribosomal protein L28 [Alicycliphilus denitrificans K601]
 gi|166226533|sp|A1WB79|RL28_ACISJ RecName: Full=50S ribosomal protein L28
 gi|254801357|sp|B9MEB7|RL28_DIAST RecName: Full=50S ribosomal protein L28
 gi|120607764|gb|ABM43504.1| LSU ribosomal protein L28P [Acidovorax sp. JS42]
 gi|220713811|gb|EED69179.1| ribosomal protein L28 [Comamonas testosteroni KF-1]
 gi|221731336|gb|ACM34156.1| ribosomal protein L28 [Acidovorax ebreus TPSY]
 gi|262207531|gb|ACY31629.1| ribosomal protein L28 [Comamonas testosteroni CNB-2]
 gi|298719508|gb|EFI60475.1| 50S ribosomal protein L28 [Comamonas testosteroni S44]
 gi|317116459|gb|ADU98947.1| ribosomal protein L28 [Alicycliphilus denitrificans BC]
 gi|329311622|gb|AEB86037.1| 50S ribosomal protein L28 [Alicycliphilus denitrificans K601]
          Length = 77

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 34/75 (45%), Positives = 48/75 (64%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVCE+T K  M GN VSHANNKT+RRFLPNL       +   +  +LR+S  ALR ++
Sbjct: 1  MARVCEVTGKKPMVGNNVSHANNKTKRRFLPNLQYRRFWVESENRWVRLRVSSAALRLID 60

Query: 61 RQGGLDRFLSNSKKE 75
          + G +D  L++ +  
Sbjct: 61 KNG-IDSVLADMRAR 74


>gi|91789646|ref|YP_550598.1| 50S ribosomal protein L28 [Polaromonas sp. JS666]
 gi|123355325|sp|Q125U2|RL28_POLSJ RecName: Full=50S ribosomal protein L28
 gi|91698871|gb|ABE45700.1| LSU ribosomal protein L28P [Polaromonas sp. JS666]
          Length = 77

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 31/75 (41%), Positives = 47/75 (62%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVC++T K  M GN VSHANNKT+RRF+PNL       +   +  +LRI+   LR ++
Sbjct: 1  MARVCQVTGKGPMVGNNVSHANNKTKRRFMPNLQYRRFWVESENRWVRLRITSAGLRLID 60

Query: 61 RQGGLDRFLSNSKKE 75
          ++G +D  L + +  
Sbjct: 61 KKG-IDAILVDLRAR 74


>gi|117924123|ref|YP_864740.1| 50S ribosomal protein L28P [Magnetococcus sp. MC-1]
 gi|166226586|sp|A0L5U1|RL28_MAGSM RecName: Full=50S ribosomal protein L28
 gi|117607879|gb|ABK43334.1| LSU ribosomal protein L28P [Magnetococcus sp. MC-1]
          Length = 95

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 36/95 (37%), Positives = 53/95 (55%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+R   L  K   +GNKVSH+  KTRR+++PN+    L S  + Q  ++ IS  ALRSV+
Sbjct: 1  MARKRTLGGKAPQAGNKVSHSQRKTRRQWMPNIQTKALWSITLGQSVKVTISTSALRSVD 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEK 95
            GGLD +L       L+  MR +  QI ++ +  
Sbjct: 61 NAGGLDNYLLKILPSELTPSMRRVARQIRERKAAA 95


>gi|160900797|ref|YP_001566379.1| 50S ribosomal protein L28 [Delftia acidovorans SPH-1]
 gi|226738065|sp|A9BNU9|RL28_DELAS RecName: Full=50S ribosomal protein L28
 gi|160366381|gb|ABX37994.1| ribosomal protein L28 [Delftia acidovorans SPH-1]
          Length = 77

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 34/75 (45%), Positives = 48/75 (64%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVCE+T K  M GN VSHANNKT+RRFLPNL       +   +  +LR+S  ALR ++
Sbjct: 1  MARVCEVTGKKPMVGNNVSHANNKTKRRFLPNLQYRRFWVESENRWVRLRVSSAALRLID 60

Query: 61 RQGGLDRFLSNSKKE 75
          + G +D  L++ +  
Sbjct: 61 KNG-IDSVLADLRAR 74


>gi|42520268|ref|NP_966183.1| 50S ribosomal protein L28 [Wolbachia endosymbiont of Drosophila
          melanogaster]
 gi|58700226|ref|ZP_00374712.1| ribosomal protein L28-related protein [Wolbachia endosymbiont of
          Drosophila ananassae]
 gi|99034408|ref|ZP_01314419.1| hypothetical protein Wendoof_01000778 [Wolbachia endosymbiont of
          Drosophila willistoni TSC#14030-0811.24]
 gi|225630197|ref|YP_002726988.1| ribosomal protein L28 [Wolbachia sp. wRi]
 gi|225677014|ref|ZP_03788027.1| ribosomal protein L28 [Wolbachia endosymbiont of Muscidifurax
          uniraptor]
 gi|67461471|sp|Q73HZ5|RL28_WOLPM RecName: Full=50S ribosomal protein L28
 gi|42410006|gb|AAS14117.1| ribosomal protein L28 [Wolbachia endosymbiont of Drosophila
          melanogaster]
 gi|58533257|gb|EAL57770.1| ribosomal protein L28-related protein [Wolbachia endosymbiont of
          Drosophila ananassae]
 gi|225590940|gb|EEH12154.1| ribosomal protein L28 [Wolbachia endosymbiont of Muscidifurax
          uniraptor]
 gi|225592178|gb|ACN95197.1| ribosomal protein L28 [Wolbachia sp. wRi]
          Length = 104

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 40/95 (42%), Positives = 66/95 (69%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVCELT +    GNKVSH+N KT+R FL NL ++TL SDI+ +K++ R++   LR+++
Sbjct: 1  MSRVCELTNRKKSFGNKVSHSNRKTKRTFLLNLHKVTLTSDILNKKFRFRVATRTLRTID 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEK 95
           +G LD FL N++   LS + + ++ ++ K + ++
Sbjct: 61 YKGDLDAFLLNTRTIKLSEKAQKIKRRLKKVLVKQ 95


>gi|120612081|ref|YP_971759.1| 50S ribosomal protein L28 [Acidovorax citrulli AAC00-1]
 gi|241765340|ref|ZP_04763316.1| ribosomal protein L28 [Acidovorax delafieldii 2AN]
 gi|326318090|ref|YP_004235762.1| 50S ribosomal protein L28 [Acidovorax avenae subsp. avenae ATCC
          19860]
 gi|166226528|sp|A1TSP7|RL28_ACIAC RecName: Full=50S ribosomal protein L28
 gi|120590545|gb|ABM33985.1| LSU ribosomal protein L28P [Acidovorax citrulli AAC00-1]
 gi|241364939|gb|EER59877.1| ribosomal protein L28 [Acidovorax delafieldii 2AN]
 gi|323374926|gb|ADX47195.1| 50S ribosomal protein L28 [Acidovorax avenae subsp. avenae ATCC
          19860]
          Length = 77

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 33/75 (44%), Positives = 48/75 (64%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVC++T K  M GN VSHANNKT+RRFLPNL       +   +  +LR+S  ALR ++
Sbjct: 1  MARVCDVTGKKPMVGNNVSHANNKTKRRFLPNLQYRRFWVESENRWVRLRVSSAALRLID 60

Query: 61 RQGGLDRFLSNSKKE 75
          + G +D  L++ +  
Sbjct: 61 KNG-IDSVLADLRAR 74


>gi|126733276|ref|ZP_01749023.1| ribosomal protein L28 [Roseobacter sp. CCS2]
 gi|126716142|gb|EBA13006.1| ribosomal protein L28 [Roseobacter sp. CCS2]
          Length = 82

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 38/82 (46%), Positives = 55/82 (67%)

Query: 13 MSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFLSNS 72
          MSGN VSHA N+TRRRFLPNL  +TL SD + + ++ +IS  ALR+V+ +GGLD F++ +
Sbjct: 1  MSGNNVSHAKNRTRRRFLPNLQDVTLQSDTLGRSFKFKISNAALRTVDHRGGLDAFMAKA 60

Query: 73 KKENLSARMRTLRSQILKKMSE 94
          K   LS     ++ +I K  + 
Sbjct: 61 KDAELSDNALKVKKEIAKATAA 82


>gi|53718557|ref|YP_107543.1| 50S ribosomal protein L28 [Burkholderia pseudomallei K96243]
 gi|53726240|ref|YP_103795.1| 50S ribosomal protein L28 [Burkholderia mallei ATCC 23344]
 gi|76810126|ref|YP_332549.1| 50S ribosomal protein L28 [Burkholderia pseudomallei 1710b]
 gi|78067303|ref|YP_370072.1| 50S ribosomal protein L28 [Burkholderia sp. 383]
 gi|83720970|ref|YP_441336.1| 50S ribosomal protein L28 [Burkholderia thailandensis E264]
 gi|107023440|ref|YP_621767.1| 50S ribosomal protein L28 [Burkholderia cenocepacia AU 1054]
 gi|115352600|ref|YP_774439.1| 50S ribosomal protein L28 [Burkholderia ambifaria AMMD]
 gi|116690522|ref|YP_836145.1| 50S ribosomal protein L28 [Burkholderia cenocepacia HI2424]
 gi|124384182|ref|YP_001027008.1| 50S ribosomal protein L28 [Burkholderia mallei NCTC 10229]
 gi|126440334|ref|YP_001058029.1| 50S ribosomal protein L28 [Burkholderia pseudomallei 668]
 gi|126452424|ref|YP_001065264.1| 50S ribosomal protein L28 [Burkholderia pseudomallei 1106a]
 gi|134296675|ref|YP_001120410.1| 50S ribosomal protein L28 [Burkholderia vietnamiensis G4]
 gi|161523973|ref|YP_001578985.1| 50S ribosomal protein L28 [Burkholderia multivorans ATCC 17616]
 gi|167561867|ref|ZP_02354783.1| 50S ribosomal protein L28 [Burkholderia oklahomensis EO147]
 gi|167569089|ref|ZP_02361963.1| 50S ribosomal protein L28 [Burkholderia oklahomensis C6786]
 gi|167580121|ref|ZP_02372995.1| 50S ribosomal protein L28 [Burkholderia thailandensis TXDOH]
 gi|167585718|ref|ZP_02378106.1| 50S ribosomal protein L28 [Burkholderia ubonensis Bu]
 gi|167618185|ref|ZP_02386816.1| 50S ribosomal protein L28 [Burkholderia thailandensis Bt4]
 gi|167718468|ref|ZP_02401704.1| 50S ribosomal protein L28 [Burkholderia pseudomallei DM98]
 gi|167737517|ref|ZP_02410291.1| 50S ribosomal protein L28 [Burkholderia pseudomallei 14]
 gi|167814636|ref|ZP_02446316.1| 50S ribosomal protein L28 [Burkholderia pseudomallei 91]
 gi|167823104|ref|ZP_02454575.1| 50S ribosomal protein L28 [Burkholderia pseudomallei 9]
 gi|167835744|ref|ZP_02462627.1| 50S ribosomal protein L28 [Burkholderia thailandensis MSMB43]
 gi|167844667|ref|ZP_02470175.1| 50S ribosomal protein L28 [Burkholderia pseudomallei B7210]
 gi|167893196|ref|ZP_02480598.1| 50S ribosomal protein L28 [Burkholderia pseudomallei 7894]
 gi|167901649|ref|ZP_02488854.1| 50S ribosomal protein L28 [Burkholderia pseudomallei NCTC 13177]
 gi|167909899|ref|ZP_02496990.1| 50S ribosomal protein L28 [Burkholderia pseudomallei 112]
 gi|167917921|ref|ZP_02505012.1| 50S ribosomal protein L28 [Burkholderia pseudomallei BCC215]
 gi|170697689|ref|ZP_02888777.1| ribosomal protein L28 [Burkholderia ambifaria IOP40-10]
 gi|170733863|ref|YP_001765810.1| 50S ribosomal protein L28 [Burkholderia cenocepacia MC0-3]
 gi|171316764|ref|ZP_02905976.1| ribosomal protein L28 [Burkholderia ambifaria MEX-5]
 gi|172061462|ref|YP_001809114.1| 50S ribosomal protein L28 [Burkholderia ambifaria MC40-6]
 gi|186475351|ref|YP_001856821.1| 50S ribosomal protein L28 [Burkholderia phymatum STM815]
 gi|189351266|ref|YP_001946894.1| 50S ribosomal protein L28 [Burkholderia multivorans ATCC 17616]
 gi|206561052|ref|YP_002231817.1| 50S ribosomal protein L28 [Burkholderia cenocepacia J2315]
 gi|221199268|ref|ZP_03572312.1| 50S ribosomal protein L28 [Burkholderia multivorans CGD2M]
 gi|221205830|ref|ZP_03578845.1| 50S ribosomal protein L28 [Burkholderia multivorans CGD2]
 gi|221211488|ref|ZP_03584467.1| 50S ribosomal protein L28 [Burkholderia multivorans CGD1]
 gi|238028404|ref|YP_002912635.1| 50S ribosomal protein L28 [Burkholderia glumae BGR1]
 gi|254175666|ref|ZP_04882326.1| 50S ribosomal protein L28 [Burkholderia mallei ATCC 10399]
 gi|254181485|ref|ZP_04888082.1| 50S ribosomal protein L28 [Burkholderia pseudomallei 1655]
 gi|254190873|ref|ZP_04897380.1| 50S ribosomal protein L28 [Burkholderia pseudomallei Pasteur
          52237]
 gi|254202497|ref|ZP_04908860.1| 50S ribosomal protein L28 [Burkholderia mallei FMH]
 gi|254207832|ref|ZP_04914182.1| 50S ribosomal protein L28 [Burkholderia mallei JHU]
 gi|254247436|ref|ZP_04940757.1| ribosomal protein L28 [Burkholderia cenocepacia PC184]
 gi|254251633|ref|ZP_04944951.1| RL28_BLOFL 50S ribosomal protein L28 [Burkholderia dolosa AUO158]
 gi|254356273|ref|ZP_04972549.1| 50S ribosomal protein L28 [Burkholderia mallei 2002721280]
 gi|257139990|ref|ZP_05588252.1| ribosomal protein L28 [Burkholderia thailandensis E264]
 gi|330818062|ref|YP_004361767.1| 50S ribosomal protein L28 [Burkholderia gladioli BSR3]
 gi|67461359|sp|Q62HM5|RL28_BURMA RecName: Full=50S ribosomal protein L28
 gi|67461365|sp|Q63WH3|RL28_BURPS RecName: Full=50S ribosomal protein L28
 gi|122322428|sp|Q0BCL8|RL28_BURCM RecName: Full=50S ribosomal protein L28
 gi|123371366|sp|Q1BUB1|RL28_BURCA RecName: Full=50S ribosomal protein L28
 gi|123537847|sp|Q2T0G3|RL28_BURTA RecName: Full=50S ribosomal protein L28
 gi|123567820|sp|Q39DN8|RL28_BURS3 RecName: Full=50S ribosomal protein L28
 gi|123599996|sp|Q3JV54|RL28_BURP1 RecName: Full=50S ribosomal protein L28
 gi|166226550|sp|A0K9S5|RL28_BURCH RecName: Full=50S ribosomal protein L28
 gi|166226551|sp|A2S4Y9|RL28_BURM9 RecName: Full=50S ribosomal protein L28
 gi|166226552|sp|A3NSE3|RL28_BURP0 RecName: Full=50S ribosomal protein L28
 gi|166226553|sp|A3N6Q8|RL28_BURP6 RecName: Full=50S ribosomal protein L28
 gi|166226554|sp|A4JH22|RL28_BURVG RecName: Full=50S ribosomal protein L28
 gi|226738041|sp|B1YV94|RL28_BURA4 RecName: Full=50S ribosomal protein L28
 gi|226738042|sp|B1JXB3|RL28_BURCC RecName: Full=50S ribosomal protein L28
 gi|226738043|sp|B4E8Y7|RL28_BURCJ RecName: Full=50S ribosomal protein L28
 gi|226738044|sp|A9AHD5|RL28_BURM1 RecName: Full=50S ribosomal protein L28
 gi|226738045|sp|B2JDZ9|RL28_BURP8 RecName: Full=50S ribosomal protein L28
 gi|52208971|emb|CAH34910.1| 50S ribosomal protein L28 [Burkholderia pseudomallei K96243]
 gi|52429663|gb|AAU50256.1| ribosomal protein L28 [Burkholderia mallei ATCC 23344]
 gi|76579579|gb|ABA49054.1| RpmB protein [Burkholderia pseudomallei 1710b]
 gi|77968048|gb|ABB09428.1| LSU ribosomal protein L28P [Burkholderia sp. 383]
 gi|83654795|gb|ABC38858.1| ribosomal protein L28, putative [Burkholderia thailandensis E264]
 gi|105893629|gb|ABF76794.1| LSU ribosomal protein L28P [Burkholderia cenocepacia AU 1054]
 gi|115282588|gb|ABI88105.1| LSU ribosomal protein L28P [Burkholderia ambifaria AMMD]
 gi|116648611|gb|ABK09252.1| LSU ribosomal protein L28P [Burkholderia cenocepacia HI2424]
 gi|124292202|gb|ABN01471.1| 50S ribosomal protein L28 [Burkholderia mallei NCTC 10229]
 gi|124872212|gb|EAY63928.1| ribosomal protein L28 [Burkholderia cenocepacia PC184]
 gi|124894242|gb|EAY68122.1| RL28_BLOFL 50S ribosomal protein L28 [Burkholderia dolosa AUO158]
 gi|126219827|gb|ABN83333.1| 50S ribosomal protein L28 [Burkholderia pseudomallei 668]
 gi|126226066|gb|ABN89606.1| 50S ribosomal protein L28 [Burkholderia pseudomallei 1106a]
 gi|134139832|gb|ABO55575.1| LSU ribosomal protein L28P [Burkholderia vietnamiensis G4]
 gi|147746744|gb|EDK53821.1| 50S ribosomal protein L28 [Burkholderia mallei FMH]
 gi|147751726|gb|EDK58793.1| 50S ribosomal protein L28 [Burkholderia mallei JHU]
 gi|148025270|gb|EDK83424.1| 50S ribosomal protein L28 [Burkholderia mallei 2002721280]
 gi|157938548|gb|EDO94218.1| 50S ribosomal protein L28 [Burkholderia pseudomallei Pasteur
          52237]
 gi|160341402|gb|ABX14488.1| ribosomal protein L28 [Burkholderia multivorans ATCC 17616]
 gi|160696710|gb|EDP86680.1| 50S ribosomal protein L28 [Burkholderia mallei ATCC 10399]
 gi|169817105|gb|ACA91688.1| ribosomal protein L28 [Burkholderia cenocepacia MC0-3]
 gi|170137437|gb|EDT05677.1| ribosomal protein L28 [Burkholderia ambifaria IOP40-10]
 gi|171098114|gb|EDT42929.1| ribosomal protein L28 [Burkholderia ambifaria MEX-5]
 gi|171993979|gb|ACB64898.1| ribosomal protein L28 [Burkholderia ambifaria MC40-6]
 gi|184191810|gb|ACC69775.1| ribosomal protein L28 [Burkholderia phymatum STM815]
 gi|184212023|gb|EDU09066.1| 50S ribosomal protein L28 [Burkholderia pseudomallei 1655]
 gi|189335288|dbj|BAG44358.1| large subunit ribosomal protein L28 [Burkholderia multivorans
          ATCC 17616]
 gi|198037094|emb|CAR53015.1| 50S ribosomal protein L28 [Burkholderia cenocepacia J2315]
 gi|221168849|gb|EEE01317.1| 50S ribosomal protein L28 [Burkholderia multivorans CGD1]
 gi|221174668|gb|EEE07100.1| 50S ribosomal protein L28 [Burkholderia multivorans CGD2]
 gi|221180553|gb|EEE12956.1| 50S ribosomal protein L28 [Burkholderia multivorans CGD2M]
 gi|237877598|gb|ACR29931.1| 50S ribosomal protein L28 [Burkholderia glumae BGR1]
 gi|325528991|gb|EGD06010.1| ribosomal protein L28 [Burkholderia sp. TJI49]
 gi|327370455|gb|AEA61811.1| 50S ribosomal protein L28 [Burkholderia gladioli BSR3]
          Length = 77

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 33/75 (44%), Positives = 48/75 (64%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVC++T K  MSGN VSHANNKT+RRFLPNL       +   +  +LR+S   LR ++
Sbjct: 1  MARVCQVTGKAPMSGNNVSHANNKTKRRFLPNLQNRRFWVESENRWVRLRVSNAGLRLID 60

Query: 61 RQGGLDRFLSNSKKE 75
          + G +D  L++ +  
Sbjct: 61 KNG-IDSVLADLRAR 74


>gi|17547164|ref|NP_520566.1| 50S ribosomal protein L28 [Ralstonia solanacearum GMI1000]
 gi|83746660|ref|ZP_00943709.1| LSU ribosomal protein L28P [Ralstonia solanacearum UW551]
 gi|300690690|ref|YP_003751685.1| 50S ribosomal subunit protein L28 [Ralstonia solanacearum PSI07]
 gi|300703308|ref|YP_003744910.1| 50S ribosomal protein L28 [Ralstonia solanacearum CFBP2957]
 gi|20139460|sp|Q8XWM9|RL28_RALSO RecName: Full=50S ribosomal protein L28
 gi|17429466|emb|CAD16152.1| probable 50s ribosomal protein l28 [Ralstonia solanacearum
          GMI1000]
 gi|83726613|gb|EAP73742.1| LSU ribosomal protein L28P [Ralstonia solanacearum UW551]
 gi|299065958|emb|CBJ37139.1| 50S ribosomal subunit protein L28 [Ralstonia solanacearum CMR15]
 gi|299070971|emb|CBJ42280.1| 50S ribosomal subunit protein L28 [Ralstonia solanacearum
          CFBP2957]
 gi|299077750|emb|CBJ50388.1| 50S ribosomal subunit protein L28 [Ralstonia solanacearum PSI07]
          Length = 77

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 32/75 (42%), Positives = 47/75 (62%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVC++T K  M GN VSHANNKT+RRFLPNL       +   +   LR+S   LR ++
Sbjct: 1  MARVCQVTGKAPMVGNNVSHANNKTKRRFLPNLQNRRFWVESENRWVSLRVSNAGLRLID 60

Query: 61 RQGGLDRFLSNSKKE 75
          ++G +D  L++ +  
Sbjct: 61 KKG-IDEVLADLRAR 74


>gi|91784963|ref|YP_560169.1| 50S ribosomal protein L28 [Burkholderia xenovorans LB400]
 gi|209517443|ref|ZP_03266284.1| ribosomal protein L28 [Burkholderia sp. H160]
 gi|296157155|ref|ZP_06839991.1| ribosomal protein L28 [Burkholderia sp. Ch1-1]
 gi|123358513|sp|Q13UX2|RL28_BURXL RecName: Full=50S ribosomal protein L28
 gi|91688917|gb|ABE32117.1| LSU ribosomal protein L28P [Burkholderia xenovorans LB400]
 gi|209502097|gb|EEA02112.1| ribosomal protein L28 [Burkholderia sp. H160]
 gi|295892491|gb|EFG72273.1| ribosomal protein L28 [Burkholderia sp. Ch1-1]
          Length = 77

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 33/75 (44%), Positives = 49/75 (65%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVC++T K  MSGN VSHANNKT+RRFLPNL    +  +   +  +LR+S   LR ++
Sbjct: 1  MARVCQVTGKAPMSGNNVSHANNKTKRRFLPNLQNRRIWVESENRWVRLRVSNAGLRLID 60

Query: 61 RQGGLDRFLSNSKKE 75
          + G +D  L++ +  
Sbjct: 61 KNG-IDAVLADLRAR 74


>gi|319941938|ref|ZP_08016259.1| ribosomal protein L28 [Sutterella wadsworthensis 3_1_45B]
 gi|319804591|gb|EFW01461.1| ribosomal protein L28 [Sutterella wadsworthensis 3_1_45B]
          Length = 77

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 30/75 (40%), Positives = 49/75 (65%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVC++T K  M G++VSHANNKT+RRF+PNL       +   +  +LR++   LR+V+
Sbjct: 1  MARVCQVTGKAPMVGHQVSHANNKTKRRFMPNLQYRRFWVESENRWVRLRLTNAGLRTVD 60

Query: 61 RQGGLDRFLSNSKKE 75
          + G +D  L++ +  
Sbjct: 61 KLG-IDAVLADLRAR 74


>gi|187929783|ref|YP_001900270.1| 50S ribosomal protein L28 [Ralstonia pickettii 12J]
 gi|241663909|ref|YP_002982269.1| 50S ribosomal protein L28 [Ralstonia pickettii 12D]
 gi|309781501|ref|ZP_07676237.1| ribosomal protein L28 [Ralstonia sp. 5_7_47FAA]
 gi|226699151|sp|B2UAP1|RL28_RALPJ RecName: Full=50S ribosomal protein L28
 gi|187726673|gb|ACD27838.1| ribosomal protein L28 [Ralstonia pickettii 12J]
 gi|240865936|gb|ACS63597.1| ribosomal protein L28 [Ralstonia pickettii 12D]
 gi|308919914|gb|EFP65575.1| ribosomal protein L28 [Ralstonia sp. 5_7_47FAA]
          Length = 77

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 32/75 (42%), Positives = 46/75 (61%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVC++T K  M GN VSHANNKT+RRFLPNL       +   +   LR+S   LR ++
Sbjct: 1  MARVCQVTGKAPMVGNNVSHANNKTKRRFLPNLQNRRFWVESENRWVSLRVSNAGLRLID 60

Query: 61 RQGGLDRFLSNSKKE 75
          ++G +D  L + +  
Sbjct: 61 KKG-IDEVLVDLRAR 74


>gi|88657876|ref|YP_507300.1| 50S ribosomal protein L28 [Ehrlichia chaffeensis str. Arkansas]
 gi|123493481|sp|Q2GGY3|RL28_EHRCR RecName: Full=50S ribosomal protein L28
 gi|88599333|gb|ABD44802.1| 50S ribosomal protein L28 [Ehrlichia chaffeensis str. Arkansas]
          Length = 100

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 36/94 (38%), Positives = 63/94 (67%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T +    GNKVSH+N KT+R +L NL  +TL+SDI+ +K++ ++S   LR+V 
Sbjct: 1  MSRVCDITGQGKSFGNKVSHSNRKTKRAYLVNLHNVTLVSDILNRKFKFKVSSRTLRTVN 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSE 94
           +GGLD +L N+    L+ + + ++  +   +++
Sbjct: 61 YKGGLDLYLLNTSSRKLTDKAQKIKKLVKNAVAK 94


>gi|262277628|ref|ZP_06055421.1| 50S ribosomal protein L28 [alpha proteobacterium HIMB114]
 gi|262224731|gb|EEY75190.1| 50S ribosomal protein L28 [alpha proteobacterium HIMB114]
          Length = 97

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 44/97 (45%), Positives = 73/97 (75%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+ +CELT K  MSG+KVSHANNKT+R+F PNL +++L S+++++   L+IS  AL++V+
Sbjct: 1  MANICELTGKRPMSGHKVSHANNKTKRKFFPNLKKVSLKSELLKKNVSLKISTRALKAVD 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKSS 97
           +GGLD+FL  +K +NL+ R++ L+  ++ K   K++
Sbjct: 61 FRGGLDQFLIRAKNKNLAPRIKKLKKALMVKTKAKAN 97


>gi|303257739|ref|ZP_07343751.1| ribosomal protein L28 [Burkholderiales bacterium 1_1_47]
 gi|331000392|ref|ZP_08324070.1| ribosomal protein L28 [Parasutterella excrementihominis YIT
          11859]
 gi|302859709|gb|EFL82788.1| ribosomal protein L28 [Burkholderiales bacterium 1_1_47]
 gi|329571944|gb|EGG53618.1| ribosomal protein L28 [Parasutterella excrementihominis YIT
          11859]
          Length = 77

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 30/75 (40%), Positives = 50/75 (66%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVC++T K  M GN+VSHANNKT+RRF+PNL       +   +  +LR++  ALR+++
Sbjct: 1  MARVCQVTGKAPMVGNRVSHANNKTKRRFMPNLQYRRFWVESENRWVRLRVTNAALRTID 60

Query: 61 RQGGLDRFLSNSKKE 75
          + G ++  L++ +  
Sbjct: 61 KNG-IEAVLADLRAR 74


>gi|312795309|ref|YP_004028231.1| LSU ribosomal protein L28P [Burkholderia rhizoxinica HKI 454]
 gi|312167084|emb|CBW74087.1| LSU ribosomal protein L28P [Burkholderia rhizoxinica HKI 454]
          Length = 98

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 31/75 (41%), Positives = 46/75 (61%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+R C++T K  M GN VSHANNKT+RRFLPNL       +   +  +LR+S   LR ++
Sbjct: 22 MARKCQVTGKAPMVGNNVSHANNKTKRRFLPNLQSRRFWVESENRWVRLRVSNAGLRLID 81

Query: 61 RQGGLDRFLSNSKKE 75
          + G +D  L++ +  
Sbjct: 82 KNG-IDPVLADLRAR 95


>gi|332530913|ref|ZP_08406837.1| 50S ribosomal protein L28 [Hylemonella gracilis ATCC 19624]
 gi|332039601|gb|EGI76003.1| 50S ribosomal protein L28 [Hylemonella gracilis ATCC 19624]
          Length = 77

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 33/75 (44%), Positives = 48/75 (64%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVCE+T K  M GN +SHANNKT+RRFLPNL       +   +  +LR+S  ALR ++
Sbjct: 1  MARVCEVTGKKPMVGNNISHANNKTKRRFLPNLQYRRFWVESENRWVRLRVSSAALRLID 60

Query: 61 RQGGLDRFLSNSKKE 75
          + G +D  L++ +  
Sbjct: 61 KNG-IDSVLADLRAR 74


>gi|89901949|ref|YP_524420.1| 50S ribosomal protein L28 [Rhodoferax ferrireducens T118]
 gi|122478563|sp|Q21TL4|RL28_RHOFD RecName: Full=50S ribosomal protein L28
 gi|89346686|gb|ABD70889.1| LSU ribosomal protein L28P [Rhodoferax ferrireducens T118]
          Length = 77

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 34/75 (45%), Positives = 48/75 (64%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVCE+T K  M GNKVSHANN+T+RRFLPNL       +   +  +LRIS   LR ++
Sbjct: 1  MARVCEVTGKGPMVGNKVSHANNRTKRRFLPNLQYRRFWVETENRWIRLRISNAGLRLID 60

Query: 61 RQGGLDRFLSNSKKE 75
          + G +D  L++ +  
Sbjct: 61 KNG-IDVVLADLRAR 74


>gi|94311802|ref|YP_585012.1| 50S ribosomal protein L28 [Cupriavidus metallidurans CH34]
 gi|166226608|sp|Q1LJD3|RL28_RALME RecName: Full=50S ribosomal protein L28
 gi|93355654|gb|ABF09743.1| 50S ribosomal subunit protein L28 [Cupriavidus metallidurans
          CH34]
          Length = 77

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 32/75 (42%), Positives = 47/75 (62%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVC++T K  M GN VSHANNKT+RRFLPNL       +   +   LR+S   LR ++
Sbjct: 1  MARVCQVTGKAPMVGNNVSHANNKTKRRFLPNLQNRRFFVESENRWVSLRVSNAGLRLID 60

Query: 61 RQGGLDRFLSNSKKE 75
          ++G +D  L++ +  
Sbjct: 61 KKG-IDAVLADLRAR 74


>gi|242219285|ref|XP_002475424.1| mitochondrial 50S ribosomal protein L28-like protein [Postia
           placenta Mad-698-R]
 gi|220725395|gb|EED79384.1| mitochondrial 50S ribosomal protein L28-like protein [Postia
           placenta Mad-698-R]
          Length = 124

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 26/88 (29%), Positives = 48/88 (54%)

Query: 9   KKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRF 68
            K    GN V  +  KTRR +LPN+      SD +++  Q+++S  AL+++ + GG+D +
Sbjct: 26  GKMKQYGNNVPFSMQKTRRTWLPNIQNKRFFSDALQEFVQVKVSTRALKTINKYGGIDTY 85

Query: 69  LSNSKKENLSARMRTLRSQILKKMSEKS 96
           L  +K + L      LR  + +++S + 
Sbjct: 86  LLKTKSDLLGWEGMRLRIMVRERISSRQ 113


>gi|254780584|ref|YP_003064997.1| 50S ribosomal protein L28 [Candidatus Liberibacter asiaticus str.
          psy62]
 gi|254040261|gb|ACT57057.1| 50S ribosomal protein L28 [Candidatus Liberibacter asiaticus str.
          psy62]
          Length = 97

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 97/97 (100%), Positives = 97/97 (100%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE
Sbjct: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKSS 97
          RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKSS
Sbjct: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKSS 97


>gi|91774668|ref|YP_544424.1| 50S ribosomal protein L28P [Methylobacillus flagellatus KT]
 gi|253998048|ref|YP_003050111.1| 50S ribosomal protein L28 [Methylovorus sp. SIP3-4]
 gi|313200113|ref|YP_004038771.1| 50S ribosomal protein L28 [Methylovorus sp. MP688]
 gi|122400322|sp|Q1H4K4|RL28_METFK RecName: Full=50S ribosomal protein L28
 gi|91708655|gb|ABE48583.1| LSU ribosomal protein L28P [Methylobacillus flagellatus KT]
 gi|253984727|gb|ACT49584.1| ribosomal protein L28 [Methylovorus sp. SIP3-4]
 gi|312439429|gb|ADQ83535.1| ribosomal protein L28 [Methylovorus sp. MP688]
          Length = 78

 Score =  100 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 33/75 (44%), Positives = 48/75 (64%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVC++T K  M GN VSHANNKT+RRFLPNL       +   +   LRI+  ALR+++
Sbjct: 1  MARVCQVTGKKPMVGNNVSHANNKTKRRFLPNLQNRKFWVESENRWVSLRITNAALRTID 60

Query: 61 RQGGLDRFLSNSKKE 75
          + G +D  L++ +  
Sbjct: 61 KNG-IDAVLADLRAS 74


>gi|254494553|ref|ZP_05107724.1| 50S ribosomal protein L28 [Neisseria gonorrhoeae 1291]
 gi|268604467|ref|ZP_06138634.1| 50S ribosomal protein L28 [Neisseria gonorrhoeae PID1]
 gi|226513593|gb|EEH62938.1| 50S ribosomal protein L28 [Neisseria gonorrhoeae 1291]
 gi|268588598|gb|EEZ53274.1| 50S ribosomal protein L28 [Neisseria gonorrhoeae PID1]
          Length = 117

 Score =  100 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 34/75 (45%), Positives = 50/75 (66%), Gaps = 1/75 (1%)

Query: 1   MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
           M+RVC++T K  MSGN VSHANNKT+RRFLPNL       +   +  +LR+S  ALR+++
Sbjct: 41  MARVCKVTGKRPMSGNNVSHANNKTKRRFLPNLQSRRFWVESENRWVRLRVSNAALRTID 100

Query: 61  RQGGLDRFLSNSKKE 75
           + G +D  L++ +  
Sbjct: 101 KVG-IDVVLADLRAR 114


>gi|301629813|ref|XP_002944028.1| PREDICTED: 50S ribosomal protein L28-like [Xenopus (Silurana)
          tropicalis]
          Length = 90

 Score =  100 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 34/75 (45%), Positives = 49/75 (65%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVCE+T K  M GNKVSHANNKT+RRFLPNL       +   +  +LR+S  ALR ++
Sbjct: 14 MARVCEVTGKKPMVGNKVSHANNKTKRRFLPNLQYRRFWVESENRWVRLRVSSAALRLID 73

Query: 61 RQGGLDRFLSNSKKE 75
          + G ++  L++ +  
Sbjct: 74 KNG-IESVLADMRAR 87


>gi|226939473|ref|YP_002794546.1| 50S ribosomal protein L28 [Laribacter hongkongensis HLHK9]
 gi|254801365|sp|C1DCC0|RL28_LARHH RecName: Full=50S ribosomal protein L28
 gi|226714399|gb|ACO73537.1| RpmB [Laribacter hongkongensis HLHK9]
          Length = 77

 Score =  100 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 32/75 (42%), Positives = 49/75 (65%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVC++T K  M GN VSHANNKT+RRFLPNL       +   +  ++R+S  ALR+++
Sbjct: 1  MARVCKVTGKRPMVGNNVSHANNKTKRRFLPNLQYRRFWVESENRWVRMRVSNAALRTID 60

Query: 61 RQGGLDRFLSNSKKE 75
          + G +D  L++ +  
Sbjct: 61 KVG-IDAVLADLRAR 74


>gi|289613675|emb|CBI59423.1| unnamed protein product [Sordaria macrospora]
          Length = 266

 Score =  100 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 25/88 (28%), Positives = 47/88 (53%), Gaps = 4/88 (4%)

Query: 12  VMSGNKVSHAN-NKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFLS 70
           +  GN VS  N  KTRR++ PN+ +  L S  +    + R++   LR++++ GGLD +L 
Sbjct: 96  IRFGNNVSKRNEIKTRRKWRPNVQQKRLWSKSLGVFVRTRVTTRVLRTIDKVGGLDEYLL 155

Query: 71  N---SKKENLSARMRTLRSQILKKMSEK 95
               ++ + L      LR +I++  + +
Sbjct: 156 GHKAARVKELGPWGWMLRWRIMQTPAVR 183


>gi|255719428|ref|XP_002555994.1| KLTH0H02618p [Lachancea thermotolerans]
 gi|238941960|emb|CAR30132.1| KLTH0H02618p [Lachancea thermotolerans]
          Length = 273

 Score =  100 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 25/92 (27%), Positives = 52/92 (56%), Gaps = 3/92 (3%)

Query: 9   KKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRF 68
              +  GN V+ +  KTRRR+LPN+ +  L S+ + +   +R++   LR+V ++GG+D +
Sbjct: 91  GSFIQYGNNVAESKTKTRRRWLPNVIKKGLWSEALSRNVSIRMTAKVLRTVTKEGGIDNY 150

Query: 69  LSN---SKKENLSARMRTLRSQILKKMSEKSS 97
           L+    ++ + L      LR ++L++   + +
Sbjct: 151 LTKEKSARIKELGPTGWKLRYRVLQRQELREN 182


>gi|170693581|ref|ZP_02884739.1| ribosomal protein L28 [Burkholderia graminis C4D1M]
 gi|295677433|ref|YP_003605957.1| ribosomal protein L28 [Burkholderia sp. CCGE1002]
 gi|307730753|ref|YP_003907977.1| 50S ribosomal protein L28 [Burkholderia sp. CCGE1003]
 gi|323527116|ref|YP_004229269.1| 50S ribosomal protein L28 [Burkholderia sp. CCGE1001]
 gi|170141363|gb|EDT09533.1| ribosomal protein L28 [Burkholderia graminis C4D1M]
 gi|295437276|gb|ADG16446.1| ribosomal protein L28 [Burkholderia sp. CCGE1002]
 gi|307585288|gb|ADN58686.1| ribosomal protein L28 [Burkholderia sp. CCGE1003]
 gi|323384118|gb|ADX56209.1| ribosomal protein L28 [Burkholderia sp. CCGE1001]
          Length = 77

 Score =  100 bits (250), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 34/75 (45%), Positives = 49/75 (65%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVC++T K  MSGN VSHANNKT+RRFLPNL    +  +   +  +LRIS   LR ++
Sbjct: 1  MARVCQVTGKAPMSGNNVSHANNKTKRRFLPNLQSRRIWVESENRWVRLRISNAGLRLID 60

Query: 61 RQGGLDRFLSNSKKE 75
          + G +D  L++ +  
Sbjct: 61 KNG-IDAVLADLRAR 74


>gi|217969674|ref|YP_002354908.1| 50S ribosomal protein L28 [Thauera sp. MZ1T]
 gi|217507001|gb|ACK54012.1| ribosomal protein L28 [Thauera sp. MZ1T]
          Length = 78

 Score =  100 bits (250), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 36/84 (42%), Positives = 52/84 (61%), Gaps = 6/84 (7%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVC++T K  M GN VSHANNKT+RRFLPNL      S+   +  +LR+S   LR+++
Sbjct: 1  MARVCQVTGKAPMVGNNVSHANNKTKRRFLPNLQSRRFWSEGENRWIRLRVSNAGLRTID 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTL 84
          ++G +D  ++      L AR   L
Sbjct: 61 KKG-IDVVVA-----ELRARGEKL 78


>gi|73542418|ref|YP_296938.1| 50S ribosomal protein L28 [Ralstonia eutropha JMP134]
 gi|113868988|ref|YP_727477.1| 50S ribosomal protein L28 [Ralstonia eutropha H16]
 gi|194290594|ref|YP_002006501.1| 50S ribosomal protein l28 [Cupriavidus taiwanensis LMG 19424]
 gi|122946632|sp|Q0K7B2|RL28_RALEH RecName: Full=50S ribosomal protein L28
 gi|123624202|sp|Q46XN9|RL28_RALEJ RecName: Full=50S ribosomal protein L28
 gi|226738062|sp|B3R6F8|RL28_CUPTR RecName: Full=50S ribosomal protein L28
 gi|72119831|gb|AAZ62094.1| LSU ribosomal protein L28P [Ralstonia eutropha JMP134]
 gi|113527764|emb|CAJ94109.1| LSU ribosomal protein L28 [Ralstonia eutropha H16]
 gi|193224429|emb|CAQ70440.1| 50S ribosomal subunit protein L28 [Cupriavidus taiwanensis LMG
          19424]
          Length = 77

 Score =  100 bits (249), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 32/75 (42%), Positives = 47/75 (62%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVC++T K  M GN VSHANNKT+RRFLPNL       +   +   LR+S   LR ++
Sbjct: 1  MARVCQVTGKAPMVGNNVSHANNKTKRRFLPNLQNRRFFVESENRWVSLRVSNAGLRLID 60

Query: 61 RQGGLDRFLSNSKKE 75
          ++G +D  L++ +  
Sbjct: 61 KKG-IDSVLADLRAR 74


>gi|307824752|ref|ZP_07654975.1| ribosomal protein L28 [Methylobacter tundripaludum SV96]
 gi|307734110|gb|EFO04964.1| ribosomal protein L28 [Methylobacter tundripaludum SV96]
          Length = 78

 Score =  100 bits (249), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 48/73 (65%), Gaps = 1/73 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  ++GN VSHANN+T+RRF PNL       +   +  +LRIS   +R ++
Sbjct: 1  MSRVCQVTGKRPVTGNNVSHANNRTKRRFCPNLQHHRFWVESENRWVRLRISTKGMRIID 60

Query: 61 RQGGLDRFLSNSK 73
          ++G +D  L++ +
Sbjct: 61 KKG-IDAVLADLR 72


>gi|319788437|ref|YP_004147912.1| ribosomal protein L28 [Pseudoxanthomonas suwonensis 11-1]
 gi|317466949|gb|ADV28681.1| ribosomal protein L28 [Pseudoxanthomonas suwonensis 11-1]
          Length = 78

 Score =  100 bits (249), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 38/84 (45%), Positives = 51/84 (60%), Gaps = 6/84 (7%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K V +GN VSHANNKTRRRFLPNL           +  +LR+S  ALR+++
Sbjct: 1  MSRVCQVTGKGVQTGNNVSHANNKTRRRFLPNLHERRFWVASENRWVKLRVSAAALRTID 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTL 84
          + G +D  L+      L AR   +
Sbjct: 61 KNG-IDSVLA-----ELRARGEKI 78


>gi|124266309|ref|YP_001020313.1| 50S ribosomal protein L28 [Methylibium petroleiphilum PM1]
 gi|166226588|sp|A2SET9|RL28_METPP RecName: Full=50S ribosomal protein L28
 gi|124259084|gb|ABM94078.1| LSU ribosomal protein L28P [Methylibium petroleiphilum PM1]
          Length = 77

 Score =  100 bits (249), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 30/63 (47%), Positives = 42/63 (66%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVC++T K  M GN VSHANNKT+RRFLPNL       +   +  +LR++  ALR ++
Sbjct: 1  MARVCQVTGKGPMVGNNVSHANNKTKRRFLPNLQYRRFWLETENRWVRLRVTNAALRLID 60

Query: 61 RQG 63
          + G
Sbjct: 61 KVG 63


>gi|253995750|ref|YP_003047814.1| 50S ribosomal protein L28 [Methylotenera mobilis JLW8]
 gi|253982429|gb|ACT47287.1| ribosomal protein L28 [Methylotenera mobilis JLW8]
          Length = 78

 Score = 99.7 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 31/74 (41%), Positives = 47/74 (63%), Gaps = 1/74 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVC++T K  M GN VSHA NKT+RRFLPNL       +   +   +RI+  ALR+++
Sbjct: 1  MARVCQVTGKKPMVGNNVSHAQNKTKRRFLPNLQNRKFWVESENRWVSMRITNAALRTID 60

Query: 61 RQGGLDRFLSNSKK 74
          + G +D  L++ + 
Sbjct: 61 KNG-IDAVLADMRA 73


>gi|104784326|ref|YP_610824.1| 50S ribosomal protein L28 [Pseudomonas entomophila L48]
 gi|122401257|sp|Q1I2U5|RL28_PSEE4 RecName: Full=50S ribosomal protein L28
 gi|95113313|emb|CAK18041.1| 50S ribosomal protein L28 [Pseudomonas entomophila L48]
          Length = 78

 Score = 99.7 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 31/73 (42%), Positives = 48/73 (65%), Gaps = 1/73 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  ++GN +SHANNKTRRRFLPNL       +   +  +LR+S   +R ++
Sbjct: 1  MSRVCQVTGKGPVTGNNISHANNKTRRRFLPNLQHHRFWVESENRFVRLRVSAKGMRIID 60

Query: 61 RQGGLDRFLSNSK 73
          ++G +D  L + +
Sbjct: 61 KRG-IDAVLVDIR 72


>gi|152983116|ref|YP_001354242.1| 50S ribosomal protein L28 [Janthinobacterium sp. Marseille]
 gi|151283193|gb|ABR91603.1| 50S ribosomal protein L28 [Janthinobacterium sp. Marseille]
          Length = 112

 Score = 99.7 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 32/75 (42%), Positives = 47/75 (62%), Gaps = 1/75 (1%)

Query: 1   MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
           M+RVC++T K  M GN VSHANNKT+RRFLPNL    +  +   +   LR+S   LR ++
Sbjct: 35  MARVCQVTGKGPMVGNNVSHANNKTKRRFLPNLQNRRIFVESENRWVSLRLSNAGLRVID 94

Query: 61  RQGGLDRFLSNSKKE 75
           + G +D  L++ +  
Sbjct: 95  KIG-IDAVLADMRAR 108


>gi|296840760|ref|ZP_06899339.1| 50S ribosomal subunit protein L28 [Neisseria polysaccharea ATCC
          43768]
 gi|296840040|gb|EFH23978.1| 50S ribosomal subunit protein L28 [Neisseria polysaccharea ATCC
          43768]
          Length = 99

 Score = 99.7 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 34/75 (45%), Positives = 50/75 (66%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVC++T K  MSGN VSHANNKT+RRFLPNL       +   +  +LR+S  ALR+++
Sbjct: 23 MARVCKVTGKRPMSGNNVSHANNKTKRRFLPNLQSRRFWVESENRWVRLRVSNAALRTID 82

Query: 61 RQGGLDRFLSNSKKE 75
          + G +D  L++ +  
Sbjct: 83 KVG-IDVVLADLRAR 96


>gi|329890834|ref|ZP_08269177.1| 50S ribosomal protein L28 [Brevundimonas diminuta ATCC 11568]
 gi|328846135|gb|EGF95699.1| 50S ribosomal protein L28 [Brevundimonas diminuta ATCC 11568]
          Length = 86

 Score = 99.7 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 34/85 (40%), Positives = 57/85 (67%)

Query: 13 MSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFLSNS 72
          M G+ VSH+N KT+RRFLP L  + + S+ + Q + LRIS  ALR+++ +GGLD F+  +
Sbjct: 1  MVGHHVSHSNIKTKRRFLPALKTVKVQSEALGQTFSLRISNAALRTLDFKGGLDAFIVKA 60

Query: 73 KKENLSARMRTLRSQILKKMSEKSS 97
          + E LS     ++ Q+  K++E+++
Sbjct: 61 RDEQLSIAALRIKRQVRAKLAEQAA 85


>gi|147865450|emb|CAN79404.1| hypothetical protein VITISV_028074 [Vitis vinifera]
          Length = 1084

 Score = 99.7 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 25/95 (26%), Positives = 50/95 (52%), Gaps = 1/95 (1%)

Query: 2   SRVCELTKKTVMSGNKVSH-ANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
           ++      + +  GN+VS    NKTRR + PN+    L S I+++  +++++  ALR ++
Sbjct: 39  AKRGIYAGRHIQFGNRVSEDGGNKTRRSWKPNVQEKRLFSYILDRHIRVKVTTHALRCID 98

Query: 61  RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEK 95
           + GG+D +L  +    +   M       ++KM E+
Sbjct: 99  KAGGIDEYLLKTPYHKMDTEMGLFWKAKIEKMYEE 133


>gi|71908756|ref|YP_286343.1| 50S ribosomal protein L28 [Dechloromonas aromatica RCB]
 gi|123626758|sp|Q47BA8|RL28_DECAR RecName: Full=50S ribosomal protein L28
 gi|71848377|gb|AAZ47873.1| LSU ribosomal protein L28P [Dechloromonas aromatica RCB]
          Length = 77

 Score = 99.7 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 32/75 (42%), Positives = 48/75 (64%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVC++T K  M GNKVSHANN+T+RRFLPNL       +   +  +LR+S   LR ++
Sbjct: 1  MARVCQVTGKAPMVGNKVSHANNRTKRRFLPNLQYRRFWVESENRFLRLRVSNAGLRLID 60

Query: 61 RQGGLDRFLSNSKKE 75
          + G +D  L++ +  
Sbjct: 61 KNG-IDAVLADLRAR 74


>gi|148652401|ref|YP_001279494.1| 50S ribosomal protein L28 [Psychrobacter sp. PRwf-1]
 gi|172048504|sp|A5WD03|RL28_PSYWF RecName: Full=50S ribosomal protein L28
 gi|148571485|gb|ABQ93544.1| LSU ribosomal protein L28P [Psychrobacter sp. PRwf-1]
          Length = 78

 Score = 99.7 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 31/75 (41%), Positives = 48/75 (64%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K    GN VSHA+NKTRRRFLPNL       +   +  +LR+S   +R ++
Sbjct: 1  MSRVCQVTGKRPQVGNNVSHAHNKTRRRFLPNLHNHRFWVESENRFVRLRVSTKGMRIID 60

Query: 61 RQGGLDRFLSNSKKE 75
          + G +D+ L++ + +
Sbjct: 61 KHG-IDKVLADLRAK 74


>gi|171057442|ref|YP_001789791.1| 50S ribosomal protein L28 [Leptothrix cholodnii SP-6]
 gi|226732833|sp|B1Y149|RL28_LEPCP RecName: Full=50S ribosomal protein L28
 gi|170774887|gb|ACB33026.1| ribosomal protein L28 [Leptothrix cholodnii SP-6]
          Length = 77

 Score = 99.3 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 32/63 (50%), Positives = 42/63 (66%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVC++T K  M GN VSHANNKT+RRFLPNL       +   +  +LRIS  ALR ++
Sbjct: 1  MARVCQVTGKGPMVGNNVSHANNKTKRRFLPNLHYRRFWLETENRWVRLRISNAALRLID 60

Query: 61 RQG 63
          + G
Sbjct: 61 KVG 63


>gi|56477979|ref|YP_159568.1| 50S ribosomal protein L28 [Aromatoleum aromaticum EbN1]
 gi|67461304|sp|Q5P1Z7|RL28_AZOSE RecName: Full=50S ribosomal protein L28
 gi|56314022|emb|CAI08667.1| 50S ribosomal protein L28 [Aromatoleum aromaticum EbN1]
          Length = 78

 Score = 99.3 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 36/84 (42%), Positives = 52/84 (61%), Gaps = 6/84 (7%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVC++T K  M GN VSHANNKT+RRFLPNL      S+   +  +LR+S  ALR+++
Sbjct: 1  MARVCQVTGKAPMVGNNVSHANNKTKRRFLPNLQNRRFWSESENRWIRLRVSNAALRTID 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTL 84
          ++G +D  +       L AR   +
Sbjct: 61 KKG-IDVVV-----SELRARGEKV 78


>gi|170719375|ref|YP_001747063.1| 50S ribosomal protein L28 [Pseudomonas putida W619]
 gi|226699150|sp|B1J4M3|RL28_PSEPW RecName: Full=50S ribosomal protein L28
 gi|169757378|gb|ACA70694.1| ribosomal protein L28 [Pseudomonas putida W619]
          Length = 78

 Score = 99.3 bits (247), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 31/75 (41%), Positives = 48/75 (64%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  ++GN +SHANNKTRRRFLPNL       +   +  +LR+S   +R ++
Sbjct: 1  MSRVCQVTGKGPVTGNNISHANNKTRRRFLPNLQHHRFWVESENRFVRLRVSAKGMRVID 60

Query: 61 RQGGLDRFLSNSKKE 75
          ++G +D  L+  +  
Sbjct: 61 KRG-IDVVLAELRAR 74


>gi|119897427|ref|YP_932640.1| 50S ribosomal protein L28 [Azoarcus sp. BH72]
 gi|166226540|sp|A1K4J8|RL28_AZOSB RecName: Full=50S ribosomal protein L28
 gi|119669840|emb|CAL93753.1| 50S ribosomal protein L28 [Azoarcus sp. BH72]
          Length = 78

 Score = 99.3 bits (247), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 33/75 (44%), Positives = 50/75 (66%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVC++T K  M GN VSHANNKT+RRFLPNL      S+   +  +LR+S  ALR+++
Sbjct: 1  MARVCQVTGKAPMVGNHVSHANNKTKRRFLPNLQNRRFWSEAENRWIRLRVSNAALRTID 60

Query: 61 RQGGLDRFLSNSKKE 75
          ++G +D  ++  +  
Sbjct: 61 KKG-IDVVVAELRAR 74


>gi|85110139|ref|XP_963282.1| hypothetical protein NCU08410 [Neurospora crassa OR74A]
 gi|164423992|ref|XP_001728109.1| hypothetical protein NCU10866 [Neurospora crassa OR74A]
 gi|28924956|gb|EAA34046.1| conserved hypothetical protein [Neurospora crassa OR74A]
 gi|157070322|gb|EDO65018.1| conserved hypothetical protein [Neurospora crassa OR74A]
          Length = 274

 Score = 99.3 bits (247), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 25/83 (30%), Positives = 45/83 (54%), Gaps = 4/83 (4%)

Query: 12  VMSGNKVSHAN-NKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFLS 70
           +  GN VS  N  KTRR++ PN+ +  L S  +    + R++   LR++++ GGLD +L 
Sbjct: 101 IRFGNNVSKRNEIKTRRKWRPNVQQKRLWSKSLGVFVRTRVTTRVLRTIDKVGGLDEYLL 160

Query: 71  N---SKKENLSARMRTLRSQILK 90
               ++ + L      LR +I++
Sbjct: 161 GHKAARVKELGPWGWMLRWRIMQ 183


>gi|34498911|ref|NP_903126.1| 50S ribosomal protein L28 [Chromobacterium violaceum ATCC 12472]
 gi|67461496|sp|Q7NSH0|RL28_CHRVO RecName: Full=50S ribosomal protein L28
 gi|34104760|gb|AAQ61117.1| 50S ribosomal protein L28 [Chromobacterium violaceum ATCC 12472]
          Length = 77

 Score = 99.0 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 33/75 (44%), Positives = 50/75 (66%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVC++T K  M+GN VSHANNKT+RRFLPNL       +   +  +LR+S  ALR+++
Sbjct: 1  MARVCKVTGKRPMTGNNVSHANNKTKRRFLPNLQYRKFWVESENRWVRLRVSNAALRTID 60

Query: 61 RQGGLDRFLSNSKKE 75
          + G +D  L++ +  
Sbjct: 61 KVG-IDVVLADLRAR 74


>gi|121999092|ref|YP_001003879.1| ribosomal protein L28 [Halorhodospira halophila SL1]
 gi|166226580|sp|A1WZG5|RL28_HALHL RecName: Full=50S ribosomal protein L28
 gi|121590497|gb|ABM63077.1| LSU ribosomal protein L28P [Halorhodospira halophila SL1]
          Length = 78

 Score = 99.0 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 30/75 (40%), Positives = 47/75 (62%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS+VC++T     +GN VSHANNKTRRRFLPNL       +   +  +LR+S   +R ++
Sbjct: 1  MSKVCQVTGTRPGTGNNVSHANNKTRRRFLPNLHDHRYWVESENRWVRLRVSAKGMRIID 60

Query: 61 RQGGLDRFLSNSKKE 75
          ++G +D  L++ +  
Sbjct: 61 KRG-IDAVLADMRAR 74


>gi|190570684|ref|YP_001975042.1| ribosomal protein L28 [Wolbachia endosymbiont of Culex
          quinquefasciatus Pel]
 gi|213019068|ref|ZP_03334875.1| ribosomal protein L28 [Wolbachia endosymbiont of Culex
          quinquefasciatus JHB]
 gi|190356956|emb|CAQ54342.1| ribosomal protein L28 [Wolbachia endosymbiont of Culex
          quinquefasciatus Pel]
 gi|212995177|gb|EEB55818.1| ribosomal protein L28 [Wolbachia endosymbiont of Culex
          quinquefasciatus JHB]
          Length = 104

 Score = 99.0 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 41/95 (43%), Positives = 66/95 (69%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR+CELT +    GNKVSH+N KT+R FL NL ++TL S+I+E+K+  RI+   LR+++
Sbjct: 1  MSRICELTNRKKSFGNKVSHSNRKTKRTFLLNLHKVTLTSNILEKKFSFRIATRTLRTID 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEK 95
           +G LD FL N+K   LS   + ++ ++ K ++++
Sbjct: 61 YKGDLDAFLLNTKTIKLSKEAQKIKRRLKKVLAKQ 95


>gi|71066265|ref|YP_264992.1| 50S ribosomal protein L28 [Psychrobacter arcticus 273-4]
 gi|93006813|ref|YP_581250.1| 50S ribosomal protein L28 [Psychrobacter cryohalolentis K5]
 gi|122414948|sp|Q1Q987|RL28_PSYCK RecName: Full=50S ribosomal protein L28
 gi|123648080|sp|Q4FR00|RL28_PSYA2 RecName: Full=50S ribosomal protein L28
 gi|71039250|gb|AAZ19558.1| LSU ribosomal protein L28P [Psychrobacter arcticus 273-4]
 gi|92394491|gb|ABE75766.1| LSU ribosomal protein L28P [Psychrobacter cryohalolentis K5]
          Length = 78

 Score = 99.0 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 33/75 (44%), Positives = 48/75 (64%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  M GN VSHANNKTRRRFLPNL       +   +  +LR+S   +R ++
Sbjct: 1  MSRVCQVTGKRPMVGNNVSHANNKTRRRFLPNLHNHRFWVESENRFVRLRVSTKGMRIID 60

Query: 61 RQGGLDRFLSNSKKE 75
          + G +D+ L + + +
Sbjct: 61 KLG-IDKVLVDLRAQ 74


>gi|198284382|ref|YP_002220703.1| 50S ribosomal protein L28 [Acidithiobacillus ferrooxidans ATCC
          53993]
 gi|218667456|ref|YP_002427047.1| ribosomal protein L28 [Acidithiobacillus ferrooxidans ATCC 23270]
 gi|226738018|sp|B7J7Y4|RL28_ACIF2 RecName: Full=50S ribosomal protein L28
 gi|226738019|sp|B5ENA7|RL28_ACIF5 RecName: Full=50S ribosomal protein L28
 gi|198248903|gb|ACH84496.1| ribosomal protein L28 [Acidithiobacillus ferrooxidans ATCC 53993]
 gi|218519669|gb|ACK80255.1| ribosomal protein L28 [Acidithiobacillus ferrooxidans ATCC 23270]
          Length = 78

 Score = 99.0 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 31/74 (41%), Positives = 50/74 (67%), Gaps = 1/74 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  M+GN VSHA+NKTRRRFLPNL       +   +  ++R+S   +R+++
Sbjct: 1  MSRVCKVTGKKPMAGNNVSHAHNKTRRRFLPNLQYHRFWVESENRWVRMRVSTKGIRTID 60

Query: 61 RQGGLDRFLSNSKK 74
          ++G +D  L++ + 
Sbjct: 61 KKG-IDVVLADLRA 73


>gi|332968532|gb|EGK07593.1| 50S ribosomal protein L28 [Kingella kingae ATCC 23330]
          Length = 78

 Score = 99.0 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 32/75 (42%), Positives = 50/75 (66%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M++VC++T K  MSGN VSHANNKT+RRFLPNL       +   +  ++R+S  ALR+++
Sbjct: 1  MAKVCKITGKRPMSGNNVSHANNKTKRRFLPNLQSRRFWVESENRWVRIRVSNAALRTID 60

Query: 61 RQGGLDRFLSNSKKE 75
          + G +D  L++ +  
Sbjct: 61 KNG-IDAVLADLRAR 74


>gi|58700297|ref|ZP_00374759.1| ribosomal protein L28-related protein [Wolbachia endosymbiont of
          Drosophila ananassae]
 gi|58533187|gb|EAL57724.1| ribosomal protein L28-related protein [Wolbachia endosymbiont of
          Drosophila ananassae]
          Length = 103

 Score = 99.0 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 39/94 (41%), Positives = 65/94 (69%)

Query: 2  SRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVER 61
          SRVCELT +    GNKVSH+N KT+R FL NL ++TL SDI+ +K++ R++   LR+++ 
Sbjct: 1  SRVCELTNRKKSFGNKVSHSNRKTKRTFLLNLHKVTLTSDILNKKFRFRVATRTLRTIDY 60

Query: 62 QGGLDRFLSNSKKENLSARMRTLRSQILKKMSEK 95
          +G LD FL N++   LS + + ++ ++ K + ++
Sbjct: 61 KGDLDAFLLNTRTIKLSEKAQKIKRRLKKVLVKQ 94


>gi|298369464|ref|ZP_06980781.1| ribosomal protein L28 [Neisseria sp. oral taxon 014 str. F0314]
 gi|298282021|gb|EFI23509.1| ribosomal protein L28 [Neisseria sp. oral taxon 014 str. F0314]
          Length = 77

 Score = 99.0 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 35/75 (46%), Positives = 50/75 (66%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVC++T K  MSGN VSHANNKT+RRFLPNL       +   +  +LRIS  ALR+++
Sbjct: 1  MARVCKVTGKRPMSGNNVSHANNKTKRRFLPNLQSRRFWVESENRWVRLRISNAALRTID 60

Query: 61 RQGGLDRFLSNSKKE 75
          + G +D  L++ +  
Sbjct: 61 KVG-IDAVLADLRAR 74


>gi|149928584|ref|ZP_01916804.1| ribosomal protein L28 [Limnobacter sp. MED105]
 gi|149822696|gb|EDM81963.1| ribosomal protein L28 [Limnobacter sp. MED105]
          Length = 77

 Score = 99.0 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 33/75 (44%), Positives = 50/75 (66%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVC++T K  M GNKVSHANNKT+RRFLPNL       +   +  +LR++  ALR+++
Sbjct: 1  MARVCQVTGKRPMVGNKVSHANNKTKRRFLPNLQSRKFWVESENRWVRLRLTNNALRTID 60

Query: 61 RQGGLDRFLSNSKKE 75
          + G +D  L++ +  
Sbjct: 61 KNG-IDAVLADLRAR 74


>gi|15676238|ref|NP_273370.1| 50S ribosomal protein L28 [Neisseria meningitidis MC58]
 gi|59802005|ref|YP_208717.1| 50S ribosomal protein L28 [Neisseria gonorrhoeae FA 1090]
 gi|121635542|ref|YP_975787.1| 50S ribosomal protein L28 [Neisseria meningitidis FAM18]
 gi|161870749|ref|YP_001599922.1| 50S ribosomal protein L28 [Neisseria meningitidis 053442]
 gi|218768902|ref|YP_002343414.1| 50S ribosomal protein L28 [Neisseria meningitidis Z2491]
 gi|225076598|ref|ZP_03719797.1| hypothetical protein NEIFLAOT_01646 [Neisseria flavescens
          NRL30031/H210]
 gi|239999768|ref|ZP_04719692.1| 50S ribosomal protein L28 [Neisseria gonorrhoeae 35/02]
 gi|240014925|ref|ZP_04721838.1| 50S ribosomal protein L28 [Neisseria gonorrhoeae DGI18]
 gi|240017373|ref|ZP_04723913.1| 50S ribosomal protein L28 [Neisseria gonorrhoeae FA6140]
 gi|240081516|ref|ZP_04726059.1| 50S ribosomal protein L28 [Neisseria gonorrhoeae FA19]
 gi|240113795|ref|ZP_04728285.1| 50S ribosomal protein L28 [Neisseria gonorrhoeae MS11]
 gi|240116529|ref|ZP_04730591.1| 50S ribosomal protein L28 [Neisseria gonorrhoeae PID18]
 gi|240118753|ref|ZP_04732815.1| 50S ribosomal protein L28 [Neisseria gonorrhoeae PID1]
 gi|240121995|ref|ZP_04734957.1| 50S ribosomal protein L28 [Neisseria gonorrhoeae PID24-1]
 gi|240124292|ref|ZP_04737248.1| 50S ribosomal protein L28 [Neisseria gonorrhoeae PID332]
 gi|240126503|ref|ZP_04739389.1| 50S ribosomal protein L28 [Neisseria gonorrhoeae SK-92-679]
 gi|240128966|ref|ZP_04741627.1| 50S ribosomal protein L28 [Neisseria gonorrhoeae SK-93-1035]
 gi|241759287|ref|ZP_04757393.1| ribosomal protein L28 [Neisseria flavescens SK114]
 gi|254805643|ref|YP_003083864.1| 50S ribosomal protein L28 [Neisseria meningitidis alpha14]
 gi|255067972|ref|ZP_05319827.1| ribosomal protein L28 [Neisseria sicca ATCC 29256]
 gi|260439714|ref|ZP_05793530.1| 50S ribosomal protein L28 [Neisseria gonorrhoeae DGI2]
 gi|261378369|ref|ZP_05982942.1| ribosomal protein L28 [Neisseria cinerea ATCC 14685]
 gi|261379983|ref|ZP_05984556.1| ribosomal protein L28 [Neisseria subflava NJ9703]
 gi|268595580|ref|ZP_06129747.1| 50S ribosomal protein L28 [Neisseria gonorrhoeae 35/02]
 gi|268597615|ref|ZP_06131782.1| 50S ribosomal protein L28 [Neisseria gonorrhoeae FA19]
 gi|268599866|ref|ZP_06134033.1| 50S ribosomal protein L28 [Neisseria gonorrhoeae MS11]
 gi|268602201|ref|ZP_06136368.1| 50S ribosomal protein L28 [Neisseria gonorrhoeae PID18]
 gi|268682920|ref|ZP_06149782.1| 50S ribosomal protein L28 [Neisseria gonorrhoeae PID332]
 gi|268685086|ref|ZP_06151948.1| 50S ribosomal protein L28 [Neisseria gonorrhoeae SK-92-679]
 gi|268687349|ref|ZP_06154211.1| 50S ribosomal protein L28 [Neisseria gonorrhoeae SK-93-1035]
 gi|291042961|ref|ZP_06568699.1| 50S ribosomal protein L28 [Neisseria gonorrhoeae DGI2]
 gi|293398307|ref|ZP_06642498.1| 50S ribosomal protein L28 [Neisseria gonorrhoeae F62]
 gi|319639310|ref|ZP_07994061.1| 50S ribosomal protein L28 [Neisseria mucosa C102]
 gi|54039149|sp|P66151|RL28_NEIMB RecName: Full=50S ribosomal protein L28
 gi|54041850|sp|P66150|RL28_NEIMA RecName: Full=50S ribosomal protein L28
 gi|67461225|sp|Q5F682|RL28_NEIG1 RecName: Full=50S ribosomal protein L28
 gi|166226589|sp|A1KVW2|RL28_NEIMF RecName: Full=50S ribosomal protein L28
 gi|189029447|sp|A9M300|RL28_NEIM0 RecName: Full=50S ribosomal protein L28
 gi|7225542|gb|AAF40766.1| 50S ribosomal protein L28 [Neisseria meningitidis MC58]
 gi|59718900|gb|AAW90305.1| putative 50S ribosomal protein L28 [Neisseria gonorrhoeae FA
          1090]
 gi|120867248|emb|CAM11017.1| 50S ribosomal protein L28 [Neisseria meningitidis FAM18]
 gi|121052910|emb|CAM09262.1| 50S ribosomal protein L28 [Neisseria meningitidis Z2491]
 gi|161596302|gb|ABX73962.1| 50S ribosomal protein L28 [Neisseria meningitidis 053442]
 gi|224952098|gb|EEG33307.1| hypothetical protein NEIFLAOT_01646 [Neisseria flavescens
          NRL30031/H210]
 gi|241320423|gb|EER56720.1| ribosomal protein L28 [Neisseria flavescens SK114]
 gi|254669185|emb|CBA07933.1| 50S ribosomal protein L28 [Neisseria meningitidis alpha14]
 gi|255047749|gb|EET43213.1| ribosomal protein L28 [Neisseria sicca ATCC 29256]
 gi|261391847|emb|CAX49306.1| 50S ribosomal protein L28 [Neisseria meningitidis 8013]
 gi|268548969|gb|EEZ44387.1| 50S ribosomal protein L28 [Neisseria gonorrhoeae 35/02]
 gi|268551403|gb|EEZ46422.1| 50S ribosomal protein L28 [Neisseria gonorrhoeae FA19]
 gi|268583997|gb|EEZ48673.1| 50S ribosomal protein L28 [Neisseria gonorrhoeae MS11]
 gi|268586332|gb|EEZ51008.1| 50S ribosomal protein L28 [Neisseria gonorrhoeae PID18]
 gi|268623204|gb|EEZ55604.1| 50S ribosomal protein L28 [Neisseria gonorrhoeae PID332]
 gi|268625370|gb|EEZ57770.1| 50S ribosomal protein L28 [Neisseria gonorrhoeae SK-92-679]
 gi|268627633|gb|EEZ60033.1| 50S ribosomal protein L28 [Neisseria gonorrhoeae SK-93-1035]
 gi|269145479|gb|EEZ71897.1| ribosomal protein L28 [Neisseria cinerea ATCC 14685]
 gi|284797182|gb|EFC52529.1| ribosomal protein L28 [Neisseria subflava NJ9703]
 gi|291013100|gb|EFE05069.1| 50S ribosomal protein L28 [Neisseria gonorrhoeae DGI2]
 gi|291611231|gb|EFF40315.1| 50S ribosomal protein L28 [Neisseria gonorrhoeae F62]
 gi|308388532|gb|ADO30852.1| 50S ribosomal protein L28 [Neisseria meningitidis alpha710]
 gi|309378671|emb|CBX22742.1| unnamed protein product [Neisseria lactamica Y92-1009]
 gi|317399494|gb|EFV80164.1| 50S ribosomal protein L28 [Neisseria mucosa C102]
 gi|319411203|emb|CBY91608.1| 50S ribosomal protein L28 [Neisseria meningitidis WUE 2594]
 gi|325128907|gb|EGC51761.1| ribosomal protein L28 [Neisseria meningitidis N1568]
 gi|325133013|gb|EGC55688.1| ribosomal protein L28 [Neisseria meningitidis M6190]
 gi|325134999|gb|EGC57629.1| ribosomal protein L28 [Neisseria meningitidis M13399]
 gi|325136897|gb|EGC59494.1| ribosomal protein L28 [Neisseria meningitidis M0579]
 gi|325139002|gb|EGC61550.1| ribosomal protein L28 [Neisseria meningitidis ES14902]
 gi|325141046|gb|EGC63551.1| ribosomal protein L28 [Neisseria meningitidis CU385]
 gi|325145210|gb|EGC67491.1| ribosomal protein L28 [Neisseria meningitidis M01-240013]
 gi|325198988|gb|ADY94444.1| ribosomal protein L28 [Neisseria meningitidis G2136]
 gi|325199515|gb|ADY94970.1| ribosomal protein L28 [Neisseria meningitidis H44/76]
 gi|325202858|gb|ADY98312.1| ribosomal protein L28 [Neisseria meningitidis M01-240149]
 gi|325203435|gb|ADY98888.1| ribosomal protein L28 [Neisseria meningitidis M01-240355]
 gi|325205399|gb|ADZ00852.1| ribosomal protein L28 [Neisseria meningitidis M04-240196]
 gi|325208851|gb|ADZ04303.1| ribosomal protein L28 [Neisseria meningitidis NZ-05/33]
          Length = 77

 Score = 99.0 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 34/75 (45%), Positives = 50/75 (66%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVC++T K  MSGN VSHANNKT+RRFLPNL       +   +  +LR+S  ALR+++
Sbjct: 1  MARVCKVTGKRPMSGNNVSHANNKTKRRFLPNLQSRRFWVESENRWVRLRVSNAALRTID 60

Query: 61 RQGGLDRFLSNSKKE 75
          + G +D  L++ +  
Sbjct: 61 KVG-IDVVLADLRAR 74


>gi|325267099|ref|ZP_08133768.1| 50S ribosomal protein L28 [Kingella denitrificans ATCC 33394]
 gi|324981452|gb|EGC17095.1| 50S ribosomal protein L28 [Kingella denitrificans ATCC 33394]
          Length = 78

 Score = 99.0 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 32/75 (42%), Positives = 50/75 (66%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M++VC++T K  +SGN VSHANNKT+RRFLPNL       +   +  +LR+S  ALR+++
Sbjct: 1  MAKVCKITGKRPVSGNNVSHANNKTKRRFLPNLQSRRFWVESENRWVRLRVSNAALRTID 60

Query: 61 RQGGLDRFLSNSKKE 75
          + G +D  L++ +  
Sbjct: 61 KNG-IDAVLADLRAR 74


>gi|225457937|ref|XP_002273919.1| PREDICTED: hypothetical protein [Vitis vinifera]
 gi|302142683|emb|CBI19886.3| unnamed protein product [Vitis vinifera]
          Length = 216

 Score = 98.6 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 25/95 (26%), Positives = 50/95 (52%), Gaps = 1/95 (1%)

Query: 2   SRVCELTKKTVMSGNKVSH-ANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
           ++      + +  GN+VS    NKTRR + PN+    L S I+++  +++++  ALR ++
Sbjct: 39  AKRGIYAGRHIQFGNRVSEDGGNKTRRSWKPNVQEKRLFSYILDRHIRVKVTTHALRCID 98

Query: 61  RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEK 95
           + GG+D +L  +    +   M       ++KM E+
Sbjct: 99  KAGGIDEYLLKTPYHKMDTEMGLFWKAKIEKMYEE 133


>gi|297537562|ref|YP_003673331.1| 50S ribosomal protein L28 [Methylotenera sp. 301]
 gi|297256909|gb|ADI28754.1| ribosomal protein L28 [Methylotenera sp. 301]
          Length = 78

 Score = 98.6 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 31/74 (41%), Positives = 47/74 (63%), Gaps = 1/74 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVC +T K  M GN VSHANN+T+RRFLPNL       +   +   +RI+  ALR+++
Sbjct: 1  MARVCMVTGKKPMVGNNVSHANNRTKRRFLPNLQNRKFWVESENRWVSMRITNNALRTID 60

Query: 61 RQGGLDRFLSNSKK 74
          + G +D  L++ + 
Sbjct: 61 KNG-IDAVLADMRA 73


>gi|220933511|ref|YP_002512410.1| ribosomal protein L28 [Thioalkalivibrio sp. HL-EbGR7]
 gi|254801385|sp|B8GUR2|RL28_THISH RecName: Full=50S ribosomal protein L28
 gi|219994821|gb|ACL71423.1| ribosomal protein L28 [Thioalkalivibrio sp. HL-EbGR7]
          Length = 78

 Score = 98.6 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 32/75 (42%), Positives = 49/75 (65%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVC++T K  ++GN VSHA+NKTRRRFLPNL       +   +  +LRIS   LR ++
Sbjct: 1  MARVCQITGKRPVTGNNVSHAHNKTRRRFLPNLHSHRFWVESENRWVRLRISSKGLRIID 60

Query: 61 RQGGLDRFLSNSKKE 75
          ++G +D  L++ +  
Sbjct: 61 KKG-IDAVLADLRAR 74


>gi|261856607|ref|YP_003263890.1| ribosomal protein L28 [Halothiobacillus neapolitanus c2]
 gi|261837076|gb|ACX96843.1| ribosomal protein L28 [Halothiobacillus neapolitanus c2]
          Length = 78

 Score = 98.2 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 34/84 (40%), Positives = 50/84 (59%), Gaps = 6/84 (7%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVC++T K    GN VSHANNKTRRRFLPNL       +   +   LR+S  A+R+++
Sbjct: 1  MARVCQVTGKRPAVGNNVSHANNKTRRRFLPNLHHKRFWVESEGRFVTLRVSTNAIRTID 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTL 84
          + G ++  L+     +L AR   +
Sbjct: 61 KVG-IESVLA-----DLRARGEKV 78


>gi|158929977|gb|ABW82958.1| 50S ribosomal protein L28 [uncultured bacterium pEAF66]
          Length = 78

 Score = 98.2 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 32/75 (42%), Positives = 46/75 (61%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVC++T K  M GN VSHANNKT+RRFLPNL    +  +   +   LR+S   LR ++
Sbjct: 1  MARVCQVTGKGPMVGNNVSHANNKTKRRFLPNLQNRRIFVESENRWVSLRLSNAGLRVID 60

Query: 61 RQGGLDRFLSNSKKE 75
          + G +D  L + +  
Sbjct: 61 KVG-IDAVLVDMRAR 74


>gi|302879482|ref|YP_003848046.1| 50S ribosomal protein L28 [Gallionella capsiferriformans ES-2]
 gi|302582271|gb|ADL56282.1| ribosomal protein L28 [Gallionella capsiferriformans ES-2]
          Length = 78

 Score = 98.2 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 31/75 (41%), Positives = 49/75 (65%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVC++T K  MSGN VSHANN+T+RRFLPNL R     +   +   LR++   LR+++
Sbjct: 1  MARVCQVTGKGPMSGNNVSHANNRTKRRFLPNLQRRRFWVEAENRWVSLRLTNAGLRTID 60

Query: 61 RQGGLDRFLSNSKKE 75
          + G ++  L++ +  
Sbjct: 61 KNG-IESVLADMRAR 74


>gi|294789471|ref|ZP_06754707.1| ribosomal protein L28 [Simonsiella muelleri ATCC 29453]
 gi|294482551|gb|EFG30242.1| ribosomal protein L28 [Simonsiella muelleri ATCC 29453]
          Length = 78

 Score = 98.2 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 33/75 (44%), Positives = 50/75 (66%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M++VC++T K  MSGN VSHANNKT+RRFLPNL       +   +  +LR+S  ALR+++
Sbjct: 1  MAKVCKVTGKRPMSGNNVSHANNKTKRRFLPNLQSRRFWVESENRWVRLRVSNAALRTID 60

Query: 61 RQGGLDRFLSNSKKE 75
          + G +D  L++ +  
Sbjct: 61 KNG-IDVVLADLRAR 74


>gi|171677089|ref|XP_001903496.1| hypothetical protein [Podospora anserina S mat+]
 gi|170936612|emb|CAP61271.1| unnamed protein product [Podospora anserina S mat+]
          Length = 366

 Score = 98.2 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 30/90 (33%), Positives = 46/90 (51%), Gaps = 4/90 (4%)

Query: 11  TVMSGNKVSHAN-NKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFL 69
           T+  GN VS  N  KTRR + PN+ R  L S  +    Q R++   LR++++ GGLD +L
Sbjct: 161 TIRYGNNVSEKNEIKTRRTWRPNVHRKRLFSLSLRTWVQTRLTTRVLRTIDKVGGLDEYL 220

Query: 70  SNSKK---ENLSARMRTLRSQILKKMSEKS 96
              K    + L      LR +I++  + K 
Sbjct: 221 LGIKPNRIKELGPWGWRLRWRIMQTRAVKQ 250


>gi|300310516|ref|YP_003774608.1| 50S ribosomal protein L28 [Herbaspirillum seropedicae SmR1]
 gi|300073301|gb|ADJ62700.1| 50S ribosomal subunit L28 protein [Herbaspirillum seropedicae
          SmR1]
          Length = 78

 Score = 98.2 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 35/84 (41%), Positives = 50/84 (59%), Gaps = 6/84 (7%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVC++T K  M GN VSHANNKT+RRFLPNL    +  +   +   LR+S   LR ++
Sbjct: 1  MARVCQVTGKGPMVGNNVSHANNKTKRRFLPNLQNRRIFVESENRWVSLRLSNAGLRVID 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTL 84
          + G +D  L+     +L AR   +
Sbjct: 61 KIG-IDAVLA-----DLRARGEKV 78


>gi|187925123|ref|YP_001896765.1| 50S ribosomal protein L28 [Burkholderia phytofirmans PsJN]
 gi|226738046|sp|B2T6H7|RL28_BURPP RecName: Full=50S ribosomal protein L28
 gi|187716317|gb|ACD17541.1| ribosomal protein L28 [Burkholderia phytofirmans PsJN]
          Length = 77

 Score = 98.2 bits (244), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 34/75 (45%), Positives = 49/75 (65%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVC++T K  MSGN VSHANNKT+RRFLPNL    +  +   +  +LRIS   LR ++
Sbjct: 1  MARVCQVTGKAPMSGNNVSHANNKTKRRFLPNLQSRRIWVESENRFVRLRISNAGLRLID 60

Query: 61 RQGGLDRFLSNSKKE 75
          + G +D  L++ +  
Sbjct: 61 KNG-IDSVLADLRAR 74


>gi|332977907|gb|EGK14655.1| 50S ribosomal protein L28 [Psychrobacter sp. 1501(2011)]
          Length = 78

 Score = 98.2 bits (244), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 30/75 (40%), Positives = 47/75 (62%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K    GN VSHA N+TRRRFLPNL       +   +  +LR+S   +R ++
Sbjct: 1  MSRVCQVTGKRPQVGNNVSHALNRTRRRFLPNLHNHRFWVESENRFVRLRVSTKGMRIID 60

Query: 61 RQGGLDRFLSNSKKE 75
          + G +D+ L++ + +
Sbjct: 61 KHG-IDKVLADLRAK 74


>gi|255019877|ref|ZP_05291952.1| LSU ribosomal protein L28p [Acidithiobacillus caldus ATCC 51756]
 gi|254970657|gb|EET28144.1| LSU ribosomal protein L28p [Acidithiobacillus caldus ATCC 51756]
          Length = 78

 Score = 97.8 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 32/74 (43%), Positives = 50/74 (67%), Gaps = 1/74 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  M+GN VSHANNKTRRRFLPNL       +  ++  ++R+S   +R+++
Sbjct: 1  MSRVCKITGKKPMAGNNVSHANNKTRRRFLPNLQYHRFWVESEQRWVRMRVSTKGMRTID 60

Query: 61 RQGGLDRFLSNSKK 74
          ++G +D  L+  + 
Sbjct: 61 KKG-IDVVLAELRA 73


>gi|134095643|ref|YP_001100718.1| 50S ribosomal protein L28 [Herminiimonas arsenicoxydans]
 gi|166226581|sp|A4G7W0|RL28_HERAR RecName: Full=50S ribosomal protein L28
 gi|133739546|emb|CAL62597.1| 50S ribosomal subunit protein L28 [Herminiimonas arsenicoxydans]
          Length = 78

 Score = 97.8 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 32/75 (42%), Positives = 46/75 (61%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVC++T K  M GN VSHANNKT+RRFLPNL    +  +   +   LR+S   LR ++
Sbjct: 1  MARVCQVTGKGPMVGNNVSHANNKTKRRFLPNLQNRRIFVESENRWVSLRLSNAGLRVID 60

Query: 61 RQGGLDRFLSNSKKE 75
          + G +D  L + +  
Sbjct: 61 KIG-IDAVLVDMRAR 74


>gi|325982098|ref|YP_004294500.1| 50S ribosomal protein L28 [Nitrosomonas sp. AL212]
 gi|325531617|gb|ADZ26338.1| ribosomal protein L28 [Nitrosomonas sp. AL212]
          Length = 78

 Score = 97.8 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 33/73 (45%), Positives = 48/73 (65%), Gaps = 1/73 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVCE+T K  MSG+ VSHANNKT+RRFLPNL       +   +  +LR++  ALR+++
Sbjct: 1  MARVCEVTGKKPMSGHNVSHANNKTKRRFLPNLQHRKFWVESENRWIKLRLTNAALRTID 60

Query: 61 RQGGLDRFLSNSK 73
          + G +D  L   +
Sbjct: 61 KNG-IDAVLVKMR 72


>gi|74318607|ref|YP_316347.1| 50S ribosomal protein L28 [Thiobacillus denitrificans ATCC 25259]
 gi|123611211|sp|Q3SFR4|RL28_THIDA RecName: Full=50S ribosomal protein L28
 gi|74058102|gb|AAZ98542.1| ribosomal protein L28 [Thiobacillus denitrificans ATCC 25259]
          Length = 78

 Score = 97.8 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 32/75 (42%), Positives = 48/75 (64%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVC +T K  M GN VSHANNKT+RRFLPNL       +   +  +LR+S  ALR+++
Sbjct: 1  MARVCVVTGKKPMVGNNVSHANNKTKRRFLPNLQYRRFWVESENRWVRLRLSNAALRTID 60

Query: 61 RQGGLDRFLSNSKKE 75
          + G ++  L++ +  
Sbjct: 61 KNG-IESVLADLRAR 74


>gi|145589914|ref|YP_001156511.1| ribosomal protein L28 [Polynucleobacter necessarius subsp.
          asymbioticus QLW-P1DMWA-1]
 gi|189029449|sp|A4SZN3|RL28_POLSQ RecName: Full=50S ribosomal protein L28
 gi|145048320|gb|ABP34947.1| LSU ribosomal protein L28P [Polynucleobacter necessarius subsp.
          asymbioticus QLW-P1DMWA-1]
          Length = 77

 Score = 97.8 bits (243), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 31/75 (41%), Positives = 46/75 (61%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M++VC++T K  M GN VSHANNKT+RRFLPNL       +   +   LR++   LR ++
Sbjct: 1  MAKVCQVTGKKPMVGNNVSHANNKTKRRFLPNLQNRRFWVESENRWISLRLTNAGLRVID 60

Query: 61 RQGGLDRFLSNSKKE 75
          + G +D  LS+ +  
Sbjct: 61 KNG-IDAVLSDLRAR 74


>gi|49082438|gb|AAT50619.1| PA5316 [synthetic construct]
          Length = 79

 Score = 97.4 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 29/75 (38%), Positives = 50/75 (66%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  ++GN +SHA+NKTRRRFLPNL       +  ++  +LR+S   +R ++
Sbjct: 1  MSRVCQVTGKGPVTGNNISHAHNKTRRRFLPNLQHHRFWVESEKRFVRLRVSAKGMRIID 60

Query: 61 RQGGLDRFLSNSKKE 75
          ++G ++  L++ +  
Sbjct: 61 KRG-IEAVLADLRAR 74


>gi|70734366|ref|YP_263107.1| 50S ribosomal protein L28 [Pseudomonas fluorescens Pf-5]
 gi|123652040|sp|Q4K3S6|RL28_PSEF5 RecName: Full=50S ribosomal protein L28
 gi|68348665|gb|AAY96271.1| ribosomal protein L28 [Pseudomonas fluorescens Pf-5]
          Length = 78

 Score = 97.4 bits (242), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 31/73 (42%), Positives = 49/73 (67%), Gaps = 1/73 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  ++GN +SHANNKTRRRFLPNL       +  ++  +LR+S   +R ++
Sbjct: 1  MSRVCQVTGKGPVTGNNISHANNKTRRRFLPNLQHHRFWVESEKRFVRLRVSAKGMRIID 60

Query: 61 RQGGLDRFLSNSK 73
          ++G +D  L+  +
Sbjct: 61 KRG-IDVVLAEIR 72


>gi|225682598|gb|EEH20882.1| 50S ribosomal protein L24 [Paracoccidioides brasiliensis Pb03]
 gi|226290013|gb|EEH45497.1| 50S ribosomal protein L24 [Paracoccidioides brasiliensis Pb18]
          Length = 203

 Score = 97.0 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 25/92 (27%), Positives = 50/92 (54%), Gaps = 5/92 (5%)

Query: 9   KKTVMSGNKVSHANNK--TRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLD 66
             T+  GNK+S   NK  TRR + PN+    L S+ +    +L+++   LR++++ GGLD
Sbjct: 73  GSTIQFGNKISKGRNKGKTRRTWKPNVRHEELYSEALGTTLKLKVTHRVLRTIKKVGGLD 132

Query: 67  RFLSN---SKKENLSARMRTLRSQILKKMSEK 95
           ++L     ++ + L      LR ++++  + +
Sbjct: 133 QYLLGDKPARIKELGVFGWKLRWKVMQSKAMR 164


>gi|226946811|ref|YP_002801884.1| 50S ribosomal protein L28 [Azotobacter vinelandii DJ]
 gi|259646727|sp|C1DK04|RL28_AZOVD RecName: Full=50S ribosomal protein L28
 gi|226721738|gb|ACO80909.1| ribosomal protein L28 [Azotobacter vinelandii DJ]
          Length = 78

 Score = 97.0 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 31/75 (41%), Positives = 49/75 (65%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  ++GN +SHANNKTRRRFLPNL       +  ++  +LR+S   +R ++
Sbjct: 1  MSRVCQVTGKGPVTGNNISHANNKTRRRFLPNLQHHRFWVESEKRFVRLRVSAKGMRIID 60

Query: 61 RQGGLDRFLSNSKKE 75
          ++G +D  L+  +  
Sbjct: 61 KRG-IDVVLAELRAR 74


>gi|255646903|gb|ACU23921.1| unknown [Glycine max]
          Length = 235

 Score = 97.0 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 25/95 (26%), Positives = 51/95 (53%), Gaps = 1/95 (1%)

Query: 2   SRVCELTKKTVMSGNKVSH-ANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
           ++      K +  GN+VS    NK+RR + PN+    L S I+++  +++++  ALR ++
Sbjct: 43  AKRGLFAGKHIQFGNRVSEDGGNKSRRTWKPNVQEKRLFSYILDRHVRVKVTTHALRCID 102

Query: 61  RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEK 95
           + GG+D +L  +    +   M  L    ++K+ E+
Sbjct: 103 KAGGIDEYLLKTPYHKMDTEMGILWKAKIEKLYEE 137


>gi|291613167|ref|YP_003523324.1| ribosomal protein L28 [Sideroxydans lithotrophicus ES-1]
 gi|291583279|gb|ADE10937.1| ribosomal protein L28 [Sideroxydans lithotrophicus ES-1]
          Length = 78

 Score = 97.0 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 33/75 (44%), Positives = 48/75 (64%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVC++T K  M GN +SHANNKT+RRFLPNL R  L  +   +   LR++  ALR+++
Sbjct: 1  MARVCQVTGKKPMVGNNISHANNKTKRRFLPNLQRRRLWVESENRWVSLRLTNAALRTID 60

Query: 61 RQGGLDRFLSNSKKE 75
          + G +D  L   +  
Sbjct: 61 KNG-IDAVLFEMRAR 74


>gi|30249436|ref|NP_841506.1| 50S ribosomal protein L28 [Nitrosomonas europaea ATCC 19718]
 gi|67461512|sp|Q82UL8|RL28_NITEU RecName: Full=50S ribosomal protein L28
 gi|30138799|emb|CAD85376.1| Ribosomal protein L28 [Nitrosomonas europaea ATCC 19718]
          Length = 78

 Score = 97.0 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 32/75 (42%), Positives = 50/75 (66%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVC++T K  MSG+ VSHANNKT+RRFLPNL       +   +  +LR++  ALR+V+
Sbjct: 1  MARVCQVTGKRPMSGHNVSHANNKTKRRFLPNLQSRRFWLESENRWIRLRLTNAALRTVD 60

Query: 61 RQGGLDRFLSNSKKE 75
          + G +D  +++ +  
Sbjct: 61 KNG-IDSVVADMRAR 74


>gi|114330794|ref|YP_747016.1| 50S ribosomal protein L28 [Nitrosomonas eutropha C91]
 gi|122314268|sp|Q0AHY1|RL28_NITEC RecName: Full=50S ribosomal protein L28
 gi|114307808|gb|ABI59051.1| LSU ribosomal protein L28P [Nitrosomonas eutropha C91]
          Length = 78

 Score = 97.0 bits (241), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 31/75 (41%), Positives = 50/75 (66%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVC++T K  MSG+ VSHANNKT+RRFLPNL       +   +  +LR++  ALR+++
Sbjct: 1  MARVCQVTGKRPMSGHHVSHANNKTKRRFLPNLQSRRFWLESENRWIRLRLTNAALRTID 60

Query: 61 RQGGLDRFLSNSKKE 75
          + G +D  +++ +  
Sbjct: 61 KNG-IDVVIADMRAR 74


>gi|45198359|ref|NP_985388.1| AFL162Cp [Ashbya gossypii ATCC 10895]
 gi|44984246|gb|AAS53212.1| AFL162Cp [Ashbya gossypii ATCC 10895]
          Length = 261

 Score = 97.0 bits (241), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 24/92 (26%), Positives = 53/92 (57%), Gaps = 3/92 (3%)

Query: 9   KKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRF 68
              +  GN +S +  KTRR +LPN+ R +L S+ +++  +++++   LR++ ++GGLD +
Sbjct: 79  GSFIQFGNNISESKTKTRRTWLPNIVRKSLWSEALQKDVRIKLTAKVLRTISKEGGLDNY 138

Query: 69  LSN---SKKENLSARMRTLRSQILKKMSEKSS 97
           L+    ++ + L  +   LR ++L     + +
Sbjct: 139 LTKDKSARIKELGPKGWELRYRVLVARERQLN 170


>gi|26991958|ref|NP_747383.1| 50S ribosomal protein L28 [Pseudomonas putida KT2440]
 gi|148550392|ref|YP_001270494.1| 50S ribosomal protein L28 [Pseudomonas putida F1]
 gi|167036319|ref|YP_001671550.1| 50S ribosomal protein L28 [Pseudomonas putida GB-1]
 gi|325273179|ref|ZP_08139469.1| 50S ribosomal protein L28 [Pseudomonas sp. TJI-51]
 gi|38258487|sp|Q88C99|RL28_PSEPK RecName: Full=50S ribosomal protein L28
 gi|166226605|sp|A5WB00|RL28_PSEP1 RecName: Full=50S ribosomal protein L28
 gi|189029451|sp|B0KQ85|RL28_PSEPG RecName: Full=50S ribosomal protein L28
 gi|24987087|gb|AAN70847.1|AE016729_5 ribosomal protein L28 [Pseudomonas putida KT2440]
 gi|148514450|gb|ABQ81310.1| LSU ribosomal protein L28P [Pseudomonas putida F1]
 gi|166862807|gb|ABZ01215.1| ribosomal protein L28 [Pseudomonas putida GB-1]
 gi|313501257|gb|ADR62623.1| RpmB [Pseudomonas putida BIRD-1]
 gi|324101686|gb|EGB99242.1| 50S ribosomal protein L28 [Pseudomonas sp. TJI-51]
          Length = 78

 Score = 97.0 bits (241), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 31/73 (42%), Positives = 49/73 (67%), Gaps = 1/73 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  ++GN +SHANNKTRRRFLPNL       +  ++  +LR+S   +R ++
Sbjct: 1  MSRVCQVTGKGPVTGNNISHANNKTRRRFLPNLQHHRFWVESEKRFVRLRVSAKGMRIID 60

Query: 61 RQGGLDRFLSNSK 73
          ++G +D  L + +
Sbjct: 61 KRG-IDAVLVDIR 72


>gi|237747513|ref|ZP_04577993.1| LSU ribosomal protein L28P [Oxalobacter formigenes OXCC13]
 gi|229380956|gb|EEO31047.1| LSU ribosomal protein L28P [Oxalobacter formigenes OXCC13]
          Length = 78

 Score = 97.0 bits (241), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 34/75 (45%), Positives = 48/75 (64%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVC++T K  MSGNKVSHANNKTRRRF+PNL       +   +   LR+S   LR ++
Sbjct: 1  MARVCQITGKKPMSGNKVSHANNKTRRRFMPNLHYRRFFVESENRWVSLRVSNAGLRVID 60

Query: 61 RQGGLDRFLSNSKKE 75
          + G +D  L++ +  
Sbjct: 61 KLG-IDAVLADLRAR 74


>gi|15600509|ref|NP_254003.1| 50S ribosomal protein L28 [Pseudomonas aeruginosa PAO1]
 gi|116053463|ref|YP_793790.1| 50S ribosomal protein L28 [Pseudomonas aeruginosa UCBPP-PA14]
 gi|152989167|ref|YP_001351408.1| 50S ribosomal protein L28 [Pseudomonas aeruginosa PA7]
 gi|218894419|ref|YP_002443289.1| 50S ribosomal protein L28 [Pseudomonas aeruginosa LESB58]
 gi|254237990|ref|ZP_04931313.1| 50S ribosomal protein L28 [Pseudomonas aeruginosa C3719]
 gi|254243798|ref|ZP_04937120.1| 50S ribosomal protein L28 [Pseudomonas aeruginosa 2192]
 gi|296392175|ref|ZP_06881650.1| 50S ribosomal protein L28 [Pseudomonas aeruginosa PAb1]
 gi|313106742|ref|ZP_07792959.1| 50S ribosomal protein L28 [Pseudomonas aeruginosa 39016]
 gi|14195125|sp|Q9HTN8|RL28_PSEAE RecName: Full=50S ribosomal protein L28
 gi|122256516|sp|Q02E46|RL28_PSEAB RecName: Full=50S ribosomal protein L28
 gi|166226603|sp|A6VEC3|RL28_PSEA7 RecName: Full=50S ribosomal protein L28
 gi|226699149|sp|B7V5K7|RL28_PSEA8 RecName: Full=50S ribosomal protein L28
 gi|9951633|gb|AAG08701.1|AE004944_5 50S ribosomal protein L28 [Pseudomonas aeruginosa PAO1]
 gi|115588684|gb|ABJ14699.1| 50S ribosomal protein L28 [Pseudomonas aeruginosa UCBPP-PA14]
 gi|126169921|gb|EAZ55432.1| 50S ribosomal protein L28 [Pseudomonas aeruginosa C3719]
 gi|126197176|gb|EAZ61239.1| 50S ribosomal protein L28 [Pseudomonas aeruginosa 2192]
 gi|150964325|gb|ABR86350.1| ribosomal protein L28 [Pseudomonas aeruginosa PA7]
 gi|218774648|emb|CAW30465.1| 50S ribosomal protein L28 [Pseudomonas aeruginosa LESB58]
 gi|310879461|gb|EFQ38055.1| 50S ribosomal protein L28 [Pseudomonas aeruginosa 39016]
          Length = 78

 Score = 97.0 bits (241), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 29/75 (38%), Positives = 50/75 (66%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  ++GN +SHA+NKTRRRFLPNL       +  ++  +LR+S   +R ++
Sbjct: 1  MSRVCQVTGKGPVTGNNISHAHNKTRRRFLPNLQHHRFWVESEKRFVRLRVSAKGMRIID 60

Query: 61 RQGGLDRFLSNSKKE 75
          ++G ++  L++ +  
Sbjct: 61 KRG-IEAVLADLRAR 74


>gi|313676115|ref|YP_004054111.1| LSU ribosomal protein l28p [Marivirga tractuosa DSM 4126]
 gi|312942813|gb|ADR22003.1| LSU ribosomal protein L28P [Marivirga tractuosa DSM 4126]
          Length = 79

 Score = 96.6 bits (240), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 29/75 (38%), Positives = 46/75 (61%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVC++T K    GN VSH+NNKTRRRFLPNL +        ++   L++S  A+R++ 
Sbjct: 1  MARVCQITGKRPQVGNNVSHSNNKTRRRFLPNLQKKRFYLPEEDKWITLKVSASAIRTIN 60

Query: 61 RQGGLDRFLSNSKKE 75
          + G +   L  +++ 
Sbjct: 61 KNG-ITSVLKKAREN 74


>gi|146280503|ref|YP_001170656.1| 50S ribosomal protein L28 [Pseudomonas stutzeri A1501]
 gi|146309388|ref|YP_001189853.1| 50S ribosomal protein L28 [Pseudomonas mendocina ymp]
 gi|330505618|ref|YP_004382487.1| 50S ribosomal protein L28 [Pseudomonas mendocina NK-01]
 gi|166226604|sp|A4Y0K5|RL28_PSEMY RecName: Full=50S ribosomal protein L28
 gi|166226606|sp|A4VFR3|RL28_PSEU5 RecName: Full=50S ribosomal protein L28
 gi|145568708|gb|ABP77814.1| 50S ribosomal protein L28 [Pseudomonas stutzeri A1501]
 gi|145577589|gb|ABP87121.1| LSU ribosomal protein L28P [Pseudomonas mendocina ymp]
 gi|327478739|gb|AEA82049.1| 50S ribosomal protein L28 [Pseudomonas stutzeri DSM 4166]
 gi|328919904|gb|AEB60735.1| 50S ribosomal protein L28 [Pseudomonas mendocina NK-01]
          Length = 78

 Score = 96.6 bits (240), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 31/75 (41%), Positives = 49/75 (65%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  ++GN +SHANNKTRRRFLPNL       +  ++  +LR+S   +R ++
Sbjct: 1  MSRVCQVTGKGPVTGNNISHANNKTRRRFLPNLQHHRFWVESEKRFVRLRVSAKGMRVID 60

Query: 61 RQGGLDRFLSNSKKE 75
          ++G +D  L+  +  
Sbjct: 61 KRG-IDVVLAELRAR 74


>gi|258543788|ref|ZP_05704022.1| 50S ribosomal protein L28 [Cardiobacterium hominis ATCC 15826]
 gi|258520963|gb|EEV89822.1| 50S ribosomal protein L28 [Cardiobacterium hominis ATCC 15826]
          Length = 78

 Score = 96.6 bits (240), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 28/75 (37%), Positives = 46/75 (61%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR+C++T K  M GN VSHANNK +RRFLPN+       +   +  +L++S   +R ++
Sbjct: 1  MSRICQVTGKKPMVGNTVSHANNKNKRRFLPNIQEHRFWVESENRFVKLKVSTHGMRIID 60

Query: 61 RQGGLDRFLSNSKKE 75
          ++G +D  L+  +  
Sbjct: 61 KRG-IDAVLAEIRAR 74


>gi|224824522|ref|ZP_03697629.1| ribosomal protein L28 [Lutiella nitroferrum 2002]
 gi|224603015|gb|EEG09191.1| ribosomal protein L28 [Lutiella nitroferrum 2002]
          Length = 77

 Score = 96.6 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 31/63 (49%), Positives = 44/63 (69%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVC++T K  M+GN VSHANNKT+RRFLPNL       +   +  +LR+S  ALR+++
Sbjct: 1  MARVCKVTGKRPMTGNNVSHANNKTKRRFLPNLQYRKFWVESENRWVRLRVSNAALRTID 60

Query: 61 RQG 63
          + G
Sbjct: 61 KLG 63


>gi|154295457|ref|XP_001548164.1| hypothetical protein BC1G_13207 [Botryotinia fuckeliana B05.10]
 gi|150844075|gb|EDN19268.1| hypothetical protein BC1G_13207 [Botryotinia fuckeliana B05.10]
          Length = 233

 Score = 96.6 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 27/84 (32%), Positives = 46/84 (54%), Gaps = 4/84 (4%)

Query: 11  TVMSGNKVSHAN-NKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFL 69
            +  GN VS  N  KTRR + PN+ R  L S  + ++ +LR++   LR++++ GGLD +L
Sbjct: 64  KIRYGNIVSEKNEIKTRRHWRPNVQRKRLYSPSLGRQIKLRVTTKVLRTIDKAGGLDEYL 123

Query: 70  S---NSKKENLSARMRTLRSQILK 90
                 + + L      LR +I++
Sbjct: 124 LGEKTQRIKELGMGGWKLRWRIMQ 147


>gi|332526019|ref|ZP_08402157.1| 50S ribosomal protein L28 [Rubrivivax benzoatilyticus JA2]
 gi|332109862|gb|EGJ10490.1| 50S ribosomal protein L28 [Rubrivivax benzoatilyticus JA2]
          Length = 77

 Score = 96.3 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 31/63 (49%), Positives = 42/63 (66%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVC++T K  M GN VSHANNKT+RRFLPNL       +   +  +LR+S  ALR ++
Sbjct: 1  MARVCQVTGKRPMVGNNVSHANNKTKRRFLPNLQYRRFWMESENRWVRLRVSNAALRLID 60

Query: 61 RQG 63
          + G
Sbjct: 61 KVG 63


>gi|325191225|emb|CCA26012.1| conserved hypothetical protein [Albugo laibachii Nc14]
          Length = 140

 Score = 96.3 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 23/95 (24%), Positives = 47/95 (49%), Gaps = 1/95 (1%)

Query: 2   SRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVER 61
           +R      +    GN VSH+  +TRR +  N     L S+ +++   L ++   LR +++
Sbjct: 30  ARRGLFAGRDKGFGNNVSHSKRRTRRSWKVNHQWKHLYSEALDEMIGLNVTTHTLRCIDK 89

Query: 62  QGGLDRFLSNSKKE-NLSARMRTLRSQILKKMSEK 95
            GGLD +L +   E  L  +    +++I++ +  +
Sbjct: 90  IGGLDNYLQSISDEQELGVKGLKAKNRIVEALKAQ 124


>gi|311696213|gb|ADP99086.1| ribosomal protein L28 [marine bacterium HP15]
          Length = 78

 Score = 96.3 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 31/75 (41%), Positives = 48/75 (64%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  +SGN VSHA N TRRRFLPNL       +  ++  +LR+S   +R ++
Sbjct: 1  MSRVCQVTGKRPVSGNNVSHAMNHTRRRFLPNLQNHRFWVESEKRFVKLRVSTKGMRIID 60

Query: 61 RQGGLDRFLSNSKKE 75
          ++G +D  L++ +  
Sbjct: 61 KKG-IDAVLADLRAR 74


>gi|255573228|ref|XP_002527543.1| 60S ribosomal protein L24, mitochondrial precursor, putative
           [Ricinus communis]
 gi|223533093|gb|EEF34852.1| 60S ribosomal protein L24, mitochondrial precursor, putative
           [Ricinus communis]
          Length = 211

 Score = 96.3 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 25/94 (26%), Positives = 50/94 (53%), Gaps = 1/94 (1%)

Query: 2   SRVCELTKKTVMSGNKVSH-ANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
           ++      + +  GN+VS    NKTRR + PN+    L S I+++  Q++++  ALR ++
Sbjct: 43  AKRGIFAGRHIQFGNRVSEDGGNKTRRTWKPNVQEKRLFSYILDRHIQVKVTTHALRCID 102

Query: 61  RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSE 94
           + GG+D +L  +  + +   M       ++K+ E
Sbjct: 103 KAGGIDEYLLKTPYQKMDTDMGLFWKAKIEKLYE 136


>gi|300123327|emb|CBK24600.2| unnamed protein product [Blastocystis hominis]
          Length = 115

 Score = 96.3 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 32/83 (38%), Positives = 52/83 (62%), Gaps = 1/83 (1%)

Query: 13  MSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFLSNS 72
           + GN VSH+  KTRR + PN+  + L S+ +++K  LR++   LR +++ GGLD ++ N+
Sbjct: 27  LFGNNVSHSERKTRRDWNPNVRHVHLYSETLDRKIGLRVTSNTLRCIDKAGGLDYYVLNT 86

Query: 73  KKENL-SARMRTLRSQILKKMSE 94
           K ++L S     LR +IL K  E
Sbjct: 87  KDKDLNSDVALRLREEILAKQRE 109


>gi|298715840|emb|CBJ28305.1| conserved unknown protein [Ectocarpus siliculosus]
          Length = 154

 Score = 96.3 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 25/88 (28%), Positives = 50/88 (56%), Gaps = 1/88 (1%)

Query: 9   KKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRF 68
            K +  GN +S ++ K RR + PN+ +  L S+ +++  +  ++  ALR V+R GG+DR+
Sbjct: 38  GKDIGFGNTISFSHKKNRRTWKPNVQKKALYSETLDEWIKFSLTTHALRCVDRAGGIDRY 97

Query: 69  LSNSKKENL-SARMRTLRSQILKKMSEK 95
           L  +  E L S +    + +I + ++ +
Sbjct: 98  LLKTPDEWLNSVQGSKAKRKIEEALAAR 125


>gi|58584560|ref|YP_198133.1| 50S ribosomal protein L28 [Wolbachia endosymbiont strain TRS of
          Brugia malayi]
 gi|67461241|sp|Q5GSY3|RL28_WOLTR RecName: Full=50S ribosomal protein L28
 gi|58418876|gb|AAW70891.1| Ribosomal protein L28 [Wolbachia endosymbiont strain TRS of
          Brugia malayi]
          Length = 104

 Score = 96.3 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 39/95 (41%), Positives = 66/95 (69%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVCELT +    GNKVSH+N K +R FL NL  +TLIS+I+ +K++ R++   LR+++
Sbjct: 1  MSRVCELTNRKKSFGNKVSHSNRKAKRIFLLNLHNVTLISNILNKKFKFRVAIRTLRTID 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEK 95
           +G LD FL N++   LS + + ++ ++ K ++++
Sbjct: 61 YKGNLDAFLLNTRTVKLSKKAQKIKRKLKKVLAKQ 95


>gi|320594142|gb|EFX06545.1| 50S ribosomal protein l24 [Grosmannia clavigera kw1407]
          Length = 268

 Score = 96.3 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 26/93 (27%), Positives = 43/93 (46%), Gaps = 8/93 (8%)

Query: 11  TVMSGNKVSHAN-----NKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGL 65
            +  GN VS         K RR++ PN+    L S  +    + RIS   LR+V++ GGL
Sbjct: 100 RIRFGNTVSRQTEIINPQKNRRKWRPNIQEKRLWSASLSAPIRTRISTRVLRTVDKVGGL 159

Query: 66  DRFLSN---SKKENLSARMRTLRSQILKKMSEK 95
           D +L     ++   L      LR +I++  + +
Sbjct: 160 DEYLLGSKPARIAELGPWGWRLRWRIIQTPAVQ 192


>gi|295669208|ref|XP_002795152.1| 50S ribosomal protein L24 [Paracoccidioides brasiliensis Pb01]
 gi|226285086|gb|EEH40652.1| 50S ribosomal protein L24 [Paracoccidioides brasiliensis Pb01]
          Length = 199

 Score = 96.3 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 25/92 (27%), Positives = 50/92 (54%), Gaps = 5/92 (5%)

Query: 9   KKTVMSGNKVSHANNK--TRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLD 66
             T+  GNK+S   NK  TRR + PN+    L S+ +    +L+++   LR++++ GGLD
Sbjct: 73  GSTIQFGNKISKGRNKGKTRRTWKPNVRHEELYSEALGTTLKLKVTHRVLRTIKKVGGLD 132

Query: 67  RFLSN---SKKENLSARMRTLRSQILKKMSEK 95
           ++L     ++ + L      LR ++++  + +
Sbjct: 133 QYLLGDKPARIKELGVFGWKLRWKVMQSRAMR 164


>gi|190576385|ref|YP_001974230.1| 50S ribosomal protein L28 [Stenotrophomonas maltophilia K279a]
 gi|194367723|ref|YP_002030333.1| 50S ribosomal protein L28 [Stenotrophomonas maltophilia R551-3]
 gi|226699168|sp|B4SNN0|RL28_STRM5 RecName: Full=50S ribosomal protein L28
 gi|226699169|sp|B2FNE3|RL28_STRMK RecName: Full=50S ribosomal protein L28
 gi|190014307|emb|CAQ47954.1| putative 50S ribosomal protein L28 [Stenotrophomonas maltophilia
          K279a]
 gi|194350527|gb|ACF53650.1| ribosomal protein L28 [Stenotrophomonas maltophilia R551-3]
          Length = 78

 Score = 96.3 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 34/75 (45%), Positives = 48/75 (64%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC+++ K V +GN VSHANNKTRRRFLPNL           +  +LR+S  ALR+++
Sbjct: 1  MSRVCQVSGKRVQTGNNVSHANNKTRRRFLPNLHERRFWVASENRWVKLRVSAHALRTID 60

Query: 61 RQGGLDRFLSNSKKE 75
          + G +D  L+  +  
Sbjct: 61 KNG-IDSVLAELRAR 74


>gi|21233456|ref|NP_639373.1| 50S ribosomal protein L28 [Xanthomonas campestris pv. campestris
          str. ATCC 33913]
 gi|21244876|ref|NP_644458.1| 50S ribosomal protein L28 [Xanthomonas axonopodis pv. citri str.
          306]
 gi|66770420|ref|YP_245182.1| 50S ribosomal protein L28 [Xanthomonas campestris pv. campestris
          str. 8004]
 gi|78049813|ref|YP_365988.1| 50S ribosomal protein L28 [Xanthomonas campestris pv. vesicatoria
          str. 85-10]
 gi|84625952|ref|YP_453324.1| 50S ribosomal protein L28 [Xanthomonas oryzae pv. oryzae MAFF
          311018]
 gi|166710250|ref|ZP_02241457.1| 50S ribosomal protein L28 [Xanthomonas oryzae pv. oryzicola
          BLS256]
 gi|188993625|ref|YP_001905635.1| 50S ribosomal protein L28 [Xanthomonas campestris pv. campestris
          str. B100]
 gi|289666100|ref|ZP_06487681.1| 50S ribosomal protein L28 [Xanthomonas campestris pv. vasculorum
          NCPPB702]
 gi|289670773|ref|ZP_06491848.1| 50S ribosomal protein L28 [Xanthomonas campestris pv. musacearum
          NCPPB4381]
 gi|325916749|ref|ZP_08179003.1| LSU ribosomal protein L28P [Xanthomonas vesicatoria ATCC 35937]
 gi|325925992|ref|ZP_08187358.1| 50S ribosomal protein L28 [Xanthomonas perforans 91-118]
 gi|54039155|sp|P66161|RL28_XANCP RecName: Full=50S ribosomal protein L28
 gi|54041854|sp|P66160|RL28_XANAC RecName: Full=50S ribosomal protein L28
 gi|81303633|sp|Q4UP61|RL28_XANC8 RecName: Full=50S ribosomal protein L28
 gi|123520476|sp|Q2NXC7|RL28_XANOM RecName: Full=50S ribosomal protein L28
 gi|123583817|sp|Q3BMM5|RL28_XANC5 RecName: Full=50S ribosomal protein L28
 gi|226699184|sp|B0RYR3|RL28_XANCB RecName: Full=50S ribosomal protein L28
 gi|21110585|gb|AAM38994.1| 50S ribosomal protein L28 [Xanthomonas axonopodis pv. citri str.
          306]
 gi|21115302|gb|AAM43255.1| 50S ribosomal protein L28 [Xanthomonas campestris pv. campestris
          str. ATCC 33913]
 gi|66575752|gb|AAY51162.1| 50S ribosomal protein L28 [Xanthomonas campestris pv. campestris
          str. 8004]
 gi|78038243|emb|CAJ25988.1| 50S ribosomal protein L28 [Xanthomonas campestris pv. vesicatoria
          str. 85-10]
 gi|84369892|dbj|BAE71050.1| 50S ribosomal protein L28 [Xanthomonas oryzae pv. oryzae MAFF
          311018]
 gi|167735385|emb|CAP53599.1| 50S ribosomal protein L28 [Xanthomonas campestris pv. campestris]
 gi|325537003|gb|EGD08745.1| LSU ribosomal protein L28P [Xanthomonas vesicatoria ATCC 35937]
 gi|325543588|gb|EGD15005.1| 50S ribosomal protein L28 [Xanthomonas perforans 91-118]
          Length = 78

 Score = 95.9 bits (238), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 36/84 (42%), Positives = 51/84 (60%), Gaps = 6/84 (7%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC+++ K V +GN VSHANN+TRRRFLPNL           +  +LR+S  ALR+++
Sbjct: 1  MSRVCQVSGKRVQTGNNVSHANNRTRRRFLPNLHERRFWVASENRWVKLRVSAHALRTID 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTL 84
          + G +D  L     + L AR   +
Sbjct: 61 KNG-IDAVL-----KELRARGEKV 78


>gi|289209156|ref|YP_003461222.1| ribosomal protein L28 [Thioalkalivibrio sp. K90mix]
 gi|288944787|gb|ADC72486.1| ribosomal protein L28 [Thioalkalivibrio sp. K90mix]
          Length = 78

 Score = 95.9 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 29/75 (38%), Positives = 46/75 (61%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVC++T K   +GN VSHA+ KTRRRFLPNL       +   +  +LR+S   +R ++
Sbjct: 1  MARVCQVTGKRPATGNNVSHAHRKTRRRFLPNLHTHRFWVESENRFVRLRVSSKGMRIID 60

Query: 61 RQGGLDRFLSNSKKE 75
          + G +D  L++ +  
Sbjct: 61 KLG-IDAVLADCRAR 74


>gi|120556470|ref|YP_960821.1| 50S ribosomal protein L28 [Marinobacter aquaeolei VT8]
 gi|166226587|sp|A1U6L5|RL28_MARAV RecName: Full=50S ribosomal protein L28
 gi|120326319|gb|ABM20634.1| LSU ribosomal protein L28P [Marinobacter aquaeolei VT8]
          Length = 78

 Score = 95.9 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 30/75 (40%), Positives = 48/75 (64%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  ++GN VSHA N TRRRFLPNL       +  ++  +LR+S   +R ++
Sbjct: 1  MSRVCQVTGKRPVTGNNVSHAMNHTRRRFLPNLQNHRFWVESEKRFVKLRVSTKGMRIID 60

Query: 61 RQGGLDRFLSNSKKE 75
          ++G +D  L++ +  
Sbjct: 61 KKG-IDAVLADLRAR 74


>gi|229593346|ref|YP_002875465.1| 50S ribosomal protein L28 [Pseudomonas fluorescens SBW25]
 gi|312963848|ref|ZP_07778319.1| 50S ribosomal protein L28 [Pseudomonas fluorescens WH6]
 gi|259646747|sp|C3K469|RL28_PSEFS RecName: Full=50S ribosomal protein L28
 gi|229365212|emb|CAY53501.1| 50S ribosomal protein L28 [Pseudomonas fluorescens SBW25]
 gi|311281883|gb|EFQ60493.1| 50S ribosomal protein L28 [Pseudomonas fluorescens WH6]
          Length = 77

 Score = 95.9 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 29/63 (46%), Positives = 44/63 (69%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  ++GN +SHANNKTRRRFLPNL       +  ++  +LR+S   +R ++
Sbjct: 1  MSRVCQVTGKGPVTGNNISHANNKTRRRFLPNLQHHRFWVEEEKRFVRLRVSAKGMRIID 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KRG 63


>gi|288939948|ref|YP_003442188.1| 50S ribosomal protein L28 [Allochromatium vinosum DSM 180]
 gi|288895320|gb|ADC61156.1| ribosomal protein L28 [Allochromatium vinosum DSM 180]
          Length = 78

 Score = 95.9 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 30/75 (40%), Positives = 52/75 (69%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS+VC++T K  ++GN VSHANNKT+RRFLPNL       +  ++  +LR++  A+R+++
Sbjct: 1  MSKVCQVTGKRPLTGNNVSHANNKTKRRFLPNLHEKRFWVEAEKRWVKLRLTTKAMRTID 60

Query: 61 RQGGLDRFLSNSKKE 75
          ++G +D  L + + +
Sbjct: 61 KKG-IDAVLVDLRAD 74


>gi|257454608|ref|ZP_05619864.1| ribosomal protein L28 [Enhydrobacter aerosaccus SK60]
 gi|257447918|gb|EEV22905.1| ribosomal protein L28 [Enhydrobacter aerosaccus SK60]
          Length = 78

 Score = 95.9 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 31/75 (41%), Positives = 47/75 (62%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K    GN VSHANNKTRRRFLPNL       +   +  +LR++   +R ++
Sbjct: 1  MSRVCQVTGKRPAVGNNVSHANNKTRRRFLPNLHTHRFWVESENRFVKLRLTTKGMRIID 60

Query: 61 RQGGLDRFLSNSKKE 75
          + G +D+ L++ +  
Sbjct: 61 KVG-IDQVLTDMRAR 74


>gi|296112807|ref|YP_003626745.1| 50S ribosomal protein L28 [Moraxella catarrhalis RH4]
 gi|295920501|gb|ADG60852.1| 50S ribosomal protein L28 [Moraxella catarrhalis RH4]
 gi|326561053|gb|EGE11418.1| 50S ribosomal protein L28 [Moraxella catarrhalis 7169]
 gi|326561481|gb|EGE11825.1| 50S ribosomal protein L28 [Moraxella catarrhalis 46P47B1]
 gi|326564428|gb|EGE14656.1| 50S ribosomal protein L28 [Moraxella catarrhalis 12P80B1]
 gi|326566725|gb|EGE16864.1| 50S ribosomal protein L28 [Moraxella catarrhalis 103P14B1]
 gi|326567513|gb|EGE17628.1| 50S ribosomal protein L28 [Moraxella catarrhalis BC1]
 gi|326569359|gb|EGE19419.1| 50S ribosomal protein L28 [Moraxella catarrhalis BC8]
 gi|326571442|gb|EGE21457.1| 50S ribosomal protein L28 [Moraxella catarrhalis BC7]
 gi|326575275|gb|EGE25203.1| 50S ribosomal protein L28 [Moraxella catarrhalis CO72]
 gi|326576638|gb|EGE26545.1| 50S ribosomal protein L28 [Moraxella catarrhalis 101P30B1]
 gi|326577494|gb|EGE27374.1| 50S ribosomal protein L28 [Moraxella catarrhalis O35E]
          Length = 78

 Score = 95.5 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 32/84 (38%), Positives = 52/84 (61%), Gaps = 6/84 (7%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  + GN VSHA+NKTRRRFLPNL       +   +  +LR+S   +R ++
Sbjct: 1  MSRVCQVTGKRPLVGNNVSHAHNKTRRRFLPNLHNHRFWVESENRFVRLRVSSKGMRIID 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTL 84
          + G +++ L+     +L A+ + +
Sbjct: 61 KHG-IEKVLA-----DLRAQGQKI 78


>gi|15837808|ref|NP_298496.1| 50S ribosomal protein L28 [Xylella fastidiosa 9a5c]
 gi|28198400|ref|NP_778714.1| 50S ribosomal protein L28 [Xylella fastidiosa Temecula1]
 gi|71276524|ref|ZP_00652799.1| Ribosomal protein L28 [Xylella fastidiosa Dixon]
 gi|71900735|ref|ZP_00682857.1| Ribosomal protein L28 [Xylella fastidiosa Ann-1]
 gi|71901114|ref|ZP_00683221.1| Ribosomal protein L28 [Xylella fastidiosa Ann-1]
 gi|170729748|ref|YP_001775181.1| 50S ribosomal protein L28 [Xylella fastidiosa M12]
 gi|182681042|ref|YP_001829202.1| 50S ribosomal protein L28 [Xylella fastidiosa M23]
 gi|54039156|sp|P66163|RL28_XYLFT RecName: Full=50S ribosomal protein L28
 gi|54041855|sp|P66162|RL28_XYLFA RecName: Full=50S ribosomal protein L28
 gi|226699186|sp|B2I8L7|RL28_XYLF2 RecName: Full=50S ribosomal protein L28
 gi|226699187|sp|B0U5P7|RL28_XYLFM RecName: Full=50S ribosomal protein L28
 gi|9106178|gb|AAF84016.1|AE003954_13 50S ribosomal protein L28 [Xylella fastidiosa 9a5c]
 gi|28056470|gb|AAO28363.1| 50S ribosomal protein L28 [Xylella fastidiosa Temecula1]
 gi|71162701|gb|EAO12428.1| Ribosomal protein L28 [Xylella fastidiosa Dixon]
 gi|71729119|gb|EAO31243.1| Ribosomal protein L28 [Xylella fastidiosa Ann-1]
 gi|71729505|gb|EAO31614.1| Ribosomal protein L28 [Xylella fastidiosa Ann-1]
 gi|167964541|gb|ACA11551.1| 50S ribosomal protein L28 [Xylella fastidiosa M12]
 gi|182631152|gb|ACB91928.1| ribosomal protein L28 [Xylella fastidiosa M23]
 gi|307579510|gb|ADN63479.1| 50S ribosomal protein L28 [Xylella fastidiosa subsp. fastidiosa
          GB514]
          Length = 78

 Score = 95.5 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 35/75 (46%), Positives = 50/75 (66%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K V +GN VSHANNKTRRRFLPNL +         +  +LR+S CA+R+++
Sbjct: 1  MSRVCQVTGKRVQTGNNVSHANNKTRRRFLPNLHKRRFWVASENRWVKLRVSTCAVRTID 60

Query: 61 RQGGLDRFLSNSKKE 75
          + G +D  L+  +  
Sbjct: 61 KNG-IDAVLAELRAS 74


>gi|82703258|ref|YP_412824.1| ribosomal protein L28 [Nitrosospira multiformis ATCC 25196]
 gi|123544108|sp|Q2Y739|RL28_NITMU RecName: Full=50S ribosomal protein L28
 gi|82411323|gb|ABB75432.1| LSU ribosomal protein L28P [Nitrosospira multiformis ATCC 25196]
          Length = 78

 Score = 95.5 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 34/76 (44%), Positives = 49/76 (64%), Gaps = 1/76 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVCE+T K  M+G+ VSHANNKT+RRFLPNL R     +   +   LR+S  ALR+++
Sbjct: 1  MARVCEVTGKKPMTGHHVSHANNKTKRRFLPNLQRRRFWVESERRWISLRLSNEALRTID 60

Query: 61 RQGGLDRFLSNSKKEN 76
          + G +D  L+  +   
Sbjct: 61 KNG-IDAVLAEMRARR 75


>gi|325922641|ref|ZP_08184388.1| LSU ribosomal protein L28P [Xanthomonas gardneri ATCC 19865]
 gi|325923804|ref|ZP_08185419.1| LSU ribosomal protein L28P [Xanthomonas gardneri ATCC 19865]
 gi|325924285|ref|ZP_08185832.1| LSU ribosomal protein L28P [Xanthomonas gardneri ATCC 19865]
 gi|325545234|gb|EGD16541.1| LSU ribosomal protein L28P [Xanthomonas gardneri ATCC 19865]
 gi|325545737|gb|EGD16976.1| LSU ribosomal protein L28P [Xanthomonas gardneri ATCC 19865]
 gi|325546876|gb|EGD17983.1| LSU ribosomal protein L28P [Xanthomonas gardneri ATCC 19865]
          Length = 78

 Score = 95.5 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 36/84 (42%), Positives = 52/84 (61%), Gaps = 6/84 (7%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC+++ K+V +GN VSHANN+TRRRFLPNL           +  +LR+S  ALR+++
Sbjct: 1  MSRVCQVSGKSVQTGNNVSHANNRTRRRFLPNLHERRFWVASENRWVKLRVSAHALRTID 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTL 84
          + G +D  L     + L AR   +
Sbjct: 61 KNG-IDVVL-----KELRARGEKV 78


>gi|28867329|ref|NP_789948.1| 50S ribosomal protein L28 [Pseudomonas syringae pv. tomato str.
          DC3000]
 gi|66043494|ref|YP_233335.1| 50S ribosomal protein L28 [Pseudomonas syringae pv. syringae
          B728a]
 gi|71736327|ref|YP_272517.1| 50S ribosomal protein L28 [Pseudomonas syringae pv. phaseolicola
          1448A]
 gi|213970683|ref|ZP_03398808.1| 50S ribosomal protein L28 [Pseudomonas syringae pv. tomato T1]
 gi|237797775|ref|ZP_04586236.1| 50S ribosomal protein L28 [Pseudomonas syringae pv. oryzae str.
          1_6]
 gi|257481768|ref|ZP_05635809.1| 50S ribosomal protein L28 [Pseudomonas syringae pv. tabaci ATCC
          11528]
 gi|289625762|ref|ZP_06458716.1| 50S ribosomal protein L28 [Pseudomonas syringae pv. aesculi str.
          NCPPB3681]
 gi|289646361|ref|ZP_06477704.1| 50S ribosomal protein L28 [Pseudomonas syringae pv. aesculi str.
          2250]
 gi|289674416|ref|ZP_06495306.1| 50S ribosomal protein L28 [Pseudomonas syringae pv. syringae FF5]
 gi|298484833|ref|ZP_07002933.1| LSU ribosomal protein L28p [Pseudomonas savastanoi pv. savastanoi
          NCPPB 3335]
 gi|38258485|sp|Q88BC8|RL28_PSESM RecName: Full=50S ribosomal protein L28
 gi|75503899|sp|Q4ZZX5|RL28_PSEU2 RecName: Full=50S ribosomal protein L28
 gi|123638796|sp|Q48Q02|RL28_PSE14 RecName: Full=50S ribosomal protein L28
 gi|28850563|gb|AAO53643.1| ribosomal protein L28 [Pseudomonas syringae pv. tomato str.
          DC3000]
 gi|63254201|gb|AAY35297.1| Ribosomal protein L28 [Pseudomonas syringae pv. syringae B728a]
 gi|71556880|gb|AAZ36091.1| ribosomal protein L28 [Pseudomonas syringae pv. phaseolicola
          1448A]
 gi|213924517|gb|EEB58087.1| 50S ribosomal protein L28 [Pseudomonas syringae pv. tomato T1]
 gi|298160687|gb|EFI01708.1| LSU ribosomal protein L28p [Pseudomonas savastanoi pv. savastanoi
          NCPPB 3335]
 gi|330866538|gb|EGH01247.1| 50S ribosomal protein L28 [Pseudomonas syringae pv. aesculi str.
          0893_23]
 gi|330876488|gb|EGH10637.1| 50S ribosomal protein L28 [Pseudomonas syringae pv. morsprunorum
          str. M302280PT]
 gi|330895711|gb|EGH28001.1| 50S ribosomal protein L28 [Pseudomonas syringae pv. japonica str.
          M301072PT]
 gi|330941091|gb|EGH43993.1| 50S ribosomal protein L28 [Pseudomonas syringae pv. pisi str.
          1704B]
 gi|330952114|gb|EGH52374.1| 50S ribosomal protein L28 [Pseudomonas syringae Cit 7]
 gi|330957301|gb|EGH57561.1| 50S ribosomal protein L28 [Pseudomonas syringae pv. maculicola
          str. ES4326]
 gi|330964263|gb|EGH64523.1| 50S ribosomal protein L28 [Pseudomonas syringae pv. actinidiae
          str. M302091]
 gi|330972195|gb|EGH72261.1| 50S ribosomal protein L28 [Pseudomonas syringae pv. aceris str.
          M302273PT]
 gi|330977332|gb|EGH77285.1| 50S ribosomal protein L28 [Pseudomonas syringae pv. aptata str.
          DSM 50252]
 gi|330986858|gb|EGH84961.1| 50S ribosomal protein L28 [Pseudomonas syringae pv. lachrymans
          str. M301315]
 gi|331009402|gb|EGH89458.1| 50S ribosomal protein L28 [Pseudomonas syringae pv. tabaci ATCC
          11528]
 gi|331020625|gb|EGI00682.1| 50S ribosomal protein L28 [Pseudomonas syringae pv. oryzae str.
          1_6]
          Length = 77

 Score = 95.1 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 29/63 (46%), Positives = 44/63 (69%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  ++GN +SHANNKTRRRFLPNL       +  ++  +LR+S   +R ++
Sbjct: 1  MSRVCQVTGKGPVTGNNISHANNKTRRRFLPNLQHHRFWVEGEKRFVRLRVSAKGMRIID 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KRG 63


>gi|149376402|ref|ZP_01894164.1| 50S ribosomal protein L28 [Marinobacter algicola DG893]
 gi|149359243|gb|EDM47705.1| 50S ribosomal protein L28 [Marinobacter algicola DG893]
          Length = 78

 Score = 95.1 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 29/75 (38%), Positives = 48/75 (64%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  ++GN VSHA N +RRRFLPNL       +  ++  +LR+S   +R ++
Sbjct: 1  MSRVCQVTGKRPVTGNNVSHAMNHSRRRFLPNLQNHRFWVESEKRFVRLRVSTKGMRVID 60

Query: 61 RQGGLDRFLSNSKKE 75
          ++G +D  L++ +  
Sbjct: 61 KKG-IDAVLADLRAR 74


>gi|330873141|gb|EGH07290.1| 50S ribosomal protein L28 [Pseudomonas syringae pv. glycinea str.
          race 4]
          Length = 77

 Score = 95.1 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 29/63 (46%), Positives = 44/63 (69%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  ++GN +SHANNKTRRRFLPNL       +  ++  +LR+S   +R ++
Sbjct: 1  MSRVCQVTGKGPVTGNNISHANNKTRRRFLPNLQHHRFWVEGEKRFVRLRVSAKGMRIID 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KRG 63


>gi|292490694|ref|YP_003526133.1| ribosomal protein L28 [Nitrosococcus halophilus Nc4]
 gi|291579289|gb|ADE13746.1| ribosomal protein L28 [Nitrosococcus halophilus Nc4]
          Length = 78

 Score = 95.1 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 31/75 (41%), Positives = 51/75 (68%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  +SGN VSHA+NKT+RRFLPNL       +  ++  +L++S   LR ++
Sbjct: 1  MSRVCQVTGKRPVSGNNVSHAHNKTKRRFLPNLHTHRFWVESEKRWVKLKVSSKGLRIID 60

Query: 61 RQGGLDRFLSNSKKE 75
          ++G +D+ L++ +  
Sbjct: 61 KRG-IDQVLADLRTR 74


>gi|304310174|ref|YP_003809772.1| 50S ribosomal protein L28 [gamma proteobacterium HdN1]
 gi|301795907|emb|CBL44108.1| 50S ribosomal protein L28 [gamma proteobacterium HdN1]
          Length = 78

 Score = 95.1 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 31/84 (36%), Positives = 51/84 (60%), Gaps = 6/84 (7%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M++VC++T K  ++GN VSHAN KTRRRF PNL    +  +  ++  +LR+S   LR ++
Sbjct: 1  MAKVCQVTGKRPITGNNVSHANRKTRRRFEPNLHHHRIWVESEKRFVRLRVSNHGLRIID 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTL 84
          + G +D+ L+     +L  R   +
Sbjct: 61 KVG-IDQVLA-----DLRVRGEKV 78


>gi|311745778|ref|ZP_07719563.1| ribosomal protein L28 [Algoriphagus sp. PR1]
 gi|126575977|gb|EAZ80255.1| ribosomal protein L28 [Algoriphagus sp. PR1]
          Length = 80

 Score = 95.1 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 27/77 (35%), Positives = 46/77 (59%), Gaps = 1/77 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M++VC++T K    GN VSHANNKT+RRF PNL + T      +    L++   AL+++ 
Sbjct: 1  MAKVCDITGKRPRVGNNVSHANNKTKRRFYPNLHKKTFYVPEEDAWITLKVCTKALKTIN 60

Query: 61 RQGGLDRFLSNSKKENL 77
          ++G +   L  +++  +
Sbjct: 61 KKG-ISAVLKEAEESGM 76


>gi|285016930|ref|YP_003374641.1| 50s ribosomal subunit protein l28 [Xanthomonas albilineans GPE
          PC73]
 gi|283472148|emb|CBA14655.1| probable 50s ribosomal subunit protein l28 [Xanthomonas
          albilineans]
          Length = 78

 Score = 95.1 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 33/75 (44%), Positives = 48/75 (64%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC+++ K V +GN VSHANNKTRRRFLPNL           +  +L++S  ALR+++
Sbjct: 1  MSRVCQVSGKRVQTGNNVSHANNKTRRRFLPNLHERRFWVASENRWVKLKVSAHALRTID 60

Query: 61 RQGGLDRFLSNSKKE 75
          + G +D  L+  +  
Sbjct: 61 KNG-IDTVLAELRAR 74


>gi|50307287|ref|XP_453622.1| hypothetical protein [Kluyveromyces lactis NRRL Y-1140]
 gi|49642756|emb|CAH00718.1| KLLA0D12562p [Kluyveromyces lactis]
          Length = 255

 Score = 95.1 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 22/89 (24%), Positives = 50/89 (56%), Gaps = 3/89 (3%)

Query: 12  VMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFLSN 71
           +  GN ++ +  KTRR + PN+ R  L S+ + +K  ++++   LR++ ++GG+D +L+ 
Sbjct: 76  IQFGNNIAESKTKTRRSWSPNVIRKGLWSETLNRKISIKMTAKVLRTITKEGGIDNYLTK 135

Query: 72  ---SKKENLSARMRTLRSQILKKMSEKSS 97
              ++ + L      LR ++L    + ++
Sbjct: 136 EKAARIKELGPTGWKLRYRLLNSKEKAAN 164


>gi|77461758|ref|YP_351265.1| 50S ribosomal protein L28 [Pseudomonas fluorescens Pf0-1]
 gi|123602799|sp|Q3K4N0|RL28_PSEPF RecName: Full=50S ribosomal protein L28
 gi|77385761|gb|ABA77274.1| 50S ribosomal protein L28 [Pseudomonas fluorescens Pf0-1]
          Length = 77

 Score = 95.1 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 29/63 (46%), Positives = 44/63 (69%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  ++GN +SHANNKTRRRFLPNL       +  ++  +LR+S   +R ++
Sbjct: 1  MSRVCQVTGKGPVTGNNISHANNKTRRRFLPNLQHHRFWVEEEKRFVRLRVSAKGMRIID 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KRG 63


>gi|145518488|ref|XP_001445116.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 gi|124412560|emb|CAK77719.1| unnamed protein product [Paramecium tetraurelia]
          Length = 289

 Score = 95.1 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 27/97 (27%), Positives = 53/97 (54%), Gaps = 1/97 (1%)

Query: 1   MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
           MS+ C    K   SGN+   +  KTRR ++PN+ + T  S I+ +K  ++++   ++ + 
Sbjct: 58  MSQFCLWHGKQPKSGNQTCFSEKKTRRSWMPNVQKQTYESLILGRKIHVKVTTKTMKCIR 117

Query: 61  RQGGLDRFLSNSKKENL-SARMRTLRSQILKKMSEKS 96
           + G  D ++  +K ++L S     LR  +L K+++ S
Sbjct: 118 KAGSFDNYVLLTKPQDLDSIYGEYLRKLMLTKVNDPS 154


>gi|319943235|ref|ZP_08017518.1| 50S ribosomal protein L28 [Lautropia mirabilis ATCC 51599]
 gi|319743777|gb|EFV96181.1| 50S ribosomal protein L28 [Lautropia mirabilis ATCC 51599]
          Length = 76

 Score = 94.7 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 29/63 (46%), Positives = 44/63 (69%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M++VC++T K  M GN VSHANNKT+RRFLPNL +  L  +  ++  +LR++   LR ++
Sbjct: 1  MAKVCQVTGKGPMVGNNVSHANNKTKRRFLPNLQQRRLWVESEQRYVRLRVTAAGLRKID 60

Query: 61 RQG 63
          + G
Sbjct: 61 KLG 63


>gi|260072713|gb|ACX30609.1| ribosomal protein L28 [uncultured bacterium ARCTIC96BD-19]
          Length = 78

 Score = 94.7 bits (235), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 47/73 (64%), Gaps = 1/73 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS+VC++T K  +SGN VSHANN+TRRRF PNL       +   +  +L++S   LR ++
Sbjct: 1  MSKVCQVTGKRPISGNNVSHANNRTRRRFYPNLHTHRFWVEAENRFVKLKLSARGLRVID 60

Query: 61 RQGGLDRFLSNSK 73
          ++G +D  L+  +
Sbjct: 61 KKG-IDVVLAEIR 72


>gi|77166098|ref|YP_344623.1| ribosomal protein L28 [Nitrosococcus oceani ATCC 19707]
 gi|254436099|ref|ZP_05049606.1| ribosomal protein L28 [Nitrosococcus oceani AFC27]
 gi|123593489|sp|Q3J7V3|RL28_NITOC RecName: Full=50S ribosomal protein L28
 gi|76884412|gb|ABA59093.1| LSU ribosomal protein L28P [Nitrosococcus oceani ATCC 19707]
 gi|207089210|gb|EDZ66482.1| ribosomal protein L28 [Nitrosococcus oceani AFC27]
          Length = 78

 Score = 94.7 bits (235), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 31/75 (41%), Positives = 48/75 (64%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS+VC++T K   SGN VSHA+NKTRRRFLPNL       +   +  +L++S   LR ++
Sbjct: 1  MSKVCQVTGKRPASGNNVSHAHNKTRRRFLPNLHTHRFWVEGENRWVKLKVSGKGLRMID 60

Query: 61 RQGGLDRFLSNSKKE 75
          + G +D+ L++ +  
Sbjct: 61 KLG-IDQVLADMRTR 74


>gi|145346206|ref|XP_001417584.1| Putative mitochondrial ribosomal protein L28 [Ostreococcus
           lucimarinus CCE9901]
 gi|144577811|gb|ABO95877.1| Putative mitochondrial ribosomal protein L28 [Ostreococcus
           lucimarinus CCE9901]
          Length = 125

 Score = 94.7 bits (235), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 29/95 (30%), Positives = 53/95 (55%), Gaps = 2/95 (2%)

Query: 2   SRVCELTKKTVMSGNKVSH-ANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
           +R      K +  GN VS    NKTRRR+LPN  +  + S+++E+   +R++  ALR ++
Sbjct: 21  ARRGLFAGKHIKFGNNVSEDGGNKTRRRWLPNAQKKRVYSELLEEMIPMRVTAHALRCMD 80

Query: 61  RQGGLDRFLSNSKKENL-SARMRTLRSQILKKMSE 94
           + GGLD ++  ++ ++L S     L+ ++    S 
Sbjct: 81  KAGGLDEYILRTRDQDLKSVFALELKERLKAAKSA 115


>gi|326793824|ref|YP_004311644.1| 50S ribosomal protein L28 [Marinomonas mediterranea MMB-1]
 gi|326544588|gb|ADZ89808.1| 50S ribosomal protein L28 [Marinomonas mediterranea MMB-1]
          Length = 78

 Score = 94.3 bits (234), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 27/75 (36%), Positives = 47/75 (62%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  ++GN VSH+  +T+RRFLPNL       D   +  ++R+S   +R ++
Sbjct: 1  MSRVCQVTGKRPVTGNNVSHSKRRTKRRFLPNLHWHRFWVDSENRYVRIRVSSKGMRIID 60

Query: 61 RQGGLDRFLSNSKKE 75
          ++G +D  L++ +  
Sbjct: 61 KKG-IDAVLADMRAN 74


>gi|332666735|ref|YP_004449523.1| 50S ribosomal protein L28 [Haliscomenobacter hydrossis DSM 1100]
 gi|332335549|gb|AEE52650.1| 50S ribosomal protein L28 [Haliscomenobacter hydrossis DSM 1100]
          Length = 87

 Score = 94.3 bits (234), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 29/69 (42%), Positives = 44/69 (63%), Gaps = 1/69 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS+VC+LT K  + GN VSH+N KT+RRFLPNL +        +Q   L++S  A+R++ 
Sbjct: 1  MSKVCQLTGKRPIVGNNVSHSNRKTKRRFLPNLQKKRFFIPETDQWVTLKLSTSAMRNIS 60

Query: 61 RQGGLDRFL 69
          + G +  +L
Sbjct: 61 KLG-IYEYL 68


>gi|258567372|ref|XP_002584430.1| conserved hypothetical protein [Uncinocarpus reesii 1704]
 gi|237905876|gb|EEP80277.1| conserved hypothetical protein [Uncinocarpus reesii 1704]
          Length = 232

 Score = 94.3 bits (234), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 25/92 (27%), Positives = 49/92 (53%), Gaps = 5/92 (5%)

Query: 9   KKTVMSGNKVSHANN--KTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLD 66
             T+  GNK+S   N  KTRR + PN+ +  + S+ + +   L++    LR++++ GGLD
Sbjct: 71  GATIQFGNKISKGRNEGKTRRTWKPNIRKEKIYSEALGKWLDLKVQHRVLRTIKKVGGLD 130

Query: 67  RFLSN---SKKENLSARMRTLRSQILKKMSEK 95
           ++L     ++ + L      LR Q++   + +
Sbjct: 131 QYLLGEKPARIKELGIFGWHLRWQVMTSKAMR 162


>gi|146329689|ref|YP_001208992.1| 50S ribosomal protein L28 [Dichelobacter nodosus VCS1703A]
 gi|166226570|sp|A5EWV8|RL28_DICNV RecName: Full=50S ribosomal protein L28
 gi|146233159|gb|ABQ14137.1| 50S ribosomal protein L28 [Dichelobacter nodosus VCS1703A]
          Length = 78

 Score = 94.3 bits (234), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 28/75 (37%), Positives = 44/75 (58%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR+C++T K  M GN VSHANNK +RRFLPN+           +   L++S   +R ++
Sbjct: 1  MSRICQVTGKKPMVGNTVSHANNKGKRRFLPNIQEHRFWVQSENRFITLKVSAHGMRIID 60

Query: 61 RQGGLDRFLSNSKKE 75
          ++G +D  L+  +  
Sbjct: 61 KKG-IDAVLAQMRAR 74


>gi|330890936|gb|EGH23597.1| 50S ribosomal protein L28 [Pseudomonas syringae pv. mori str.
          301020]
          Length = 77

 Score = 94.3 bits (234), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 29/63 (46%), Positives = 44/63 (69%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  ++GN +SHANNKTRRRFLPNL       +  ++  +LR+S   +R ++
Sbjct: 1  MSRVCQVTGKGPVTGNNISHANNKTRRRFLPNLQHHRFWIEGEKRFVRLRVSAKGMRIID 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KRG 63


>gi|171464048|ref|YP_001798161.1| ribosomal protein L28 [Polynucleobacter necessarius subsp.
          necessarius STIR1]
 gi|226699144|sp|B1XW20|RL28_POLNS RecName: Full=50S ribosomal protein L28
 gi|171193586|gb|ACB44547.1| ribosomal protein L28 [Polynucleobacter necessarius subsp.
          necessarius STIR1]
          Length = 77

 Score = 94.3 bits (234), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 30/75 (40%), Positives = 45/75 (60%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M++VC++T K  M GN VSHA NKT+RRFLPNL       +   +   LR++   LR ++
Sbjct: 1  MAKVCQVTGKKPMVGNNVSHAKNKTKRRFLPNLQNRRFWVESENRWISLRLTNAGLRVID 60

Query: 61 RQGGLDRFLSNSKKE 75
          + G +D  LS+ +  
Sbjct: 61 KNG-IDAVLSDLRTR 74


>gi|71082914|ref|YP_265633.1| 50S ribosomal protein L28 [Candidatus Pelagibacter ubique
          HTCC1062]
 gi|91762663|ref|ZP_01264628.1| 50S ribosomal protein L28 [Candidatus Pelagibacter ubique
          HTCC1002]
 gi|71062027|gb|AAZ21030.1| 50S ribosomal protein L28 [Candidatus Pelagibacter ubique
          HTCC1062]
 gi|91718465|gb|EAS85115.1| 50S ribosomal protein L28 [Candidatus Pelagibacter ubique
          HTCC1002]
          Length = 107

 Score = 93.9 bits (233), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 38/80 (47%), Positives = 55/80 (68%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS+ CELT K  M G+ VSHANNKT+RRFLPNL +    S+++++   L +S   +RSV+
Sbjct: 1  MSKKCELTGKIPMKGHNVSHANNKTKRRFLPNLKKAKFTSELLKRSLTLTVSNAGVRSVD 60

Query: 61 RQGGLDRFLSNSKKENLSAR 80
          ++G  D+FL   K +N+S R
Sbjct: 61 KKGTFDQFLKTVKNKNISPR 80


>gi|126664653|ref|ZP_01735637.1| 50S ribosomal subunit protein L28 [Marinobacter sp. ELB17]
 gi|126630979|gb|EBA01593.1| 50S ribosomal subunit protein L28 [Marinobacter sp. ELB17]
          Length = 78

 Score = 93.9 bits (233), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 30/75 (40%), Positives = 48/75 (64%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  ++GN VSHA N TRRRFLPNL       +  ++  +LR+S   +R ++
Sbjct: 1  MSRVCQVTGKRPVAGNNVSHAMNHTRRRFLPNLQSHRFWVETEKRFVKLRVSTKGMRIID 60

Query: 61 RQGGLDRFLSNSKKE 75
          ++G +D  L++ +  
Sbjct: 61 KKG-IDIVLADLRAR 74


>gi|89094939|ref|ZP_01167870.1| 50S ribosomal protein L28 [Oceanospirillum sp. MED92]
 gi|89080805|gb|EAR60046.1| 50S ribosomal protein L28 [Oceanospirillum sp. MED92]
          Length = 78

 Score = 93.9 bits (233), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 28/75 (37%), Positives = 45/75 (60%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS+VC +T K  ++GN VSH+  KTRRRFLPNL       +   +  +LR+S   +R ++
Sbjct: 1  MSKVCMVTGKRPVTGNNVSHSQRKTRRRFLPNLHWHRFWVESENKFVRLRVSAKGMRIID 60

Query: 61 RQGGLDRFLSNSKKE 75
          ++G +D  L+  +  
Sbjct: 61 KKG-IDAVLTEVRAN 74


>gi|156048865|ref|XP_001590399.1| hypothetical protein SS1G_08139 [Sclerotinia sclerotiorum 1980]
 gi|154692538|gb|EDN92276.1| hypothetical protein SS1G_08139 [Sclerotinia sclerotiorum 1980
           UF-70]
          Length = 231

 Score = 93.9 bits (233), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 31/89 (34%), Positives = 47/89 (52%), Gaps = 4/89 (4%)

Query: 11  TVMSGNKVSHAN-NKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFL 69
            +  GN VS  N  KTRR + PN+ R  L S  + +  +LRI+   LR++++ GGLD +L
Sbjct: 62  KIRYGNIVSKKNEIKTRRHWRPNVQRKRLYSASLGKHIKLRITTKVLRTIDKAGGLDEYL 121

Query: 70  SNSKK---ENLSARMRTLRSQILKKMSEK 95
              K    + L      LR +I++  S K
Sbjct: 122 LGEKTQRLKELGMGGWKLRWRIMQTDSVK 150


>gi|145517660|ref|XP_001444713.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 gi|124412135|emb|CAK77316.1| unnamed protein product [Paramecium tetraurelia]
          Length = 289

 Score = 93.9 bits (233), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 26/97 (26%), Positives = 53/97 (54%), Gaps = 1/97 (1%)

Query: 1   MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
           MS+ C    K   SGN+   +  KTRR ++PN+ + T  S I+ ++  ++++   ++ + 
Sbjct: 58  MSQFCLWHGKQPKSGNQTCFSEKKTRRSWMPNVQKQTYESLILGRRIHVKVTAKTMKCIR 117

Query: 61  RQGGLDRFLSNSKKENL-SARMRTLRSQILKKMSEKS 96
           + G  D ++  +K ++L S     LR  +L K+++ S
Sbjct: 118 KAGSFDNYILLTKPQDLDSIYGEYLRQLMLTKINDPS 154


>gi|50292515|ref|XP_448690.1| hypothetical protein [Candida glabrata CBS 138]
 gi|49528002|emb|CAG61653.1| unnamed protein product [Candida glabrata]
          Length = 267

 Score = 93.9 bits (233), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 23/92 (25%), Positives = 53/92 (57%), Gaps = 3/92 (3%)

Query: 9   KKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRF 68
              V  GNK+S + +KTRR + PN+ + +L S+ + +   ++++   LR++ ++GG+D +
Sbjct: 85  GSFVKYGNKISESKHKTRRTWHPNVIKKSLWSETLNRSINIKMTAKVLRTIIKEGGIDNY 144

Query: 69  LSN---SKKENLSARMRTLRSQILKKMSEKSS 97
           L     ++ + L      LR +I+++  + ++
Sbjct: 145 LIKDKSARIKELGPTGWKLRYRIMQRKEQLNN 176


>gi|83643894|ref|YP_432329.1| ribosomal protein L28 [Hahella chejuensis KCTC 2396]
 gi|123534643|sp|Q2SN70|RL28_HAHCH RecName: Full=50S ribosomal protein L28
 gi|83631937|gb|ABC27904.1| ribosomal protein L28 [Hahella chejuensis KCTC 2396]
          Length = 78

 Score = 93.6 bits (232), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 32/75 (42%), Positives = 51/75 (68%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K+ ++GN VSHANNKT+RRFLPNL       +  ++  +LR+S   +R ++
Sbjct: 1  MSRVCQVTGKSPITGNNVSHANNKTKRRFLPNLQTHRFWVENEKRFVKLRVSTKGMRIID 60

Query: 61 RQGGLDRFLSNSKKE 75
          + G +D+ LS+ +  
Sbjct: 61 KVG-IDKVLSDIRAR 74


>gi|52308049|gb|AAU38549.1| RpmB protein [Mannheimia succiniciproducens MBEL55E]
          Length = 82

 Score = 93.6 bits (232), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 28/75 (37%), Positives = 43/75 (57%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K    GN  SHA N TRRRFLPNL       +   +   LR++   +R ++
Sbjct: 5  MSRVCQVTGKRPAVGNNRSHALNATRRRFLPNLHTHRFWVESENRFVTLRLTAKGMRIID 64

Query: 61 RQGGLDRFLSNSKKE 75
          ++G +D  L++ +  
Sbjct: 65 KKG-IDAVLADIRAR 78


>gi|224142087|ref|XP_002324390.1| predicted protein [Populus trichocarpa]
 gi|222865824|gb|EEF02955.1| predicted protein [Populus trichocarpa]
          Length = 177

 Score = 93.6 bits (232), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 22/95 (23%), Positives = 51/95 (53%), Gaps = 1/95 (1%)

Query: 2   SRVCELTKKTVMSGNKVSH-ANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
           ++      + +  GN++S    NK+RR + PN+    L S I+++  +++++  A+R ++
Sbjct: 44  AKRGLFAGRHIQFGNQISEDGGNKSRRSWKPNVQDKRLFSYILDRHVRVKVTTHAIRCID 103

Query: 61  RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEK 95
           + GG+D +L  +    +   M  L    ++K+ E+
Sbjct: 104 KAGGIDEYLLKTPYHKMDTEMGILWKAKIEKLYEE 138


>gi|40063305|gb|AAR38123.1| ribosomal protein L28 [uncultured marine bacterium 578]
          Length = 78

 Score = 93.6 bits (232), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 47/73 (64%), Gaps = 1/73 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M++VC++T K  +SGN VSHANNKTRRRF PNL       +   +  +L++S   LR ++
Sbjct: 1  MAKVCQVTGKRPISGNNVSHANNKTRRRFYPNLHTHRFWVENENRFVKLKLSARGLRVID 60

Query: 61 RQGGLDRFLSNSK 73
          ++G +D  L+  +
Sbjct: 61 KKG-IDVVLAEIR 72


>gi|114321788|ref|YP_743471.1| 50S ribosomal protein L28P [Alkalilimnicola ehrlichii MLHE-1]
 gi|122310770|sp|Q0A5A6|RL28_ALHEH RecName: Full=50S ribosomal protein L28
 gi|114228182|gb|ABI57981.1| LSU ribosomal protein L28P [Alkalilimnicola ehrlichii MLHE-1]
          Length = 78

 Score = 93.6 bits (232), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 34/84 (40%), Positives = 52/84 (61%), Gaps = 6/84 (7%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS+VC++T K   +GN VSHANNKT+RRFLPNL       +  ++  +LR+S   +R ++
Sbjct: 1  MSKVCQVTGKRPTTGNNVSHANNKTKRRFLPNLHHHRFWVESEQRFVRLRVSSKGMRIID 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTL 84
          R+G +D+ L      +L AR   +
Sbjct: 61 RKG-IDQVL-----SDLRARGEKV 78


>gi|281203401|gb|EFA77601.1| hypothetical protein PPL_12207 [Polysphondylium pallidum PN500]
          Length = 142

 Score = 93.2 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 25/89 (28%), Positives = 50/89 (56%), Gaps = 1/89 (1%)

Query: 9   KKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRF 68
            +T+  GN +S ++ KTRR + PN+   T  SDI+ Q  ++ ++   +R +++ G  D +
Sbjct: 35  GRTIQYGNSISFSHKKTRRTWKPNVQSKTYHSDILNQDIKVDVTTYTMRCIDKAGNFDNY 94

Query: 69  LSNSKKENL-SARMRTLRSQILKKMSEKS 96
           + N+K ++L S     L+  +   + EK+
Sbjct: 95  IINTKDKDLDSKLGSDLKVLLKSTLREKA 123


>gi|118595305|ref|ZP_01552652.1| 50S ribosomal protein L28 [Methylophilales bacterium HTCC2181]
 gi|118441083|gb|EAV47710.1| 50S ribosomal protein L28 [Methylophilales bacterium HTCC2181]
          Length = 78

 Score = 93.2 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 32/75 (42%), Positives = 49/75 (65%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+R CE+T K  +SGN VSHANN+TRRRFLPNL    +  +   +   +RIS  ALR+++
Sbjct: 1  MTRECEVTGKRPVSGNNVSHANNRTRRRFLPNLHNRRIWVETENRWVSMRISSAALRTID 60

Query: 61 RQGGLDRFLSNSKKE 75
          + G +D  ++  + +
Sbjct: 61 KLG-IDAVIAKMRSD 74


>gi|326480944|gb|EGE04954.1| 54S ribosomal protein L24 [Trichophyton equinum CBS 127.97]
          Length = 232

 Score = 93.2 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 25/92 (27%), Positives = 52/92 (56%), Gaps = 5/92 (5%)

Query: 9   KKTVMSGNKVSHANNK--TRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLD 66
             T++ GNK+S   NK  TRR + PN+ +  + S  ++++ +L+++   LR++ + GGLD
Sbjct: 71  GATIIFGNKISKGRNKGKTRRIWKPNVRKEKVYSKALDEEIELKVTHGVLRTINKVGGLD 130

Query: 67  RFLSN---SKKENLSARMRTLRSQILKKMSEK 95
            +L     ++ + L      LR +++  ++ K
Sbjct: 131 EYLLGDKPARIKELGMFGWKLRWRVMTSLAMK 162


>gi|153877669|ref|ZP_02004325.1| Ribosomal protein L28 [Beggiatoa sp. PS]
 gi|152065867|gb|EDN65675.1| Ribosomal protein L28 [Beggiatoa sp. PS]
          Length = 78

 Score = 93.2 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 27/63 (42%), Positives = 42/63 (66%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS+VC++T K  +SGN VSHA+NKT+RRFLPNL           +  +LR++   +R ++
Sbjct: 1  MSKVCQVTGKRPISGNNVSHAHNKTKRRFLPNLHTHRFWVPDENRYIKLRVTTKGMRIID 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|183597218|ref|ZP_02958711.1| hypothetical protein PROSTU_00460 [Providencia stuartii ATCC
          25827]
 gi|188023531|gb|EDU61571.1| hypothetical protein PROSTU_00460 [Providencia stuartii ATCC
          25827]
          Length = 78

 Score = 93.2 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 30/75 (40%), Positives = 45/75 (60%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  MSGN  SHA N T+RRFLPNL       +  ++   LR+S   +R ++
Sbjct: 1  MSRVCQVTGKRPMSGNNRSHALNATKRRFLPNLHSHRFWVESEKRFVTLRVSAKGMRIID 60

Query: 61 RQGGLDRFLSNSKKE 75
          ++G +D  L+  +  
Sbjct: 61 KKG-IDAVLAELRAR 74


>gi|326473945|gb|EGD97954.1| 50S ribosomal protein L24 [Trichophyton tonsurans CBS 112818]
          Length = 234

 Score = 93.2 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 25/92 (27%), Positives = 52/92 (56%), Gaps = 5/92 (5%)

Query: 9   KKTVMSGNKVSHANNK--TRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLD 66
             T++ GNK+S   NK  TRR + PN+ +  + S  ++++ +L+++   LR++ + GGLD
Sbjct: 71  GATIIFGNKISKGRNKGKTRRIWKPNVRKEKVYSKALDEEIELKVTHGVLRTINKVGGLD 130

Query: 67  RFLSN---SKKENLSARMRTLRSQILKKMSEK 95
            +L     ++ + L      LR +++  ++ K
Sbjct: 131 EYLLGDKPARIKELGMFGWKLRWRVMTSLAMK 162


>gi|300113188|ref|YP_003759763.1| 50S ribosomal protein L28 [Nitrosococcus watsonii C-113]
 gi|299539125|gb|ADJ27442.1| ribosomal protein L28 [Nitrosococcus watsonii C-113]
          Length = 78

 Score = 93.2 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 32/75 (42%), Positives = 48/75 (64%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS+VC++T K   SGN VSHA+NKTRRRFLPNL       +   +  +L++S   LR ++
Sbjct: 1  MSKVCQVTGKRPASGNNVSHAHNKTRRRFLPNLHTHRFWVEGENRWVKLKVSGKGLRMID 60

Query: 61 RQGGLDRFLSNSKKE 75
          + G +DR L++ +  
Sbjct: 61 KLG-IDRVLADMRAR 74


>gi|327295266|ref|XP_003232328.1| 50S ribosomal protein L24 [Trichophyton rubrum CBS 118892]
 gi|326465500|gb|EGD90953.1| 50S ribosomal protein L24 [Trichophyton rubrum CBS 118892]
          Length = 232

 Score = 93.2 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 25/92 (27%), Positives = 52/92 (56%), Gaps = 5/92 (5%)

Query: 9   KKTVMSGNKVSHANNK--TRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLD 66
             T++ GNK+S   NK  TRR + PN+ +  + S  ++++ +L+++   LR++ + GGLD
Sbjct: 71  GATIIFGNKISKGRNKGKTRRIWKPNVRKEKIYSKALDEEIELKVTHGVLRTINKVGGLD 130

Query: 67  RFLSN---SKKENLSARMRTLRSQILKKMSEK 95
            +L     ++ + L      LR +++  ++ K
Sbjct: 131 EYLLGDKPARIKELGMFGWKLRWRVMTSLAMK 162


>gi|315043030|ref|XP_003170891.1| 54S ribosomal protein L24 [Arthroderma gypseum CBS 118893]
 gi|311344680|gb|EFR03883.1| 54S ribosomal protein L24 [Arthroderma gypseum CBS 118893]
          Length = 232

 Score = 93.2 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 25/92 (27%), Positives = 52/92 (56%), Gaps = 5/92 (5%)

Query: 9   KKTVMSGNKVSHANNK--TRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLD 66
             T++ GNK+S   NK  TRR + PN+ +  + S  ++++ +L+++   LR++ + GGLD
Sbjct: 71  GATIIFGNKISKGRNKGKTRRIWKPNVRKEKVYSKALDEEIELKVTHGVLRTINKVGGLD 130

Query: 67  RFLSN---SKKENLSARMRTLRSQILKKMSEK 95
            +L     ++ + L      LR +++  ++ K
Sbjct: 131 EYLLGDKPARIKELGMFGWKLRWRVMTSLAMK 162


>gi|167855901|ref|ZP_02478651.1| 50S ribosomal protein L28 [Haemophilus parasuis 29755]
 gi|219872083|ref|YP_002476458.1| 50S ribosomal protein L28 [Haemophilus parasuis SH0165]
 gi|254801363|sp|B8F858|RL28_HAEPS RecName: Full=50S ribosomal protein L28
 gi|167852989|gb|EDS24253.1| 50S ribosomal protein L28 [Haemophilus parasuis 29755]
 gi|219692287|gb|ACL33510.1| 50S ribosomal protein L28 [Haemophilus parasuis SH0165]
          Length = 78

 Score = 92.8 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 27/75 (36%), Positives = 43/75 (57%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  + GN  SHA N T+RRFLPNL       +   +   LR++   +R ++
Sbjct: 1  MSRVCQVTGKRPVVGNNRSHAMNATKRRFLPNLHTHRFWVESENRFVTLRLTAKGMRIID 60

Query: 61 RQGGLDRFLSNSKKE 75
          ++G +D  L+  +  
Sbjct: 61 KKG-IDAVLAEIRAR 74


>gi|53803464|ref|YP_114755.1| 50S ribosomal protein L28 [Methylococcus capsulatus str. Bath]
 gi|67461354|sp|Q605E5|RL28_METCA RecName: Full=50S ribosomal protein L28
 gi|53757225|gb|AAU91516.1| ribosomal protein L28 [Methylococcus capsulatus str. Bath]
          Length = 78

 Score = 92.8 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 28/75 (37%), Positives = 46/75 (61%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS+VC++T K  + G+ VSHANNKT+R F PNL       +   +  +L++S   LR ++
Sbjct: 1  MSKVCQVTGKRRIVGHNVSHANNKTKRLFNPNLHERRFWVESENRWVRLKVSNHGLRVID 60

Query: 61 RQGGLDRFLSNSKKE 75
          + G +D  L++ +K 
Sbjct: 61 KCG-IDAVLADIRKR 74


>gi|208806801|ref|ZP_03249138.1| ribosomal protein L28 [Escherichia coli O157:H7 str. EC4206]
 gi|208726602|gb|EDZ76203.1| ribosomal protein L28 [Escherichia coli O157:H7 str. EC4206]
          Length = 85

 Score = 92.8 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 28/75 (37%), Positives = 45/75 (60%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  ++GN  SHA N T+RRFLPNL       +  ++   LR+S   +R ++
Sbjct: 8  MSRVCQVTGKRPVTGNNRSHALNATKRRFLPNLHSHRFWVESEKRFVTLRVSAKGMRVID 67

Query: 61 RQGGLDRFLSNSKKE 75
          ++G +D  L+  +  
Sbjct: 68 KKG-IDTVLAELRAR 81


>gi|164656903|ref|XP_001729578.1| hypothetical protein MGL_3122 [Malassezia globosa CBS 7966]
 gi|159103471|gb|EDP42364.1| hypothetical protein MGL_3122 [Malassezia globosa CBS 7966]
          Length = 153

 Score = 92.8 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 29/87 (33%), Positives = 56/87 (64%)

Query: 9   KKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRF 68
            + V  GN +  + +KT R++ PN+ R TL S+ +++    R++  A+RS+E+ GGLD++
Sbjct: 59  GRIVQFGNTIPKSRHKTSRKWTPNIQRTTLWSETLQEYVTTRVATSAMRSIEKHGGLDQY 118

Query: 69  LSNSKKENLSARMRTLRSQILKKMSEK 95
           L+ +K+ +L    RTLR ++ + + +K
Sbjct: 119 LARTKESHLGEFGRTLRMRVARALRDK 145


>gi|115472627|ref|NP_001059912.1| Os07g0544900 [Oryza sativa Japonica Group]
 gi|34393259|dbj|BAC83129.1| unknown protein [Oryza sativa Japonica Group]
 gi|113611448|dbj|BAF21826.1| Os07g0544900 [Oryza sativa Japonica Group]
 gi|125558698|gb|EAZ04234.1| hypothetical protein OsI_26378 [Oryza sativa Indica Group]
 gi|125600612|gb|EAZ40188.1| hypothetical protein OsJ_24633 [Oryza sativa Japonica Group]
          Length = 204

 Score = 92.8 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 24/97 (24%), Positives = 49/97 (50%), Gaps = 1/97 (1%)

Query: 2   SRVCELTKKTVMSGNKVSH-ANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
           ++      + +  GNKVS    NK+RR + PN+    L S I ++  +++++  ALR ++
Sbjct: 44  AKRGIYAGRHIQFGNKVSEDGGNKSRRTWKPNVQEKRLFSYIHDRHIRVKVTTHALRCID 103

Query: 61  RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKSS 97
           + GG+D +L  +    +   M       ++KM  + +
Sbjct: 104 KAGGIDEYLLKTPYNKMDTEMGVAWKAKIEKMYSQLA 140


>gi|320584009|gb|EFW98221.1| 54S ribosomal protein L24, mitochondrial [Pichia angusta DL-1]
          Length = 260

 Score = 92.8 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 29/101 (28%), Positives = 54/101 (53%), Gaps = 5/101 (4%)

Query: 2   SRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVER 61
           S       + ++ GNKVS   N+ RR +LPN+    L S+ + +   L+++   LR++ +
Sbjct: 73  SNRGLFGGQFIVFGNKVSEHKNRARRTWLPNVVNKKLWSESLNKMVPLKLTARVLRTITK 132

Query: 62  QGGLDRFLSN---SKKENLSARMRTLRSQILKKM--SEKSS 97
           +GGLD +L+    ++ + L      LR  +LK    ++K+S
Sbjct: 133 EGGLDNYLTKDKRARIKELGPFGWRLRYDVLKAQERAKKAS 173


>gi|87120856|ref|ZP_01076748.1| ribosomal protein L28 [Marinomonas sp. MED121]
 gi|86163694|gb|EAQ64967.1| ribosomal protein L28 [Marinomonas sp. MED121]
          Length = 78

 Score = 92.8 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 26/75 (34%), Positives = 47/75 (62%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  ++GN VSH+  +T+RRFLPNL       +   +  +LR+S   +R ++
Sbjct: 1  MSRVCQVTGKRPVTGNNVSHSKRRTKRRFLPNLHWHRFWVEGENRFVRLRVSSKGIRIID 60

Query: 61 RQGGLDRFLSNSKKE 75
          ++G ++  L++ +  
Sbjct: 61 KKG-IEAVLTDLRAN 74


>gi|269468151|gb|EEZ79855.1| ribosomal protein L28 [uncultured SUP05 cluster bacterium]
 gi|269468485|gb|EEZ80146.1| ribosomal protein L28 [uncultured SUP05 cluster bacterium]
          Length = 78

 Score = 92.8 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 28/75 (37%), Positives = 47/75 (62%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+++C++T K  +SGN VSHANN+TRRRF PNL       +   +  +L+++   LR V+
Sbjct: 1  MAKICQVTGKRPISGNNVSHANNRTRRRFYPNLHTHRFWVESENRFVKLKLTAKGLRIVD 60

Query: 61 RQGGLDRFLSNSKKE 75
          ++G +D  L+  +  
Sbjct: 61 KKG-IDTVLAEIRAR 74


>gi|16272889|ref|NP_439112.1| 50S ribosomal protein L28 [Haemophilus influenzae Rd KW20]
 gi|68249539|ref|YP_248651.1| 50S ribosomal protein L28 [Haemophilus influenzae 86-028NP]
 gi|145628113|ref|ZP_01783914.1| DNA repair protein RadC [Haemophilus influenzae 22.1-21]
 gi|145630046|ref|ZP_01785828.1| 50S ribosomal protein L33 [Haemophilus influenzae R3021]
 gi|145632337|ref|ZP_01788072.1| 50S ribosomal protein L33 [Haemophilus influenzae 3655]
 gi|145634127|ref|ZP_01789838.1| 50S ribosomal protein L33 [Haemophilus influenzae PittAA]
 gi|145637256|ref|ZP_01792917.1| 50S ribosomal protein L33 [Haemophilus influenzae PittHH]
 gi|145638226|ref|ZP_01793836.1| DNA repair protein RadC [Haemophilus influenzae PittII]
 gi|145640619|ref|ZP_01796202.1| 50S ribosomal protein L33 [Haemophilus influenzae R3021]
 gi|148826398|ref|YP_001291151.1| 50S ribosomal protein L28 [Haemophilus influenzae PittEE]
 gi|148828129|ref|YP_001292882.1| 50S ribosomal protein L28 [Haemophilus influenzae PittGG]
 gi|229843988|ref|ZP_04464129.1| 50S ribosomal protein L28 [Haemophilus influenzae 6P18H1]
 gi|229846011|ref|ZP_04466123.1| 50S ribosomal protein L28 [Haemophilus influenzae 7P49H1]
 gi|251793908|ref|YP_003008640.1| 50S ribosomal protein L28 [Aggregatibacter aphrophilus NJ8700]
 gi|260580041|ref|ZP_05847871.1| ribosomal protein L28 [Haemophilus influenzae RdAW]
 gi|260581786|ref|ZP_05849583.1| ribosomal protein L28 [Haemophilus influenzae NT127]
 gi|270616371|ref|ZP_06221735.1| ribosomal protein-related protein [Haemophilus influenzae HK1212]
 gi|315633558|ref|ZP_07888848.1| 50S ribosomal protein L28 [Aggregatibacter segnis ATCC 33393]
 gi|319897559|ref|YP_004135756.1| 50S ribosomal subunit protein l28 [Haemophilus influenzae F3031]
 gi|1173011|sp|P44364|RL28_HAEIN RecName: Full=50S ribosomal protein L28
 gi|81336034|sp|Q4QLV6|RL28_HAEI8 RecName: Full=50S ribosomal protein L28
 gi|166226578|sp|A5UDB7|RL28_HAEIE RecName: Full=50S ribosomal protein L28
 gi|166226579|sp|A5UI93|RL28_HAEIG RecName: Full=50S ribosomal protein L28
 gi|1573976|gb|AAC22612.1| ribosomal protein L28 (rpL28) [Haemophilus influenzae Rd KW20]
 gi|68057738|gb|AAX87991.1| 50S ribosomal protein L28 [Haemophilus influenzae 86-028NP]
 gi|144979888|gb|EDJ89547.1| DNA repair protein RadC [Haemophilus influenzae 22.1-21]
 gi|144984327|gb|EDJ91750.1| 50S ribosomal protein L33 [Haemophilus influenzae R3021]
 gi|144987244|gb|EDJ93774.1| 50S ribosomal protein L33 [Haemophilus influenzae 3655]
 gi|145268571|gb|EDK08564.1| 50S ribosomal protein L33 [Haemophilus influenzae PittAA]
 gi|145269508|gb|EDK09450.1| 50S ribosomal protein L33 [Haemophilus influenzae PittHH]
 gi|145272555|gb|EDK12462.1| DNA repair protein RadC [Haemophilus influenzae PittII]
 gi|145274545|gb|EDK14408.1| 50S ribosomal protein L33 [Haemophilus influenzae 22.4-21]
 gi|148716558|gb|ABQ98768.1| 50S ribosomal protein L28 [Haemophilus influenzae PittEE]
 gi|148719371|gb|ABR00499.1| 50S ribosomal protein L28 [Haemophilus influenzae PittGG]
 gi|229811015|gb|EEP46732.1| 50S ribosomal protein L28 [Haemophilus influenzae 7P49H1]
 gi|229812982|gb|EEP48670.1| 50S ribosomal protein L28 [Haemophilus influenzae 6P18H1]
 gi|247535307|gb|ACS98553.1| ribosomal protein L28 [Aggregatibacter aphrophilus NJ8700]
 gi|260093325|gb|EEW77258.1| ribosomal protein L28 [Haemophilus influenzae RdAW]
 gi|260095379|gb|EEW79270.1| ribosomal protein L28 [Haemophilus influenzae NT127]
 gi|270317975|gb|EFA29270.1| ribosomal protein-related protein [Haemophilus influenzae HK1212]
 gi|301169676|emb|CBW29277.1| 50S ribosomal subunit protein L28 [Haemophilus influenzae 10810]
 gi|309751381|gb|ADO81365.1| 50S ribosomal protein L28 [Haemophilus influenzae R2866]
 gi|309973546|gb|ADO96747.1| 50S ribosomal protein L28 [Haemophilus influenzae R2846]
 gi|315477600|gb|EFU68342.1| 50S ribosomal protein L28 [Aggregatibacter segnis ATCC 33393]
 gi|317433065|emb|CBY81439.1| 50S ribosomal subunit protein L28 [Haemophilus influenzae F3031]
          Length = 78

 Score = 92.8 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 28/75 (37%), Positives = 42/75 (56%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K    GN  SHA N TRRRFLPNL       +   +   LR++   +R ++
Sbjct: 1  MSRVCQVTGKRPAVGNNRSHAMNATRRRFLPNLHTHRFWVESENRFVTLRLTAKGMRIID 60

Query: 61 RQGGLDRFLSNSKKE 75
          ++G +D  L+  +  
Sbjct: 61 KKG-IDAVLAEIRAR 74


>gi|152977702|ref|YP_001343331.1| 50S ribosomal protein L28 [Actinobacillus succinogenes 130Z]
 gi|161510960|ref|YP_089134.2| 50S ribosomal protein L28 [Mannheimia succiniciproducens MBEL55E]
 gi|67461371|sp|Q65R61|RL28_MANSM RecName: Full=50S ribosomal protein L28
 gi|171472903|sp|A6VK99|RL28_ACTSZ RecName: Full=50S ribosomal protein L28
 gi|150839425|gb|ABR73396.1| ribosomal protein L28 [Actinobacillus succinogenes 130Z]
          Length = 78

 Score = 92.8 bits (230), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 28/75 (37%), Positives = 43/75 (57%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K    GN  SHA N TRRRFLPNL       +   +   LR++   +R ++
Sbjct: 1  MSRVCQVTGKRPAVGNNRSHALNATRRRFLPNLHTHRFWVESENRFVTLRLTAKGMRIID 60

Query: 61 RQGGLDRFLSNSKKE 75
          ++G +D  L++ +  
Sbjct: 61 KKG-IDAVLADIRAR 74


>gi|261867144|ref|YP_003255066.1| 50S ribosomal protein L28 [Aggregatibacter actinomycetemcomitans
          D11S-1]
 gi|261412476|gb|ACX81847.1| 50S ribosomal protein L28 [Aggregatibacter actinomycetemcomitans
          D11S-1]
          Length = 78

 Score = 92.8 bits (230), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 29/75 (38%), Positives = 42/75 (56%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K    GN  SHA N TRRRFLPNL       D   +   LR++   +R ++
Sbjct: 1  MSRVCQVTGKRPAVGNNRSHAMNATRRRFLPNLHTHRFWVDSENRFVTLRLTAKGMRIID 60

Query: 61 RQGGLDRFLSNSKKE 75
          ++G +D  L+  +  
Sbjct: 61 KKG-IDAVLAEIRAR 74


>gi|307546415|ref|YP_003898894.1| 50S ribosomal protein L28 [Halomonas elongata DSM 2581]
 gi|307218439|emb|CBV43709.1| 50S ribosomal protein L28 [Halomonas elongata DSM 2581]
          Length = 78

 Score = 92.4 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 27/75 (36%), Positives = 48/75 (64%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS+VC++T K  ++G+ VSH+  KT RRF+PNL       +  ++  +LR+S   +R ++
Sbjct: 1  MSKVCQVTGKRPVTGHNVSHSQRKTPRRFVPNLHTHRFWVEAEKRFVKLRVSTKGMRIID 60

Query: 61 RQGGLDRFLSNSKKE 75
          ++G +D  LS+ +K 
Sbjct: 61 KKG-IDAVLSDIRKR 74


>gi|261494188|ref|ZP_05990690.1| RpmB protein [Mannheimia haemolytica serotype A2 str. BOVINE]
 gi|261495584|ref|ZP_05992030.1| RpmB protein [Mannheimia haemolytica serotype A2 str. OVINE]
 gi|261308691|gb|EEY09948.1| RpmB protein [Mannheimia haemolytica serotype A2 str. OVINE]
 gi|261310169|gb|EEY11370.1| RpmB protein [Mannheimia haemolytica serotype A2 str. BOVINE]
          Length = 78

 Score = 92.4 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 27/75 (36%), Positives = 42/75 (56%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K    GN  SHA N T+RRFLPNL       +   +   LR++   +R ++
Sbjct: 1  MSRVCQVTGKRPAVGNNRSHAMNATKRRFLPNLHTHRFWVESENRFVTLRLTAKGMRIID 60

Query: 61 RQGGLDRFLSNSKKE 75
          ++G +D  L+  +  
Sbjct: 61 KKG-IDAVLAEIRAR 74


>gi|152994663|ref|YP_001339498.1| 50S ribosomal protein L28 [Marinomonas sp. MWYL1]
 gi|189029445|sp|A6VSY4|RL28_MARMS RecName: Full=50S ribosomal protein L28
 gi|150835587|gb|ABR69563.1| ribosomal protein L28 [Marinomonas sp. MWYL1]
          Length = 78

 Score = 92.4 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 26/75 (34%), Positives = 46/75 (61%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  ++GN VSH+  +T+RRFLPNL       +   +  +LR+S   +R ++
Sbjct: 1  MSRVCQVTGKRPITGNNVSHSKRRTKRRFLPNLHWHRFWVEGENRYIRLRVSSKGMRIID 60

Query: 61 RQGGLDRFLSNSKKE 75
          ++G ++  L+  +  
Sbjct: 61 KKG-IESVLAEIRAN 74


>gi|32034053|ref|ZP_00134297.1| COG0227: Ribosomal protein L28 [Actinobacillus pleuropneumoniae
          serovar 1 str. 4074]
 gi|126209425|ref|YP_001054650.1| 50S ribosomal protein L28 [Actinobacillus pleuropneumoniae L20]
 gi|165977414|ref|YP_001653007.1| 50S ribosomal protein L28 [Actinobacillus pleuropneumoniae
          serovar 3 str. JL03]
 gi|190151328|ref|YP_001969853.1| 50S ribosomal protein L28 [Actinobacillus pleuropneumoniae
          serovar 7 str. AP76]
 gi|240950186|ref|ZP_04754473.1| 50S ribosomal protein L28 [Actinobacillus minor NM305]
 gi|257465203|ref|ZP_05629574.1| 50S ribosomal protein L28 [Actinobacillus minor 202]
 gi|303250353|ref|ZP_07336552.1| 50S ribosomal protein L28 [Actinobacillus pleuropneumoniae
          serovar 6 str. Femo]
 gi|303251746|ref|ZP_07337917.1| 50S ribosomal protein L28 [Actinobacillus pleuropneumoniae
          serovar 2 str. 4226]
 gi|307246910|ref|ZP_07528975.1| 50S ribosomal protein L28 [Actinobacillus pleuropneumoniae
          serovar 1 str. 4074]
 gi|307249046|ref|ZP_07531054.1| 50S ribosomal protein L28 [Actinobacillus pleuropneumoniae
          serovar 2 str. S1536]
 gi|307251245|ref|ZP_07533166.1| 50S ribosomal protein L28 [Actinobacillus pleuropneumoniae
          serovar 4 str. M62]
 gi|307253662|ref|ZP_07535529.1| 50S ribosomal protein L28 [Actinobacillus pleuropneumoniae
          serovar 6 str. Femo]
 gi|307255892|ref|ZP_07537693.1| 50S ribosomal protein L28 [Actinobacillus pleuropneumoniae
          serovar 9 str. CVJ13261]
 gi|307258077|ref|ZP_07539829.1| 50S ribosomal protein L28 [Actinobacillus pleuropneumoniae
          serovar 10 str. D13039]
 gi|307260345|ref|ZP_07542052.1| 50S ribosomal protein L28 [Actinobacillus pleuropneumoniae
          serovar 11 str. 56153]
 gi|307262475|ref|ZP_07544120.1| 50S ribosomal protein L28 [Actinobacillus pleuropneumoniae
          serovar 12 str. 1096]
 gi|307264683|ref|ZP_07546263.1| 50S ribosomal protein L28 [Actinobacillus pleuropneumoniae
          serovar 13 str. N273]
 gi|322515257|ref|ZP_08068255.1| 50S ribosomal protein L28 [Actinobacillus ureae ATCC 25976]
 gi|325577759|ref|ZP_08148034.1| 50S ribosomal protein L28 [Haemophilus parainfluenzae ATCC 33392]
 gi|166226534|sp|A3N3Q9|RL28_ACTP2 RecName: Full=50S ribosomal protein L28
 gi|226738020|sp|B3H341|RL28_ACTP7 RecName: Full=50S ribosomal protein L28
 gi|226738021|sp|B0BTZ6|RL28_ACTPJ RecName: Full=50S ribosomal protein L28
 gi|126098217|gb|ABN75045.1| 50S ribosomal protein L28 [Actinobacillus pleuropneumoniae
          serovar 5b str. L20]
 gi|165877515|gb|ABY70563.1| 50S ribosomal protein L28 [Actinobacillus pleuropneumoniae
          serovar 3 str. JL03]
 gi|189916459|gb|ACE62711.1| 50S ribosomal protein L28 [Actinobacillus pleuropneumoniae
          serovar 7 str. AP76]
 gi|240295273|gb|EER46059.1| 50S ribosomal protein L28 [Actinobacillus minor NM305]
 gi|257450863|gb|EEV24906.1| 50S ribosomal protein L28 [Actinobacillus minor 202]
 gi|301154719|emb|CBW14182.1| 50S ribosomal subunit protein L28 [Haemophilus parainfluenzae
          T3T1]
 gi|302649176|gb|EFL79361.1| 50S ribosomal protein L28 [Actinobacillus pleuropneumoniae
          serovar 2 str. 4226]
 gi|302650823|gb|EFL80980.1| 50S ribosomal protein L28 [Actinobacillus pleuropneumoniae
          serovar 6 str. Femo]
 gi|306852195|gb|EFM84435.1| 50S ribosomal protein L28 [Actinobacillus pleuropneumoniae
          serovar 1 str. 4074]
 gi|306854504|gb|EFM86699.1| 50S ribosomal protein L28 [Actinobacillus pleuropneumoniae
          serovar 2 str. S1536]
 gi|306856761|gb|EFM88896.1| 50S ribosomal protein L28 [Actinobacillus pleuropneumoniae
          serovar 4 str. M62]
 gi|306858898|gb|EFM90944.1| 50S ribosomal protein L28 [Actinobacillus pleuropneumoniae
          serovar 6 str. Femo]
 gi|306861160|gb|EFM93153.1| 50S ribosomal protein L28 [Actinobacillus pleuropneumoniae
          serovar 9 str. CVJ13261]
 gi|306863440|gb|EFM95371.1| 50S ribosomal protein L28 [Actinobacillus pleuropneumoniae
          serovar 10 str. D13039]
 gi|306865596|gb|EFM97477.1| 50S ribosomal protein L28 [Actinobacillus pleuropneumoniae
          serovar 11 str. 56153]
 gi|306867852|gb|EFM99683.1| 50S ribosomal protein L28 [Actinobacillus pleuropneumoniae
          serovar 12 str. 1096]
 gi|306869995|gb|EFN01759.1| 50S ribosomal protein L28 [Actinobacillus pleuropneumoniae
          serovar 13 str. N273]
 gi|322118762|gb|EFX90968.1| 50S ribosomal protein L28 [Actinobacillus ureae ATCC 25976]
 gi|325160504|gb|EGC72630.1| 50S ribosomal protein L28 [Haemophilus parainfluenzae ATCC 33392]
          Length = 78

 Score = 92.4 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 28/75 (37%), Positives = 42/75 (56%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K    GN  SHA N TRRRFLPNL       +   +   LR++   +R ++
Sbjct: 1  MSRVCQVTGKRPAVGNNRSHALNATRRRFLPNLHTHRFWVESENRFVTLRLTAKGMRIID 60

Query: 61 RQGGLDRFLSNSKKE 75
          ++G +D  L+  +  
Sbjct: 61 KKG-IDAVLAEIRAR 74


>gi|90408983|ref|ZP_01217114.1| ribosomal protein L28 [Psychromonas sp. CNPT3]
 gi|90309897|gb|EAS38051.1| ribosomal protein L28 [Psychromonas sp. CNPT3]
          Length = 73

 Score = 92.4 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 29/74 (39%), Positives = 47/74 (63%), Gaps = 1/74 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K   +GN VSHA N+TRRRFLPNL       +   +  +LR++   +R ++
Sbjct: 1  MSRVCQVTGKRPATGNNVSHAKNRTRRRFLPNLQSHRFWVESENRFVKLRLTTKGMRIID 60

Query: 61 RQGGLDRFLSNSKK 74
          ++G +D  L++ + 
Sbjct: 61 KKG-IDTVLADIRA 73


>gi|78486257|ref|YP_392182.1| ribosomal protein L28 [Thiomicrospira crunogena XCL-2]
 gi|123555021|sp|Q31EB5|RL28_THICR RecName: Full=50S ribosomal protein L28
 gi|78364543|gb|ABB42508.1| LSU ribosomal protein L28P [Thiomicrospira crunogena XCL-2]
          Length = 78

 Score = 92.4 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 26/75 (34%), Positives = 45/75 (60%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS++C++T K  + GN VSH++ KTRRRFLPNL       +   +  +LR+S   +R ++
Sbjct: 1  MSKICQVTGKKPVVGNNVSHSHRKTRRRFLPNLQTHRFWVENENRFVKLRLSTSGMRIID 60

Query: 61 RQGGLDRFLSNSKKE 75
          + G ++  L+  +  
Sbjct: 61 KNG-IESVLAEMRAR 74


>gi|330720901|gb|EGG99084.1| LSU ribosomal protein L28p [gamma proteobacterium IMCC2047]
          Length = 78

 Score = 92.4 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 29/75 (38%), Positives = 50/75 (66%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS+VC++T K  ++GN VSHA N+TRRRFLPNL       +  ++  +LR+S   +R ++
Sbjct: 1  MSKVCQVTGKRPVTGNNVSHAKNRTRRRFLPNLHTHRFWVESEKRFVKLRVSTKGMRIID 60

Query: 61 RQGGLDRFLSNSKKE 75
          ++G +D+ L++ +  
Sbjct: 61 KKG-IDQVLADIRAN 74


>gi|254579857|ref|XP_002495914.1| ZYRO0C05940p [Zygosaccharomyces rouxii]
 gi|238938805|emb|CAR26981.1| ZYRO0C05940p [Zygosaccharomyces rouxii]
          Length = 256

 Score = 92.4 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 27/89 (30%), Positives = 54/89 (60%), Gaps = 3/89 (3%)

Query: 12  VMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFLSN 71
           V  GN ++ +  KTRRR+LPN+ R  L S+ +E+K  L ++   LR++ ++GG+D +L+ 
Sbjct: 76  VQYGNNIAESKTKTRRRWLPNVIRKGLWSETLERKISLGMTAKVLRTISKEGGIDNYLTK 135

Query: 72  ---SKKENLSARMRTLRSQILKKMSEKSS 97
              ++ + L      LR +I+++   +++
Sbjct: 136 DKSARIKELGPTGWRLRYRIMRRKELEAN 164


>gi|156844322|ref|XP_001645224.1| hypothetical protein Kpol_1060p22 [Vanderwaltozyma polyspora DSM
           70294]
 gi|156115883|gb|EDO17366.1| hypothetical protein Kpol_1060p22 [Vanderwaltozyma polyspora DSM
           70294]
          Length = 256

 Score = 92.4 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 27/92 (29%), Positives = 52/92 (56%), Gaps = 3/92 (3%)

Query: 9   KKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRF 68
              +  GN +S + +KTRR +LPN+ +  L S+ + +K  L+++   LR++ ++GGLD +
Sbjct: 75  GSFIQHGNTISESKHKTRRTWLPNIVKKALWSETLNKKVSLKMTTKVLRTISKEGGLDNY 134

Query: 69  LSN---SKKENLSARMRTLRSQILKKMSEKSS 97
           L     ++ + L      LR  +LK +  K++
Sbjct: 135 LIKEKSARIKELGPTGWKLRYAVLKGIELKNN 166


>gi|301116497|ref|XP_002905977.1| conserved hypothetical protein [Phytophthora infestans T30-4]
 gi|262109277|gb|EEY67329.1| conserved hypothetical protein [Phytophthora infestans T30-4]
          Length = 119

 Score = 92.4 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 26/95 (27%), Positives = 47/95 (49%), Gaps = 1/95 (1%)

Query: 2   SRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVER 61
           ++      +    GN VS +  +TRR +  N    +L S+ +++K  L ++   LR V++
Sbjct: 25  AQRGLFAGRDKAFGNNVSFSKRRTRRAWKVNHQWKSLYSEALDEKVGLNVTTHTLRCVDK 84

Query: 62  QGGLDRFLSNSKK-ENLSARMRTLRSQILKKMSEK 95
            GGLD +L + K    L  +    R ++L  +SE 
Sbjct: 85  IGGLDNYLLSIKDERELGVKGLKTRDRVLAALSEA 119


>gi|67523027|ref|XP_659574.1| hypothetical protein AN1970.2 [Aspergillus nidulans FGSC A4]
 gi|40745979|gb|EAA65135.1| hypothetical protein AN1970.2 [Aspergillus nidulans FGSC A4]
 gi|259487329|tpe|CBF85918.1| TPA: 50S ribosomal protein L24 (AFU_orthologue; AFUA_4G10740)
           [Aspergillus nidulans FGSC A4]
          Length = 203

 Score = 92.4 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 28/87 (32%), Positives = 52/87 (59%), Gaps = 5/87 (5%)

Query: 9   KKTVMSGNKVSHANN--KTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLD 66
             T+  GNK+S   N  KTRR + PN+ R  L S+ ++Q   +++++ ALR++ + GGLD
Sbjct: 60  GATIQFGNKISQGRNEGKTRRFWKPNVRRKKLWSEALQQFLFIKVTRKALRTIRKAGGLD 119

Query: 67  RFLSN---SKKENLSARMRTLRSQILK 90
           ++L +   ++ + L      LR Q+++
Sbjct: 120 QYLLDDRPARIKELGVFGWKLRWQVMQ 146


>gi|71006194|ref|XP_757763.1| hypothetical protein UM01616.1 [Ustilago maydis 521]
 gi|46097136|gb|EAK82369.1| hypothetical protein UM01616.1 [Ustilago maydis 521]
          Length = 157

 Score = 92.4 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 27/87 (31%), Positives = 48/87 (55%)

Query: 9   KKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRF 68
            K + SG+ V  +  KT R + PN+    L S+ +++  + ++S  ALRS+++ GGLD +
Sbjct: 60  GKMIQSGHNVPKSRQKTARTWSPNIQSKKLWSNTLDRFVRAKVSTSALRSMDKMGGLDIY 119

Query: 69  LSNSKKENLSARMRTLRSQILKKMSEK 95
           L+ +  E L    R LR  +  ++  K
Sbjct: 120 LAKTSSEKLGEWGRNLRDTLALRLRSK 146


>gi|332289487|ref|YP_004420339.1| 50S ribosomal protein L28 [Gallibacterium anatis UMN179]
 gi|330432383|gb|AEC17442.1| 50S ribosomal protein L28 [Gallibacterium anatis UMN179]
          Length = 78

 Score = 92.4 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 28/75 (37%), Positives = 44/75 (58%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K    GN  SHA N TRRRFLPNL       +   +   LR++   +R ++
Sbjct: 1  MSRVCQVTGKRPAVGNNRSHAMNATRRRFLPNLHTHRFWVESENRFVTLRLTAKGMRIID 60

Query: 61 RQGGLDRFLSNSKKE 75
          ++G +D  L++ + +
Sbjct: 61 KKG-IDAVLADLRAK 74


>gi|119943848|ref|YP_941528.1| ribosomal protein L28 [Psychromonas ingrahamii 37]
 gi|166226607|sp|A1SR14|RL28_PSYIN RecName: Full=50S ribosomal protein L28
 gi|119862452|gb|ABM01929.1| LSU ribosomal protein L28P [Psychromonas ingrahamii 37]
          Length = 78

 Score = 92.4 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 29/75 (38%), Positives = 47/75 (62%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K    GN VSHA N+TRRRFLPNL       +   +  +LR++   +R ++
Sbjct: 1  MSRVCQVTGKRPAVGNNVSHAKNRTRRRFLPNLQTHRFWVESENRFVKLRLTTKGMRIID 60

Query: 61 RQGGLDRFLSNSKKE 75
          ++G +D  L++ + +
Sbjct: 61 KKG-IDSVLTDIRAK 74


>gi|242050462|ref|XP_002462975.1| hypothetical protein SORBIDRAFT_02g035620 [Sorghum bicolor]
 gi|241926352|gb|EER99496.1| hypothetical protein SORBIDRAFT_02g035620 [Sorghum bicolor]
          Length = 210

 Score = 92.0 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 24/94 (25%), Positives = 48/94 (51%), Gaps = 1/94 (1%)

Query: 2   SRVCELTKKTVMSGNKVSH-ANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
           ++      + +  GNKVS    NK+RR + PN+    L S I ++  +++++  ALR ++
Sbjct: 44  AKRGIFAGRHIRFGNKVSEDGGNKSRRSWKPNVQEKRLFSYIHDRHIRVKVTTHALRCID 103

Query: 61  RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSE 94
           + GG+D +L  +    +   M  +    ++KM  
Sbjct: 104 KAGGIDEYLLKTPYNKMDTEMGIVWKAKIEKMYS 137


>gi|284041382|ref|YP_003391312.1| ribosomal protein L28 [Spirosoma linguale DSM 74]
 gi|283820675|gb|ADB42513.1| ribosomal protein L28 [Spirosoma linguale DSM 74]
          Length = 79

 Score = 92.0 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 27/75 (36%), Positives = 46/75 (61%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVC++T K   +GN VSHANNKT+R+F PNL +     +   +   LR++  A++++ 
Sbjct: 1  MARVCQITGKRTRTGNNVSHANNKTKRKFFPNLQKKRFFVESTGEWVTLRVATSAIKTIN 60

Query: 61 RQGGLDRFLSNSKKE 75
          + G L+  L  + + 
Sbjct: 61 KNG-LEATLQKAYER 74


>gi|284008823|emb|CBA75592.1| 50S ribosomal protein L28 [Arsenophonus nasoniae]
          Length = 78

 Score = 92.0 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 30/75 (40%), Positives = 46/75 (61%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  MSGN  SHA N T+RRFLPNL       +  ++  +LR+S   +R ++
Sbjct: 1  MSRVCQVTGKRPMSGNNRSHAMNATKRRFLPNLHSHRFWVESEKRFVKLRVSAKGMRIID 60

Query: 61 RQGGLDRFLSNSKKE 75
          ++G +D  L+  +  
Sbjct: 61 KKG-IDAVLAELRAR 74


>gi|253991843|ref|YP_003043199.1| 50S ribosomal protein L28 [Photorhabdus asymbiotica subsp.
          asymbiotica ATCC 43949]
 gi|268593308|ref|ZP_06127529.1| ribosomal protein L28 [Providencia rettgeri DSM 1131]
 gi|253783293|emb|CAQ86458.1| 50s ribosomal protein l28 [Photorhabdus asymbiotica]
 gi|291311005|gb|EFE51458.1| ribosomal protein L28 [Providencia rettgeri DSM 1131]
          Length = 78

 Score = 92.0 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 30/75 (40%), Positives = 45/75 (60%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  MSGN  SHA N T+RRFLPNL       +  ++   LR+S   +R ++
Sbjct: 1  MSRVCQVTGKRPMSGNNRSHALNATKRRFLPNLHSHRFWVESEKRFVTLRVSAKGMRVID 60

Query: 61 RQGGLDRFLSNSKKE 75
          ++G +D  L+  +  
Sbjct: 61 KKG-IDAVLAELRTR 74


>gi|261199896|ref|XP_002626349.1| 50S ribosomal protein L24 [Ajellomyces dermatitidis SLH14081]
 gi|239594557|gb|EEQ77138.1| 50S ribosomal protein L24 [Ajellomyces dermatitidis SLH14081]
 gi|239607948|gb|EEQ84935.1| 50S ribosomal protein L24 [Ajellomyces dermatitidis ER-3]
 gi|327350437|gb|EGE79294.1| 50S ribosomal protein L24 [Ajellomyces dermatitidis ATCC 18188]
          Length = 193

 Score = 92.0 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 25/92 (27%), Positives = 49/92 (53%), Gaps = 5/92 (5%)

Query: 9   KKTVMSGNKVSHANNK--TRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLD 66
              +  GNK+S   NK  TRR + PN+    L S+ + +  +L++    LR++++ GGLD
Sbjct: 69  GSRIQFGNKISKGRNKGKTRRTWKPNIRHEELYSEALGKTLKLKVQHRVLRTIKKVGGLD 128

Query: 67  RFLSN---SKKENLSARMRTLRSQILKKMSEK 95
           ++L     ++ + L      LR ++++  + K
Sbjct: 129 QYLLGDKPARIKELGVFGWNLRWKVMRSKAMK 160


>gi|262273496|ref|ZP_06051310.1| LSU ribosomal protein L28p [Grimontia hollisae CIP 101886]
 gi|262222474|gb|EEY73785.1| LSU ribosomal protein L28p [Grimontia hollisae CIP 101886]
          Length = 78

 Score = 92.0 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 28/75 (37%), Positives = 47/75 (62%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  + GN  SHANN T+RRFLPNL       +  ++  +LR++   +R ++
Sbjct: 1  MSRVCQVTGKRPVVGNNRSHANNATKRRFLPNLQTHRFWVESEKRFVKLRLTPKGMRIID 60

Query: 61 RQGGLDRFLSNSKKE 75
          ++G +D  L++ +  
Sbjct: 61 KKG-IDAVLADIRAR 74


>gi|119475391|ref|ZP_01615744.1| 50S ribosomal subunit protein L28 [marine gamma proteobacterium
          HTCC2143]
 gi|119451594|gb|EAW32827.1| 50S ribosomal subunit protein L28 [marine gamma proteobacterium
          HTCC2143]
          Length = 78

 Score = 92.0 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 31/75 (41%), Positives = 49/75 (65%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  ++GN VSHA N+TRRRFLPNL R     +  ++   LR+S   +R ++
Sbjct: 1  MSRVCQVTGKRPITGNNVSHAKNRTRRRFLPNLHRHRFWVESEKRFVSLRVSAKGMRIID 60

Query: 61 RQGGLDRFLSNSKKE 75
          ++G +D  L++ +  
Sbjct: 61 KKG-IDSVLTDVRAR 74


>gi|296808247|ref|XP_002844462.1| 54S ribosomal protein L24 [Arthroderma otae CBS 113480]
 gi|238843945|gb|EEQ33607.1| 54S ribosomal protein L24 [Arthroderma otae CBS 113480]
          Length = 232

 Score = 92.0 bits (228), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 25/92 (27%), Positives = 51/92 (55%), Gaps = 5/92 (5%)

Query: 9   KKTVMSGNKVSHANNK--TRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLD 66
             T++ GNK+S   NK  TRR + PN+ +  + S  ++++  L+++   LR++ + GGLD
Sbjct: 71  GATIIFGNKISKGRNKGKTRRIWKPNVRKEKVYSKALDEELDLKVTHRVLRTINKVGGLD 130

Query: 67  RFLSN---SKKENLSARMRTLRSQILKKMSEK 95
            +L     ++ + L      LR +++  ++ K
Sbjct: 131 EYLLGDKPARIKELGMFGWKLRWRVMTSLAMK 162


>gi|6323847|ref|NP_013918.1| Mrpl24p [Saccharomyces cerevisiae S288c]
 gi|1350795|sp|P36525|RM24_YEAST RecName: Full=54S ribosomal protein L24, mitochondrial; AltName:
           Full=YmL14/YmL24; Flags: Precursor
 gi|642285|emb|CAA87814.1| ribosomal protein [Saccharomyces cerevisiae]
 gi|45269854|gb|AAS56308.1| YMR193W [Saccharomyces cerevisiae]
 gi|285814196|tpg|DAA10091.1| TPA: Mrpl24p [Saccharomyces cerevisiae S288c]
          Length = 258

 Score = 92.0 bits (228), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 24/89 (26%), Positives = 52/89 (58%), Gaps = 3/89 (3%)

Query: 9   KKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRF 68
              V  GN +S +  KTR+++LPN+ +  L S+ + +K  ++++   L+++ ++GG+D +
Sbjct: 76  GSFVQFGNNISESKAKTRKKWLPNVVKKGLWSETLNRKISIKMTAKVLKTISKEGGIDNY 135

Query: 69  LSN---SKKENLSARMRTLRSQILKKMSE 94
           L+    ++ + L      LR ++LK+  E
Sbjct: 136 LTKEKSARIKELGPTGWKLRYRVLKRKDE 164


>gi|151945896|gb|EDN64128.1| YmL14 [Saccharomyces cerevisiae YJM789]
 gi|190408418|gb|EDV11683.1| 60S ribosomal protein L24, mitochondrial precursor [Saccharomyces
           cerevisiae RM11-1a]
 gi|256271573|gb|EEU06615.1| Mrpl24p [Saccharomyces cerevisiae JAY291]
 gi|259148778|emb|CAY82023.1| Mrpl24p [Saccharomyces cerevisiae EC1118]
 gi|323336086|gb|EGA77359.1| Mrpl24p [Saccharomyces cerevisiae Vin13]
 gi|323347014|gb|EGA81290.1| Mrpl24p [Saccharomyces cerevisiae Lalvin QA23]
          Length = 258

 Score = 91.6 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 24/89 (26%), Positives = 52/89 (58%), Gaps = 3/89 (3%)

Query: 9   KKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRF 68
              V  GN +S +  KTR+++LPN+ +  L S+ + +K  ++++   L+++ ++GG+D +
Sbjct: 76  GSFVQFGNNISESKAKTRKKWLPNVVKKGLWSETLNRKISIKMTAKVLKTISKEGGIDNY 135

Query: 69  LSN---SKKENLSARMRTLRSQILKKMSE 94
           L+    ++ + L      LR ++LK+  E
Sbjct: 136 LTKEKSARIKELGPTGWKLRYRVLKRKDE 164


>gi|88813415|ref|ZP_01128651.1| Ribosomal protein L28 [Nitrococcus mobilis Nb-231]
 gi|88789286|gb|EAR20417.1| Ribosomal protein L28 [Nitrococcus mobilis Nb-231]
          Length = 78

 Score = 91.6 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 27/63 (42%), Positives = 42/63 (66%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M++VC++T K   +GN VSHANNKT+RRFLPNL       +  ++  +LR+S   +R ++
Sbjct: 1  MAKVCQVTGKRPTTGNNVSHANNKTKRRFLPNLHYHRFWVETEQRWVRLRVSSKGMRIID 60

Query: 61 RQG 63
          + G
Sbjct: 61 KIG 63


>gi|302658408|ref|XP_003020908.1| hypothetical protein TRV_04984 [Trichophyton verrucosum HKI 0517]
 gi|291184778|gb|EFE40290.1| hypothetical protein TRV_04984 [Trichophyton verrucosum HKI 0517]
          Length = 339

 Score = 91.6 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 25/92 (27%), Positives = 52/92 (56%), Gaps = 5/92 (5%)

Query: 9   KKTVMSGNKVSHANNK--TRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLD 66
             T++ GNK+S   NK  TRR + PN+ +  + S  ++++ +L+++   LR++ + GGLD
Sbjct: 178 GATIIFGNKISKGRNKGKTRRIWKPNVRKEKIYSKALDEEIELKVTHGVLRTINKVGGLD 237

Query: 67  RFLSN---SKKENLSARMRTLRSQILKKMSEK 95
            +L     ++ + L      LR +++  ++ K
Sbjct: 238 EYLLGDKPARIKELGMFGWKLRWRVMTSLAMK 269


>gi|189501983|ref|YP_001957700.1| hypothetical protein Aasi_0570 [Candidatus Amoebophilus asiaticus
          5a2]
 gi|226738025|sp|B3ERW9|RL28_AMOA5 RecName: Full=50S ribosomal protein L28
 gi|189497424|gb|ACE05971.1| hypothetical protein Aasi_0570 [Candidatus Amoebophilus asiaticus
          5a2]
          Length = 83

 Score = 91.6 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 29/66 (43%), Positives = 40/66 (60%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS+VC++T K    GNKVSHANNKT+RRF PNL               LR+S   +R++ 
Sbjct: 1  MSKVCDITGKRPRVGNKVSHANNKTKRRFYPNLQFKKFYVPETNSWIVLRVSTSVIRTIN 60

Query: 61 RQGGLD 66
          ++G L+
Sbjct: 61 KKGILE 66


>gi|94499875|ref|ZP_01306411.1| ribosomal protein L28 [Oceanobacter sp. RED65]
 gi|94428076|gb|EAT13050.1| ribosomal protein L28 [Oceanobacter sp. RED65]
          Length = 78

 Score = 91.6 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 27/75 (36%), Positives = 46/75 (61%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M++VC++T K  ++GN VSH+N KT+RRFLPNL       +   +  +LR S   +R ++
Sbjct: 1  MAKVCQVTGKRPVTGNNVSHSNIKTKRRFLPNLQTHRFWVESENRFVKLRTSTKGMRIID 60

Query: 61 RQGGLDRFLSNSKKE 75
          ++G +D  L+  +  
Sbjct: 61 KKG-IDTVLAELRAR 74


>gi|90415485|ref|ZP_01223419.1| 50S ribosomal protein L28 [marine gamma proteobacterium HTCC2207]
 gi|90332808|gb|EAS47978.1| 50S ribosomal protein L28 [marine gamma proteobacterium HTCC2207]
          Length = 78

 Score = 91.6 bits (227), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 28/63 (44%), Positives = 42/63 (66%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  M+GN VSHA N+TRRRF PNL       +  ++  +LR+S   +R ++
Sbjct: 1  MSRVCQVTGKRPMAGNNVSHAKNRTRRRFEPNLHSHRFWVEAEKRFVKLRVSTKGMRIID 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|329296439|ref|ZP_08253775.1| 50S ribosomal protein L28 [Plautia stali symbiont]
          Length = 78

 Score = 91.3 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 28/75 (37%), Positives = 45/75 (60%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  ++GN  SHA N T+RRFLPNL       +  ++   LR+S   +R ++
Sbjct: 1  MSRVCQVTGKRPVTGNNRSHAMNATKRRFLPNLHSHRFWVESEKRFVTLRVSAKGMRVID 60

Query: 61 RQGGLDRFLSNSKKE 75
          ++G +D  L+  +  
Sbjct: 61 KKG-IDTVLAEIRAR 74


>gi|254567473|ref|XP_002490847.1| 54S ribosomal protein L24, mitochondrial [Pichia pastoris GS115]
 gi|238030643|emb|CAY68567.1| 54S ribosomal protein L24, mitochondrial [Pichia pastoris GS115]
 gi|328351230|emb|CCA37630.1| 54S ribosomal protein L24, mitochondrial [Pichia pastoris CBS 7435]
          Length = 248

 Score = 91.3 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 23/90 (25%), Positives = 50/90 (55%), Gaps = 3/90 (3%)

Query: 9   KKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRF 68
            + +  GNK+S   NK  R++  N+   +L S+I+ +  +++++   LR++ ++GGLD++
Sbjct: 73  GQFLQFGNKISEFKNKNGRKWSLNVHTKSLWSEILNKSIRVKLTARVLRTINKEGGLDQY 132

Query: 69  LSN---SKKENLSARMRTLRSQILKKMSEK 95
           L     ++ + L      L+ Q+L K   +
Sbjct: 133 LLKDKSARIKELGPTGWKLKFQLLTKKENQ 162


>gi|254515837|ref|ZP_05127897.1| ribosomal protein L28 [gamma proteobacterium NOR5-3]
 gi|219675559|gb|EED31925.1| ribosomal protein L28 [gamma proteobacterium NOR5-3]
          Length = 78

 Score = 91.3 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 29/75 (38%), Positives = 48/75 (64%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVC++T K  ++GN VSHA N+TRRRFLPNL +     +  ++  +LR+S   +R ++
Sbjct: 1  MARVCQVTGKRPVTGNNVSHAKNRTRRRFLPNLHQHRFWVESEKRFVRLRVSSKGMRIID 60

Query: 61 RQGGLDRFLSNSKKE 75
          ++G +D  L   +  
Sbjct: 61 KKG-IDSVLGELRAR 74


>gi|302498845|ref|XP_003011419.1| hypothetical protein ARB_02269 [Arthroderma benhamiae CBS 112371]
 gi|291174970|gb|EFE30779.1| hypothetical protein ARB_02269 [Arthroderma benhamiae CBS 112371]
          Length = 280

 Score = 91.3 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 25/92 (27%), Positives = 52/92 (56%), Gaps = 5/92 (5%)

Query: 9   KKTVMSGNKVSHANNK--TRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLD 66
             T++ GNK+S   NK  TRR + PN+ +  + S  ++++ +L+++   LR++ + GGLD
Sbjct: 119 GATIIFGNKISKGRNKGKTRRIWKPNVRKEKIYSKALDEEIELKVTHGVLRTINKVGGLD 178

Query: 67  RFLSN---SKKENLSARMRTLRSQILKKMSEK 95
            +L     ++ + L      LR +++  ++ K
Sbjct: 179 EYLLGDKPARIKELGMFGWKLRWRVMTSLAMK 210


>gi|317050106|ref|YP_004117754.1| 50S ribosomal protein L28 [Pantoea sp. At-9b]
 gi|316951723|gb|ADU71198.1| ribosomal protein L28 [Pantoea sp. At-9b]
          Length = 78

 Score = 91.3 bits (226), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 28/75 (37%), Positives = 45/75 (60%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  ++GN  SHA N T+RRFLPNL       +  ++   LR+S   +R ++
Sbjct: 1  MSRVCQVTGKRPVTGNNRSHALNATKRRFLPNLHSHRFWVESEKRFVTLRVSAKGMRVID 60

Query: 61 RQGGLDRFLSNSKKE 75
          ++G +D  L+  +  
Sbjct: 61 KKG-IDTVLAEIRAR 74


>gi|148906245|gb|ABR16278.1| unknown [Picea sitchensis]
          Length = 222

 Score = 91.3 bits (226), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 22/97 (22%), Positives = 46/97 (47%), Gaps = 1/97 (1%)

Query: 2   SRVCELTKKTVMSGNKVSH-ANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
           ++      + +  GN +S    NKTRR + PN+    L S I+++  +++++   LR ++
Sbjct: 43  AKRGLYGGRHIQFGNNISEDGGNKTRRTWKPNVQEKRLFSLILDRYIRIKVTTHTLRCID 102

Query: 61  RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKSS 97
           + G +D +L       L   +       +++  EK S
Sbjct: 103 KAGCIDDYLLQMPVRKLENELALFWKVKIQQQYEKLS 139


>gi|291300851|ref|YP_003512129.1| 50S ribosomal protein L28 [Stackebrandtia nassauensis DSM 44728]
 gi|290570071|gb|ADD43036.1| ribosomal protein L28 [Stackebrandtia nassauensis DSM 44728]
          Length = 78

 Score = 91.3 bits (226), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 24/74 (32%), Positives = 44/74 (59%), Gaps = 1/74 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+R C++T      GN VSH+ ++TRRR+ PNL R        ++  +LR+S  A+R+++
Sbjct: 1  MTRRCDVTGAGPGFGNSVSHSAHRTRRRWNPNLQRRRYWLPSQQRWIRLRVSAKAIRTID 60

Query: 61 RQGGLDRFLSNSKK 74
          R G ++  ++  + 
Sbjct: 61 RDG-IEAVIARVRA 73


>gi|226951952|ref|ZP_03822416.1| 50S ribosomal protein L28 [Acinetobacter sp. ATCC 27244]
 gi|294649214|ref|ZP_06726652.1| 50S ribosomal protein L28 [Acinetobacter haemolyticus ATCC 19194]
 gi|226837290|gb|EEH69673.1| 50S ribosomal protein L28 [Acinetobacter sp. ATCC 27244]
 gi|292824881|gb|EFF83646.1| 50S ribosomal protein L28 [Acinetobacter haemolyticus ATCC 19194]
          Length = 82

 Score = 90.9 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 26/63 (41%), Positives = 41/63 (65%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS+VC++T K  + GN VSHANNKT+RRF PNL       +  ++  +LR++   +R ++
Sbjct: 5  MSKVCQVTGKRPIVGNNVSHANNKTKRRFEPNLHHHRFWLESEKRFVRLRLTTKGMRIID 64

Query: 61 RQG 63
          + G
Sbjct: 65 KLG 67


>gi|262040686|ref|ZP_06013924.1| 50S ribosomal protein L28 [Klebsiella pneumoniae subsp.
          rhinoscleromatis ATCC 13884]
 gi|259042050|gb|EEW43083.1| 50S ribosomal protein L28 [Klebsiella pneumoniae subsp.
          rhinoscleromatis ATCC 13884]
          Length = 78

 Score = 90.9 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 27/75 (36%), Positives = 45/75 (60%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS+VC++T K  ++GN  SHA N T+RRFLPNL       +  ++   LR+S   +R ++
Sbjct: 1  MSQVCQVTGKRPVTGNNPSHALNATKRRFLPNLHSHRFWVESEKRFVTLRVSAKGMRVID 60

Query: 61 RQGGLDRFLSNSKKE 75
          ++G +D  L+  +  
Sbjct: 61 KKG-IDTVLAELRAR 74


>gi|225559900|gb|EEH08182.1| 50S ribosomal protein L24 [Ajellomyces capsulatus G186AR]
 gi|225559950|gb|EEH08232.1| 50S ribosomal protein L24 [Ajellomyces capsulatus G186AR]
          Length = 187

 Score = 90.9 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 26/92 (28%), Positives = 50/92 (54%), Gaps = 5/92 (5%)

Query: 9   KKTVMSGNKVSHANNK--TRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLD 66
             T+  GNK+S   NK  TRR + PN+    L S+ + +  QL++    LR++++ GGLD
Sbjct: 63  GSTIQFGNKISKGRNKGKTRRTWKPNIRHEELYSEALGKTLQLKVQHRVLRTIKKVGGLD 122

Query: 67  RFLSN---SKKENLSARMRTLRSQILKKMSEK 95
           ++L     ++ + L      LR ++++  + +
Sbjct: 123 QYLLGDKPARIKELGIFGWNLRWKVMQSKAMQ 154


>gi|88705461|ref|ZP_01103172.1| 50S ribosomal protein L28 [Congregibacter litoralis KT71]
 gi|88700551|gb|EAQ97659.1| 50S ribosomal protein L28 [Congregibacter litoralis KT71]
          Length = 78

 Score = 90.9 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 32/84 (38%), Positives = 51/84 (60%), Gaps = 6/84 (7%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVC++T K  ++GN VSHA N+TRRRFLPNL +     +  ++  +LR+S   +R ++
Sbjct: 1  MARVCQVTGKRPVTGNNVSHAKNRTRRRFLPNLHQHRFWVESEKRFVRLRVSSKGMRIID 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTL 84
          ++G +D  L       L AR   +
Sbjct: 61 KKG-IDTVL-----GELRARGEKV 78


>gi|312882920|ref|ZP_07742652.1| 50S ribosomal protein L28 [Vibrio caribbenthicus ATCC BAA-2122]
 gi|323495230|ref|ZP_08100312.1| 50S ribosomal protein L28 [Vibrio brasiliensis LMG 20546]
 gi|323497064|ref|ZP_08102087.1| 50S ribosomal protein L28 [Vibrio sinaloensis DSM 21326]
 gi|309369439|gb|EFP96959.1| 50S ribosomal protein L28 [Vibrio caribbenthicus ATCC BAA-2122]
 gi|323310490|gb|EGA63672.1| 50S ribosomal protein L28 [Vibrio brasiliensis LMG 20546]
 gi|323317908|gb|EGA70896.1| 50S ribosomal protein L28 [Vibrio sinaloensis DSM 21326]
          Length = 78

 Score = 90.9 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 28/75 (37%), Positives = 47/75 (62%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  ++GN  SHA N T+RRFLPNL       +  ++  +LR+S   +R ++
Sbjct: 1  MSRVCQVTGKRPVTGNNRSHARNATKRRFLPNLQTHRFWVESEKRFVKLRLSAKGMRIID 60

Query: 61 RQGGLDRFLSNSKKE 75
          ++G +D  L++ +  
Sbjct: 61 KKG-IDAVLADIRAN 74


>gi|330794352|ref|XP_003285243.1| hypothetical protein DICPUDRAFT_22474 [Dictyostelium purpureum]
 gi|325084785|gb|EGC38205.1| hypothetical protein DICPUDRAFT_22474 [Dictyostelium purpureum]
          Length = 127

 Score = 90.9 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 22/96 (22%), Positives = 50/96 (52%), Gaps = 1/96 (1%)

Query: 2   SRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVER 61
           ++      K ++ GN +S +N KTRR + PN+   T  S+++    ++R++   +R +++
Sbjct: 19  AQRGLYGGKDILFGNILSFSNKKTRRDWKPNVHNKTYHSNLLGTDIRVRVTSYVIRCIDK 78

Query: 62  QGGLDRFLSNSKKENL-SARMRTLRSQILKKMSEKS 96
            G  D ++  +K ++L S     L+  +   +  K+
Sbjct: 79  AGSFDNYIVQTKDKDLQSELGSELKVAMKNVLKSKA 114


>gi|113460291|ref|YP_718350.1| 50S ribosomal protein L28 [Haemophilus somnus 129PT]
 gi|170717208|ref|YP_001783365.1| 50S ribosomal protein L28 [Haemophilus somnus 2336]
 gi|122945106|sp|Q0I0X8|RL28_HAES1 RecName: Full=50S ribosomal protein L28
 gi|189029444|sp|B0UUW8|RL28_HAES2 RecName: Full=50S ribosomal protein L28
 gi|112822334|gb|ABI24423.1| LSU ribosomal protein L28P [Haemophilus somnus 129PT]
 gi|168825337|gb|ACA30708.1| ribosomal protein L28 [Haemophilus somnus 2336]
          Length = 78

 Score = 90.9 bits (225), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 28/75 (37%), Positives = 43/75 (57%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K    GN  SHA N TRRRFLPNL       +  ++   LR++   +R ++
Sbjct: 1  MSRVCQVTGKRPAVGNNRSHAMNATRRRFLPNLHTHRFWVESEKRFVTLRLTAKGMRIID 60

Query: 61 RQGGLDRFLSNSKKE 75
          ++G +D  L+  +  
Sbjct: 61 KKG-IDAVLAEIRAR 74


>gi|329896523|ref|ZP_08271581.1| LSU ribosomal protein L28p [gamma proteobacterium IMCC3088]
 gi|328921740|gb|EGG29113.1| LSU ribosomal protein L28p [gamma proteobacterium IMCC3088]
          Length = 78

 Score = 90.9 bits (225), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 30/75 (40%), Positives = 48/75 (64%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  ++GN VSHA N+TRRRFLPNL       +  ++  +LR+S   +R ++
Sbjct: 1  MSRVCQVTGKRPVTGNNVSHAKNRTRRRFLPNLHSHRFWVESEKRFVRLRVSSKGMRVID 60

Query: 61 RQGGLDRFLSNSKKE 75
          ++G +D  L+  +  
Sbjct: 61 KRG-IDTVLAELRAR 74


>gi|319775113|ref|YP_004137601.1| 50S ribosomal subunit protein L28 [Haemophilus influenzae F3047]
 gi|329122973|ref|ZP_08251544.1| 50S ribosomal protein L28 [Haemophilus aegyptius ATCC 11116]
 gi|317449704|emb|CBY85911.1| 50S ribosomal subunit protein L28 [Haemophilus influenzae F3047]
 gi|327471904|gb|EGF17344.1| 50S ribosomal protein L28 [Haemophilus aegyptius ATCC 11116]
          Length = 78

 Score = 90.9 bits (225), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 27/75 (36%), Positives = 41/75 (54%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K    GN  SHA N  RRRFLPNL       +   +   LR++   +R ++
Sbjct: 1  MSRVCQVTGKRPAVGNNRSHAMNAARRRFLPNLHTHRFWVESENRFVTLRLTAKGMRIID 60

Query: 61 RQGGLDRFLSNSKKE 75
          ++G +D  L+  +  
Sbjct: 61 KKG-IDAVLAEIRAR 74


>gi|260779660|ref|ZP_05888550.1| LSU ribosomal protein L28p [Vibrio coralliilyticus ATCC BAA-450]
 gi|261250534|ref|ZP_05943109.1| LSU ribosomal protein L28p [Vibrio orientalis CIP 102891]
 gi|260604469|gb|EEX30773.1| LSU ribosomal protein L28p [Vibrio coralliilyticus ATCC BAA-450]
 gi|260939103|gb|EEX95090.1| LSU ribosomal protein L28p [Vibrio orientalis CIP 102891]
          Length = 78

 Score = 90.5 bits (224), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 28/75 (37%), Positives = 46/75 (61%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  ++GN  SHA N T+RRFLPNL       +  ++  +LR+S   +R ++
Sbjct: 1  MSRVCQVTGKRPVTGNNRSHARNATKRRFLPNLQTHRFWVESEKRFVKLRLSAKGMRIID 60

Query: 61 RQGGLDRFLSNSKKE 75
          ++G +D  L + +  
Sbjct: 61 KKG-IDAVLVDIRAN 74


>gi|110833076|ref|YP_691935.1| 50S ribosomal protein L28 [Alcanivorax borkumensis SK2]
 gi|123345877|sp|Q0VT57|RL28_ALCBS RecName: Full=50S ribosomal protein L28
 gi|110646187|emb|CAL15663.1| ribosomal protein L28 [Alcanivorax borkumensis SK2]
          Length = 78

 Score = 90.5 bits (224), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 27/75 (36%), Positives = 49/75 (65%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS+VC++T K  ++GN+VSH+N KT+RRF PNL       +  ++  +LR+S   +R ++
Sbjct: 1  MSKVCQVTGKRPVTGNRVSHSNIKTKRRFEPNLHHHRFWVESEKRFVRLRVSSKGMRIID 60

Query: 61 RQGGLDRFLSNSKKE 75
          ++G +D  L++ +  
Sbjct: 61 KKG-IDSVLADIRSR 74


>gi|15603016|ref|NP_246088.1| 50S ribosomal protein L28 [Pasteurella multocida subsp. multocida
          str. Pm70]
 gi|260912779|ref|ZP_05919265.1| 50S ribosomal protein L28 [Pasteurella dagmatis ATCC 43325]
 gi|14195119|sp|Q9CLR1|RL28_PASMU RecName: Full=50S ribosomal protein L28
 gi|12721499|gb|AAK03235.1| RpL28 [Pasteurella multocida subsp. multocida str. Pm70]
 gi|260633157|gb|EEX51322.1| 50S ribosomal protein L28 [Pasteurella dagmatis ATCC 43325]
          Length = 78

 Score = 90.5 bits (224), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 27/75 (36%), Positives = 44/75 (58%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K    GN  SHA N T+RRFLPNL       +  ++   LR++   +R ++
Sbjct: 1  MSRVCQVTGKRPAVGNNRSHAMNATKRRFLPNLHTHRFWVESEKRFVTLRLTAKGMRIID 60

Query: 61 RQGGLDRFLSNSKKE 75
          ++G +D  L++ +  
Sbjct: 61 KKG-IDAVLADIRAR 74


>gi|240276199|gb|EER39711.1| 50S ribosomal protein L24 [Ajellomyces capsulatus H143]
 gi|325089935|gb|EGC43245.1| 50S ribosomal protein [Ajellomyces capsulatus H88]
          Length = 187

 Score = 90.5 bits (224), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 26/92 (28%), Positives = 50/92 (54%), Gaps = 5/92 (5%)

Query: 9   KKTVMSGNKVSHANNK--TRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLD 66
             T+  GNK+S   NK  TRR + PN+    L S+ + +  QL++    LR++++ GGLD
Sbjct: 63  GSTIQFGNKISKGRNKGKTRRTWKPNIRHEELYSEALGKTLQLKVQHRVLRTIKKVGGLD 122

Query: 67  RFLSN---SKKENLSARMRTLRSQILKKMSEK 95
           ++L     ++ + L      LR ++++  + +
Sbjct: 123 QYLLGDKPARIKELGIFGWNLRWKVMQSKAMQ 154


>gi|290477299|ref|YP_003470220.1| 50S ribosomal subunit protein L28 [Xenorhabdus bovienii SS-2004]
 gi|289176653|emb|CBJ83462.1| 50S ribosomal subunit protein L28 [Xenorhabdus bovienii SS-2004]
          Length = 78

 Score = 90.5 bits (224), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 28/75 (37%), Positives = 45/75 (60%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  +SGN  SHA N T+RRFLPNL       +  ++   LR++   +R ++
Sbjct: 1  MSRVCQVTGKRPVSGNNRSHALNATKRRFLPNLHSHRFWVESEKRFVTLRVTAKGMRVID 60

Query: 61 RQGGLDRFLSNSKKE 75
          ++G +D  L+  +  
Sbjct: 61 KKG-IDVVLAELRAR 74


>gi|254427932|ref|ZP_05041639.1| ribosomal protein L28 [Alcanivorax sp. DG881]
 gi|196194101|gb|EDX89060.1| ribosomal protein L28 [Alcanivorax sp. DG881]
          Length = 78

 Score = 90.5 bits (224), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 28/75 (37%), Positives = 49/75 (65%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS+VC++T K  ++GN+VSH+N KT+RRF PNL       +  ++  +LR+S   +R ++
Sbjct: 1  MSKVCQVTGKRPVTGNRVSHSNIKTKRRFEPNLHHHRFWVESEKRFVRLRVSSKGMRIID 60

Query: 61 RQGGLDRFLSNSKKE 75
          ++G +D  LS+ +  
Sbjct: 61 KKG-IDSVLSDIRSR 74


>gi|37528673|ref|NP_932018.1| 50S ribosomal protein L28 [Photorhabdus luminescens subsp.
          laumondii TTO1]
 gi|67461490|sp|Q7MY29|RL28_PHOLL RecName: Full=50S ribosomal protein L28
 gi|36788112|emb|CAE17236.1| 50S ribosomal protein L28 [Photorhabdus luminescens subsp.
          laumondii TTO1]
          Length = 78

 Score = 90.5 bits (224), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 30/75 (40%), Positives = 45/75 (60%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  MSGN  SHA N T+RRFLPNL       +  ++   LR+S   +R ++
Sbjct: 1  MSRVCQVTGKRPMSGNNRSHALNATKRRFLPNLHSHRFWVESEKRFVTLRVSVKGMRVID 60

Query: 61 RQGGLDRFLSNSKKE 75
          ++G +D  L+  +  
Sbjct: 61 KKG-IDAVLAELRTR 74


>gi|15804178|ref|NP_290217.1| 50S ribosomal protein L28 [Escherichia coli O157:H7 EDL933]
 gi|15833766|ref|NP_312539.1| 50S ribosomal protein L28 [Escherichia coli O157:H7 str. Sakai]
 gi|16131508|ref|NP_418094.1| 50S ribosomal subunit protein L28 [Escherichia coli str. K-12
          substr. MG1655]
 gi|24114906|ref|NP_709416.1| 50S ribosomal protein L28 [Shigella flexneri 2a str. 301]
 gi|26250283|ref|NP_756323.1| 50S ribosomal protein L28 [Escherichia coli CFT073]
 gi|30065087|ref|NP_839258.1| 50S ribosomal protein L28 [Shigella flexneri 2a str. 2457T]
 gi|74314129|ref|YP_312548.1| 50S ribosomal protein L28 [Shigella sonnei Ss046]
 gi|82779127|ref|YP_405476.1| 50S ribosomal protein L28 [Shigella dysenteriae Sd197]
 gi|89110374|ref|AP_004154.1| 50S ribosomal subunit protein L28 [Escherichia coli str. K-12
          substr. W3110]
 gi|91213154|ref|YP_543140.1| 50S ribosomal protein L28 [Escherichia coli UTI89]
 gi|110643878|ref|YP_671608.1| 50S ribosomal protein L28 [Escherichia coli 536]
 gi|152972483|ref|YP_001337629.1| 50S ribosomal protein L28 [Klebsiella pneumoniae subsp.
          pneumoniae MGH 78578]
 gi|157155847|ref|YP_001465117.1| 50S ribosomal protein L28 [Escherichia coli E24377A]
 gi|157163118|ref|YP_001460436.1| 50S ribosomal protein L28 [Escherichia coli HS]
 gi|168748715|ref|ZP_02773737.1| ribosomal protein L28 [Escherichia coli O157:H7 str. EC4113]
 gi|168753461|ref|ZP_02778468.1| ribosomal protein L28 [Escherichia coli O157:H7 str. EC4401]
 gi|168759734|ref|ZP_02784741.1| ribosomal protein L28 [Escherichia coli O157:H7 str. EC4501]
 gi|168766057|ref|ZP_02791064.1| ribosomal protein L28 [Escherichia coli O157:H7 str. EC4486]
 gi|168772397|ref|ZP_02797404.1| ribosomal protein L28 [Escherichia coli O157:H7 str. EC4196]
 gi|168779792|ref|ZP_02804799.1| ribosomal protein L28 [Escherichia coli O157:H7 str. EC4076]
 gi|168785513|ref|ZP_02810520.1| ribosomal protein L28 [Escherichia coli O157:H7 str. EC869]
 gi|168798582|ref|ZP_02823589.1| ribosomal protein L28 [Escherichia coli O157:H7 str. EC508]
 gi|170018133|ref|YP_001723087.1| 50S ribosomal protein L28 [Escherichia coli ATCC 8739]
 gi|170083145|ref|YP_001732465.1| 50S ribosomal subunit protein L28 [Escherichia coli str. K-12
          substr. DH10B]
 gi|170680615|ref|YP_001745937.1| 50S ribosomal protein L28 [Escherichia coli SMS-3-5]
 gi|187732138|ref|YP_001882334.1| 50S ribosomal protein L28 [Shigella boydii CDC 3083-94]
 gi|188496045|ref|ZP_03003315.1| ribosomal protein L28 [Escherichia coli 53638]
 gi|191167810|ref|ZP_03029616.1| ribosomal protein L28 [Escherichia coli B7A]
 gi|191170547|ref|ZP_03032100.1| ribosomal protein L28 [Escherichia coli F11]
 gi|193063777|ref|ZP_03044864.1| ribosomal protein L28 [Escherichia coli E22]
 gi|193070349|ref|ZP_03051291.1| ribosomal protein L28 [Escherichia coli E110019]
 gi|194431236|ref|ZP_03063529.1| ribosomal protein L28 [Shigella dysenteriae 1012]
 gi|194435684|ref|ZP_03067787.1| ribosomal protein L28 [Escherichia coli 101-1]
 gi|195936198|ref|ZP_03081580.1| 50S ribosomal protein L28 [Escherichia coli O157:H7 str. EC4024]
 gi|208812807|ref|ZP_03254136.1| ribosomal protein L28 [Escherichia coli O157:H7 str. EC4045]
 gi|208818638|ref|ZP_03258958.1| ribosomal protein L28 [Escherichia coli O157:H7 str. EC4042]
 gi|209397282|ref|YP_002273115.1| ribosomal protein L28 [Escherichia coli O157:H7 str. EC4115]
 gi|209921108|ref|YP_002295192.1| 50S ribosomal protein L28 [Escherichia coli SE11]
 gi|215488916|ref|YP_002331347.1| 50S ribosomal protein L28 [Escherichia coli O127:H6 str.
          E2348/69]
 gi|217324332|ref|ZP_03440416.1| ribosomal protein L28 [Escherichia coli O157:H7 str. TW14588]
 gi|218551165|ref|YP_002384956.1| 50S ribosomal protein L28 [Escherichia fergusonii ATCC 35469]
 gi|218556199|ref|YP_002389112.1| 50S ribosomal protein L28 [Escherichia coli IAI1]
 gi|218560709|ref|YP_002393622.1| 50S ribosomal protein L28 [Escherichia coli S88]
 gi|218691921|ref|YP_002400133.1| 50S ribosomal protein L28 [Escherichia coli ED1a]
 gi|218697358|ref|YP_002405025.1| 50S ribosomal protein L28 [Escherichia coli 55989]
 gi|218702403|ref|YP_002410032.1| 50S ribosomal protein L28 [Escherichia coli IAI39]
 gi|218707271|ref|YP_002414790.1| 50S ribosomal protein L28 [Escherichia coli UMN026]
 gi|237703408|ref|ZP_04533889.1| 50S ribosomal subunit protein L28 [Escherichia sp. 3_2_53FAA]
 gi|238897078|ref|YP_002921824.1| 50S ribosomal protein L28 [Klebsiella pneumoniae NTUH-K2044]
 gi|238902728|ref|YP_002928524.1| 50S ribosomal subunit protein L28 [Escherichia coli BW2952]
 gi|253771522|ref|YP_003034353.1| 50S ribosomal protein L28 [Escherichia coli 'BL21-Gold(DE3)pLysS
          AG']
 gi|254038836|ref|ZP_04872888.1| ribosomal protein L28 [Escherichia sp. 1_1_43]
 gi|254163565|ref|YP_003046673.1| 50S ribosomal protein L28 [Escherichia coli B str. REL606]
 gi|254795592|ref|YP_003080429.1| 50S ribosomal protein L28 [Escherichia coli O157:H7 str. TW14359]
 gi|256021359|ref|ZP_05435224.1| 50S ribosomal protein L28 [Shigella sp. D9]
 gi|256025633|ref|ZP_05439498.1| 50S ribosomal protein L28 [Escherichia sp. 4_1_40B]
 gi|260846598|ref|YP_003224376.1| 50S ribosomal subunit protein L28 [Escherichia coli O103:H2 str.
          12009]
 gi|260857968|ref|YP_003231859.1| 50S ribosomal subunit protein L28 [Escherichia coli O26:H11 str.
          11368]
 gi|260870367|ref|YP_003236769.1| 50S ribosomal subunit protein L28 [Escherichia coli O111:H- str.
          11128]
 gi|261224180|ref|ZP_05938461.1| 50S ribosomal subunit protein L28 [Escherichia coli O157:H7 str.
          FRIK2000]
 gi|261254791|ref|ZP_05947324.1| 50S ribosomal subunit protein L28 [Escherichia coli O157:H7 str.
          FRIK966]
 gi|291285008|ref|YP_003501826.1| 50S ribosomal protein L28 [Escherichia coli O55:H7 str. CB9615]
 gi|293407260|ref|ZP_06651184.1| LSU ribosomal protein L28p [Escherichia coli FVEC1412]
 gi|293413071|ref|ZP_06655739.1| conserved hypothetical protein [Escherichia coli B354]
 gi|293417098|ref|ZP_06659725.1| large subunit ribosomal protein L28 [Escherichia coli B185]
 gi|293463961|ref|ZP_06664375.1| 50S ribosomal protein L28 [Escherichia coli B088]
 gi|297521447|ref|ZP_06939833.1| 50S ribosomal protein L28 [Escherichia coli OP50]
 gi|298383006|ref|ZP_06992601.1| 50S ribosomal protein L28 [Escherichia coli FVEC1302]
 gi|306816015|ref|ZP_07450153.1| 50S ribosomal protein L28 [Escherichia coli NC101]
 gi|307140335|ref|ZP_07499691.1| 50S ribosomal protein L28 [Escherichia coli H736]
 gi|307314278|ref|ZP_07593886.1| ribosomal protein L28 [Escherichia coli W]
 gi|331644355|ref|ZP_08345484.1| ribosomal protein L28 [Escherichia coli H736]
 gi|331649452|ref|ZP_08350538.1| ribosomal protein L28 [Escherichia coli M605]
 gi|331655269|ref|ZP_08356268.1| ribosomal protein L28 [Escherichia coli M718]
 gi|331659957|ref|ZP_08360895.1| ribosomal protein L28 [Escherichia coli TA206]
 gi|331665262|ref|ZP_08366163.1| ribosomal protein L28 [Escherichia coli TA143]
 gi|331670477|ref|ZP_08371316.1| ribosomal protein L28 [Escherichia coli TA271]
 gi|331675117|ref|ZP_08375874.1| ribosomal protein L28 [Escherichia coli TA280]
 gi|331679728|ref|ZP_08380398.1| ribosomal protein L28 [Escherichia coli H591]
 gi|331685300|ref|ZP_08385886.1| ribosomal protein L28 [Escherichia coli H299]
 gi|332282593|ref|ZP_08395006.1| 50S ribosomal subunit protein L28 [Shigella sp. D9]
 gi|67472014|sp|P0A7M2|RL28_ECOLI RecName: Full=50S ribosomal protein L28
 gi|67472015|sp|P0A7M3|RL28_ECOL6 RecName: Full=50S ribosomal protein L28
 gi|67472016|sp|P0A7M4|RL28_ECO57 RecName: Full=50S ribosomal protein L28
 gi|67472017|sp|P0A7M5|RL28_SHIFL RecName: Full=50S ribosomal protein L28
 gi|122421887|sp|Q1R4V5|RL28_ECOUT RecName: Full=50S ribosomal protein L28
 gi|123343463|sp|Q0TBH2|RL28_ECOL5 RecName: Full=50S ribosomal protein L28
 gi|123561125|sp|Q329M0|RL28_SHIDS RecName: Full=50S ribosomal protein L28
 gi|123615831|sp|Q3YVZ9|RL28_SHISS RecName: Full=50S ribosomal protein L28
 gi|166226582|sp|A6TFM8|RL28_KLEP7 RecName: Full=50S ribosomal protein L28
 gi|166987910|sp|A7ZTI8|RL28_ECO24 RecName: Full=50S ribosomal protein L28
 gi|166987911|sp|A8A699|RL28_ECOHS RecName: Full=50S ribosomal protein L28
 gi|189029439|sp|B1IZF6|RL28_ECOLC RecName: Full=50S ribosomal protein L28
 gi|226694559|sp|B7NPZ8|RL28_ECO7I RecName: Full=50S ribosomal protein L28
 gi|226694669|sp|B7M4C1|RL28_ECO8A RecName: Full=50S ribosomal protein L28
 gi|226694688|sp|B1X971|RL28_ECODH RecName: Full=50S ribosomal protein L28
 gi|226694704|sp|B7NEU1|RL28_ECOLU RecName: Full=50S ribosomal protein L28
 gi|226694756|sp|B6I3L4|RL28_ECOSE RecName: Full=50S ribosomal protein L28
 gi|226694761|sp|B1LK74|RL28_ECOSM RecName: Full=50S ribosomal protein L28
 gi|226694789|sp|B7LVJ8|RL28_ESCF3 RecName: Full=50S ribosomal protein L28
 gi|226699166|sp|B2TTV1|RL28_SHIB3 RecName: Full=50S ribosomal protein L28
 gi|226732829|sp|B7MFJ8|RL28_ECO45 RecName: Full=50S ribosomal protein L28
 gi|226732830|sp|B5YWD5|RL28_ECO5E RecName: Full=50S ribosomal protein L28
 gi|254801358|sp|B7ULJ2|RL28_ECO27 RecName: Full=50S ribosomal protein L28
 gi|254801359|sp|B7L760|RL28_ECO55 RecName: Full=50S ribosomal protein L28
 gi|254801360|sp|B7N277|RL28_ECO81 RecName: Full=50S ribosomal protein L28
 gi|259646735|sp|C4ZXM9|RL28_ECOBW RecName: Full=50S ribosomal protein L28
 gi|157836074|pdb|2QOV|Z Chain Z, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli In Complex With Spectinomycin. This
          File Contains The 50s Subunit Of The First 70s
          Ribosome. The Entire Crystal Structure Contains Two 70s
          Ribosomes.
 gi|157836126|pdb|2QOX|Z Chain Z, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli In Complex With Spectinomycin. This
          File Contains The 50s Subunit Of The Second 70s
          Ribosome. The Entire Crystal Structure Contains Two 70s
          Ribosomes.
 gi|157836178|pdb|2QOZ|Z Chain Z, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli In Complex With Spectinomycin And
          Neomycin. This File Contains The 50s Subunit Of The
          First 70s Ribosome, With Neomycin Bound. The Entire
          Crystal Structure Contains Two 70s Ribosomes.
 gi|157836230|pdb|2QP1|Z Chain Z, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli In Complex With Spectinomycin And
          Neomycin. This File Contains The 50s Subunit Of The
          Second 70s Ribosome, With Neomycin Bound. The Entire
          Crystal Structure Contains Two 70s Ribosomes.
 gi|158429749|pdb|2QAM|Z Chain Z, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli In Complex With Neomycin. This File
          Contains The 50s Subunit Of The First 70s Ribosome,
          With Neomycin Bound. The Entire Crystal Structure
          Contains Two 70s Ribosomes And Is Described In Remark
          400.
 gi|158429801|pdb|2QAO|Z Chain Z, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli In Complex With Neomycin. This File
          Contains The 50s Subunit Of The Second 70s Ribosome,
          With Neomycin Bound. The Entire Crystal Structure
          Contains Two 70s Ribosomes And Is Described In Remark
          400.
 gi|158429859|pdb|2QBA|Z Chain Z, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli In Complex With Gentamicin. This File
          Contains The 50s Subunit Of The First 70s Ribosome,
          With Gentamicin Bound. The Entire Crystal Structure
          Contains Two 70s Ribosomes And Is Described In Remark
          400.
 gi|158429911|pdb|2QBC|Z Chain Z, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli In Complex With Gentamicin. This File
          Contains The 50s Subunit Of The Second 70s Ribosome,
          With Gentamicin Bound. The Entire Crystal Structure
          Contains Two 70s Ribosomes And Is Described In Remark
          400.
 gi|158429963|pdb|2QBE|Z Chain Z, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli In Complex With Ribosome Recycling
          Factor (Rrf). This File Contains The 50s Subunit Of The
          First 70s Ribosome, With Rrf Bound. The Entire Crystal
          Structure Contains Two 70s Ribosomes And Is Described
          In Remark 400.
 gi|158430016|pdb|2QBG|Z Chain Z, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli In Complex With Ribosome Recycling
          Factor (Rrf). This File Contains The 50s Subunit Of The
          Second 70s Ribosome, With Rrf Bound. The Entire Crystal
          Structure Contains Two 70s Ribosomes And Is Described
          In Remark 400.
 gi|158430069|pdb|2QBI|Z Chain Z, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli In Complex With Gentamicin And
          Ribosome Recycling Factor (Rrf). This File Contains The
          50s Subunit Of The First 70s Ribosome, With Gentamicin
          And Rrf Bound. The Entire Crystal Structure Contains
          Two 70s Ribosomes And Is Described In Remark 400.
 gi|158430122|pdb|2QBK|Z Chain Z, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli In Complex With Gentamicin And
          Ribosome Recycling Factor (Rrf). This File Contains The
          50s Subunit Of The Second 70s Ribosome, With Gentamicin
          And Rrf Bound. The Entire Crystal Structure Contains
          Two 70s Ribosomes And Is Described In Remark 400.
 gi|158431422|pdb|2Z4L|Z Chain Z, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli In Complex With Paromomycin And
          Ribosome Recycling Factor (Rrf). This File Contains The
          50s Subunit Of The First 70s Ribosome, With Paromomycin
          And Rrf Bound. The Entire Crystal Structure Contains
          Two 70s Ribosomes And Is Described In Remark 400.
 gi|158431475|pdb|2Z4N|Z Chain Z, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli In Complex With Paromomycin And
          Ribosome Recycling Factor (Rrf). This File Contains The
          50s Subunit Of The Second 70s Ribosome, With
          Paromomycin And Rrf Bound. The Entire Crystal Structure
          Contains Two 70s Ribosomes And Is Described In Remark
          400.
 gi|197107324|pdb|3DF2|Z Chain Z, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli In Complex With Hygromycin B. This
          File Contains The 50s Subunit Of The First 70s
          Ribosome. The Entire Crystal Structure Contains Two 70s
          Ribosomes.
 gi|197107376|pdb|3DF4|Z Chain Z, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli In Complex With Hygromycin B. This
          File Contains The 50s Subunit Of The Second 70s
          Ribosome. The Entire Crystal Structure Contains Two 70s
          Ribosomes.
 gi|257097365|pdb|3I1N|X Chain X, Crystal Structure Of The E. Coli 70s Ribosome In An
          Intermediate State Of Ratcheting
 gi|257097417|pdb|3I1P|X Chain X, Crystal Structure Of The E. Coli 70s Ribosome In An
          Intermediate State Of Ratcheting
 gi|257097471|pdb|3I1R|X Chain X, Crystal Structure Of The E. Coli 70s Ribosome In An
          Intermediate State Of Ratcheting
 gi|257097525|pdb|3I1T|X Chain X, Crystal Structure Of The E. Coli 70s Ribosome In An
          Intermediate State Of Ratcheting
 gi|257097580|pdb|3I20|X Chain X, Crystal Structure Of The E. Coli 70s Ribosome In An
          Intermediate State Of Ratcheting
 gi|257097635|pdb|3I22|X Chain X, Crystal Structure Of The E. Coli 70s Ribosome In An
          Intermediate State Of Ratcheting
 gi|290560355|pdb|3KCR|X Chain X, Ribosome-Secy Complex. This Entry 3kcr Contains 50s
          Ribosomal Subnit. The 30s Ribosomal Subunit Can Be
          Found In Pdb Entry 3kc4
 gi|308198378|pdb|1VT2|X Chain X, Crystal Structure Of The E. Coli Ribosome Bound To
          Cem-101. This File Contains The 50s Subunit Of The
          Second 70s Ribosome.
 gi|308198752|pdb|3ORB|X Chain X, Crystal Structure Of The E. Coli Ribosome Bound To
          Cem-101. This File Contains The 50s Subunit Of The
          First 70s Ribosome Bound To Cem-101.
 gi|326634233|pdb|3IZT|Y Chain Y, Structural Insights Into Cognate Vs. Near-Cognate
          Discrimination During Decoding. This Entry Contains The
          Large Subunit Of A Ribosome Programmed With A
          Near-Cognate Codon.
 gi|326634266|pdb|3IZU|Y Chain Y, Structural Insights Into Cognate Vs. Near-Cognate
          Discrimination During Decoding. This Entry Contains The
          Large Subunit Of A Ribosome Programmed With A Cognate
          Codon
 gi|12518393|gb|AAG58781.1|AE005591_5 50S ribosomal subunit protein L28 [Escherichia coli O157:H7 str.
          EDL933]
 gi|26110713|gb|AAN82897.1|AE016769_12 50S ribosomal protein L28 [Escherichia coli CFT073]
 gi|147708|gb|AAA74099.1| ribosomal protein L28 [Escherichia coli]
 gi|290487|gb|AAA61990.1| 50S ribosomal subunit protein L28 [Escherichia coli]
 gi|1790068|gb|AAC76661.1| 50S ribosomal subunit protein L28 [Escherichia coli str. K-12
          substr. MG1655]
 gi|13363987|dbj|BAB37935.1| 50S ribosomal subunit protein L28 [Escherichia coli O157:H7 str.
          Sakai]
 gi|24054148|gb|AAN45123.1| 50S ribosomal subunit protein L28 [Shigella flexneri 2a str. 301]
 gi|30043348|gb|AAP19069.1| 50S ribosomal subunit protein L28 [Shigella flexneri 2a str.
          2457T]
 gi|73857606|gb|AAZ90313.1| 50S ribosomal subunit protein L28 [Shigella sonnei Ss046]
 gi|81243275|gb|ABB63985.1| 50S ribosomal subunit protein L28 [Shigella dysenteriae Sd197]
 gi|85676405|dbj|BAE77655.1| 50S ribosomal subunit protein L28 [Escherichia coli str. K12
          substr. W3110]
 gi|91074728|gb|ABE09609.1| 50S ribosomal subunit protein L28 [Escherichia coli UTI89]
 gi|110345470|gb|ABG71707.1| 50S ribosomal protein L28 [Escherichia coli 536]
 gi|150957332|gb|ABR79362.1| 50S ribosomal protein L28 [Klebsiella pneumoniae subsp.
          pneumoniae MGH 78578]
 gi|157068798|gb|ABV08053.1| ribosomal protein L28 [Escherichia coli HS]
 gi|157077877|gb|ABV17585.1| ribosomal protein L28 [Escherichia coli E24377A]
 gi|169753061|gb|ACA75760.1| ribosomal protein L28 [Escherichia coli ATCC 8739]
 gi|169890980|gb|ACB04687.1| 50S ribosomal subunit protein L28 [Escherichia coli str. K-12
          substr. DH10B]
 gi|170518333|gb|ACB16511.1| ribosomal protein L28 [Escherichia coli SMS-3-5]
 gi|187429130|gb|ACD08404.1| ribosomal protein L28 [Shigella boydii CDC 3083-94]
 gi|187771406|gb|EDU35250.1| ribosomal protein L28 [Escherichia coli O157:H7 str. EC4196]
 gi|188016990|gb|EDU55112.1| ribosomal protein L28 [Escherichia coli O157:H7 str. EC4113]
 gi|188491244|gb|EDU66347.1| ribosomal protein L28 [Escherichia coli 53638]
 gi|189002221|gb|EDU71207.1| ribosomal protein L28 [Escherichia coli O157:H7 str. EC4076]
 gi|189359118|gb|EDU77537.1| ribosomal protein L28 [Escherichia coli O157:H7 str. EC4401]
 gi|189364784|gb|EDU83203.1| ribosomal protein L28 [Escherichia coli O157:H7 str. EC4486]
 gi|189369658|gb|EDU88074.1| ribosomal protein L28 [Escherichia coli O157:H7 str. EC4501]
 gi|189374402|gb|EDU92818.1| ribosomal protein L28 [Escherichia coli O157:H7 str. EC869]
 gi|189378795|gb|EDU97211.1| ribosomal protein L28 [Escherichia coli O157:H7 str. EC508]
 gi|190902153|gb|EDV61896.1| ribosomal protein L28 [Escherichia coli B7A]
 gi|190909355|gb|EDV68941.1| ribosomal protein L28 [Escherichia coli F11]
 gi|192930492|gb|EDV83099.1| ribosomal protein L28 [Escherichia coli E22]
 gi|192956288|gb|EDV86749.1| ribosomal protein L28 [Escherichia coli E110019]
 gi|194420691|gb|EDX36767.1| ribosomal protein L28 [Shigella dysenteriae 1012]
 gi|194425227|gb|EDX41211.1| ribosomal protein L28 [Escherichia coli 101-1]
 gi|208734084|gb|EDZ82771.1| ribosomal protein L28 [Escherichia coli O157:H7 str. EC4045]
 gi|208738761|gb|EDZ86443.1| ribosomal protein L28 [Escherichia coli O157:H7 str. EC4042]
 gi|209158682|gb|ACI36115.1| ribosomal protein L28 [Escherichia coli O157:H7 str. EC4115]
 gi|209754648|gb|ACI75636.1| 50S ribosomal subunit protein L28 [Escherichia coli]
 gi|209754650|gb|ACI75637.1| 50S ribosomal subunit protein L28 [Escherichia coli]
 gi|209754652|gb|ACI75638.1| 50S ribosomal subunit protein L28 [Escherichia coli]
 gi|209754654|gb|ACI75639.1| 50S ribosomal subunit protein L28 [Escherichia coli]
 gi|209754656|gb|ACI75640.1| 50S ribosomal subunit protein L28 [Escherichia coli]
 gi|209914367|dbj|BAG79441.1| 50S ribosomal protein L28 [Escherichia coli SE11]
 gi|215266988|emb|CAS11433.1| 50S ribosomal subunit protein L28 [Escherichia coli O127:H6 str.
          E2348/69]
 gi|217320553|gb|EEC28977.1| ribosomal protein L28 [Escherichia coli O157:H7 str. TW14588]
 gi|218354090|emb|CAV00641.1| 50S ribosomal subunit protein L28 [Escherichia coli 55989]
 gi|218358706|emb|CAQ91362.1| 50S ribosomal subunit protein L28 [Escherichia fergusonii ATCC
          35469]
 gi|218362967|emb|CAR00604.1| 50S ribosomal subunit protein L28 [Escherichia coli IAI1]
 gi|218367478|emb|CAR05260.1| 50S ribosomal subunit protein L28 [Escherichia coli S88]
 gi|218372389|emb|CAR20263.1| 50S ribosomal subunit protein L28 [Escherichia coli IAI39]
 gi|218429485|emb|CAR10448.2| 50S ribosomal subunit protein L28 [Escherichia coli ED1a]
 gi|218434368|emb|CAR15292.1| 50S ribosomal subunit protein L28 [Escherichia coli UMN026]
 gi|222035345|emb|CAP78090.1| 50S ribosomal protein L28 [Escherichia coli LF82]
 gi|226838801|gb|EEH70828.1| ribosomal protein L28 [Escherichia sp. 1_1_43]
 gi|226902672|gb|EEH88931.1| 50S ribosomal subunit protein L28 [Escherichia sp. 3_2_53FAA]
 gi|238549406|dbj|BAH65757.1| 50S ribosomal protein L28 [Klebsiella pneumoniae subsp.
          pneumoniae NTUH-K2044]
 gi|238859866|gb|ACR61864.1| 50S ribosomal subunit protein L28 [Escherichia coli BW2952]
 gi|242379161|emb|CAQ33963.1| 50S ribosomal subunit protein L28, subunit of 50S ribosomal
          subunit and ribosome [Escherichia coli BL21(DE3)]
 gi|253322566|gb|ACT27168.1| ribosomal protein L28 [Escherichia coli 'BL21-Gold(DE3)pLysS AG']
 gi|253975466|gb|ACT41137.1| 50S ribosomal protein L28 [Escherichia coli B str. REL606]
 gi|253979622|gb|ACT45292.1| 50S ribosomal protein L28 [Escherichia coli BL21(DE3)]
 gi|254594992|gb|ACT74353.1| 50S ribosomal subunit protein L28 [Escherichia coli O157:H7 str.
          TW14359]
 gi|257756617|dbj|BAI28119.1| 50S ribosomal subunit protein L28 [Escherichia coli O26:H11 str.
          11368]
 gi|257761745|dbj|BAI33242.1| 50S ribosomal subunit protein L28 [Escherichia coli O103:H2 str.
          12009]
 gi|257766723|dbj|BAI38218.1| 50S ribosomal subunit protein L28 [Escherichia coli O111:H- str.
          11128]
 gi|260447344|gb|ACX37766.1| ribosomal protein L28 [Escherichia coli DH1]
 gi|281180683|dbj|BAI57013.1| 50S ribosomal protein L28 [Escherichia coli SE15]
 gi|281603000|gb|ADA75984.1| 50S ribosomal protein L28 [Shigella flexneri 2002017]
 gi|284923670|emb|CBG36767.1| 50S ribosomal subunit protein L28 [Escherichia coli 042]
 gi|290764881|gb|ADD58842.1| 50S ribosomal protein L28 [Escherichia coli O55:H7 str. CB9615]
 gi|291321593|gb|EFE61029.1| 50S ribosomal protein L28 [Escherichia coli B088]
 gi|291426071|gb|EFE99105.1| LSU ribosomal protein L28p [Escherichia coli FVEC1412]
 gi|291431129|gb|EFF04122.1| large subunit ribosomal protein L28 [Escherichia coli B185]
 gi|291468718|gb|EFF11211.1| conserved hypothetical protein [Escherichia coli B354]
 gi|294490585|gb|ADE89341.1| ribosomal protein L28 [Escherichia coli IHE3034]
 gi|298276842|gb|EFI18360.1| 50S ribosomal protein L28 [Escherichia coli FVEC1302]
 gi|305850411|gb|EFM50868.1| 50S ribosomal protein L28 [Escherichia coli NC101]
 gi|306906101|gb|EFN36620.1| ribosomal protein L28 [Escherichia coli W]
 gi|307555736|gb|ADN48511.1| 50S ribosomal subunit protein L28 [Escherichia coli ABU 83972]
 gi|307628710|gb|ADN73014.1| 50S ribosomal protein L28 [Escherichia coli UM146]
 gi|309704039|emb|CBJ03385.1| 50S ribosomal subunit protein L28 [Escherichia coli ETEC H10407]
 gi|312948198|gb|ADR29025.1| 50S ribosomal protein L28 [Escherichia coli O83:H1 str. NRG 857C]
 gi|313647489|gb|EFS11939.1| ribosomal protein L28 [Shigella flexneri 2a str. 2457T]
 gi|315062925|gb|ADT77252.1| 50S ribosomal subunit protein L28 [Escherichia coli W]
 gi|315138219|dbj|BAJ45378.1| 50S ribosomal protein L28 [Escherichia coli DH1]
 gi|315618660|gb|EFU99246.1| ribosomal protein L28 [Escherichia coli 3431]
 gi|320644983|gb|EFX14013.1| 50S ribosomal protein L28 [Escherichia coli O157:H- str. 493-89]
 gi|320650250|gb|EFX18739.1| 50S ribosomal protein L28 [Escherichia coli O157:H- str. H 2687]
 gi|320655602|gb|EFX23530.1| 50S ribosomal protein L28 [Escherichia coli O55:H7 str. 3256-97
          TW 07815]
 gi|320661336|gb|EFX28760.1| 50S ribosomal protein L28 [Escherichia coli O55:H7 str. USDA
          5905]
 gi|320666350|gb|EFX33349.1| 50S ribosomal protein L28 [Escherichia coli O157:H7 str. LSU-61]
 gi|323173230|gb|EFZ58859.1| ribosomal protein L28 [Escherichia coli LT-68]
 gi|323376482|gb|ADX48750.1| ribosomal protein L28 [Escherichia coli KO11]
 gi|323934818|gb|EGB31200.1| ribosomal L28 family protein [Escherichia coli E1520]
 gi|323939604|gb|EGB35810.1| ribosomal L28 family protein [Escherichia coli E482]
 gi|323944090|gb|EGB40170.1| ribosomal L28 family protein [Escherichia coli H120]
 gi|323949876|gb|EGB45760.1| ribosomal L28 family protein [Escherichia coli H252]
 gi|323954823|gb|EGB50603.1| ribosomal L28 family protein [Escherichia coli H263]
 gi|323959885|gb|EGB55533.1| ribosomal L28 family protein [Escherichia coli H489]
 gi|323965903|gb|EGB61351.1| ribosomal L28 family protein [Escherichia coli M863]
 gi|323971279|gb|EGB66524.1| ribosomal L28 family protein [Escherichia coli TA007]
 gi|323975143|gb|EGB70248.1| ribosomal L28 family protein [Escherichia coli TW10509]
 gi|324111531|gb|EGC05512.1| ribosomal L28 family protein [Escherichia fergusonii B253]
 gi|324116024|gb|EGC09950.1| ribosomal L28 family protein [Escherichia coli E1167]
 gi|331036649|gb|EGI08875.1| ribosomal protein L28 [Escherichia coli H736]
 gi|331041950|gb|EGI14094.1| ribosomal protein L28 [Escherichia coli M605]
 gi|331047284|gb|EGI19362.1| ribosomal protein L28 [Escherichia coli M718]
 gi|331053172|gb|EGI25205.1| ribosomal protein L28 [Escherichia coli TA206]
 gi|331057772|gb|EGI29758.1| ribosomal protein L28 [Escherichia coli TA143]
 gi|331062539|gb|EGI34459.1| ribosomal protein L28 [Escherichia coli TA271]
 gi|331068026|gb|EGI39424.1| ribosomal protein L28 [Escherichia coli TA280]
 gi|331072900|gb|EGI44225.1| ribosomal protein L28 [Escherichia coli H591]
 gi|331077671|gb|EGI48883.1| ribosomal protein L28 [Escherichia coli H299]
 gi|332084501|gb|EGI89696.1| ribosomal protein L28 [Shigella dysenteriae 155-74]
 gi|332104945|gb|EGJ08291.1| 50S ribosomal subunit protein L28 [Shigella sp. D9]
 gi|332749908|gb|EGJ80320.1| ribosomal protein L28 [Shigella flexneri K-671]
 gi|332750594|gb|EGJ81002.1| ribosomal protein L28 [Shigella flexneri 4343-70]
          Length = 78

 Score = 90.5 bits (224), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 28/75 (37%), Positives = 45/75 (60%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  ++GN  SHA N T+RRFLPNL       +  ++   LR+S   +R ++
Sbjct: 1  MSRVCQVTGKRPVTGNNRSHALNATKRRFLPNLHSHRFWVESEKRFVTLRVSAKGMRVID 60

Query: 61 RQGGLDRFLSNSKKE 75
          ++G +D  L+  +  
Sbjct: 61 KKG-IDTVLAELRAR 74


>gi|145301063|ref|YP_001143904.1| 50S ribosomal protein L28 [Aeromonas salmonicida subsp.
          salmonicida A449]
 gi|166226536|sp|A4STD4|RL28_AERS4 RecName: Full=50S ribosomal protein L28
 gi|142853835|gb|ABO92156.1| ribosomal protein L28 [Aeromonas salmonicida subsp. salmonicida
          A449]
          Length = 78

 Score = 90.5 bits (224), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 27/63 (42%), Positives = 39/63 (61%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K    GN  SHANN T+RRFLPNL       +  ++   LR+S   +R ++
Sbjct: 1  MSRVCQVTGKRPAVGNNRSHANNATKRRFLPNLHTHRFWVEGEKRFVSLRVSAKGMRIID 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KRG 63


>gi|119503523|ref|ZP_01625606.1| 50S ribosomal subunit protein L28 [marine gamma proteobacterium
          HTCC2080]
 gi|119460585|gb|EAW41677.1| 50S ribosomal subunit protein L28 [marine gamma proteobacterium
          HTCC2080]
          Length = 78

 Score = 90.5 bits (224), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 33/84 (39%), Positives = 50/84 (59%), Gaps = 6/84 (7%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  ++GN VSHA N+TRRRFLPNL       +  ++   LRIS   +R ++
Sbjct: 1  MSRVCQVTGKRPVTGNNVSHAKNRTRRRFLPNLHNHRFWVESEKRFVSLRISPKGMRIID 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTL 84
          ++G +D  L+      L +R   +
Sbjct: 61 KRG-IDTVLA-----ELRSRGEKV 78


>gi|294637896|ref|ZP_06716165.1| ribosomal protein L28 [Edwardsiella tarda ATCC 23685]
 gi|291088922|gb|EFE21483.1| ribosomal protein L28 [Edwardsiella tarda ATCC 23685]
          Length = 78

 Score = 90.5 bits (224), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 27/75 (36%), Positives = 46/75 (61%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  ++GN  SHA N T+RRFLPNL       +  ++   LR+S   +R ++
Sbjct: 1  MSRVCQVTGKRPVTGNNRSHALNATKRRFLPNLHSHRFWVEGEKRFVTLRVSAKGMRIID 60

Query: 61 RQGGLDRFLSNSKKE 75
          ++G ++  L++ +  
Sbjct: 61 KKG-IEAVLADLRAR 74


>gi|262201431|ref|YP_003272639.1| 50S ribosomal protein L28 [Gordonia bronchialis DSM 43247]
 gi|262084778|gb|ACY20746.1| ribosomal protein L28 [Gordonia bronchialis DSM 43247]
          Length = 78

 Score = 90.5 bits (224), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 24/75 (32%), Positives = 42/75 (56%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS  C++T  T   GN+VSH++ KTRRR+ PN+ R        ++   L +S   L++++
Sbjct: 1  MSARCQVTGATPGFGNRVSHSHRKTRRRWNPNIQRRRFYIPAEDRHITLNVSAKGLKTID 60

Query: 61 RQGGLDRFLSNSKKE 75
          R G ++  L+  +  
Sbjct: 61 RHG-IESVLATIRAR 74


>gi|260599934|ref|YP_003212505.1| 50S ribosomal protein L28 [Cronobacter turicensis z3032]
 gi|260219111|emb|CBA34466.1| 50S ribosomal protein L28 [Cronobacter turicensis z3032]
          Length = 80

 Score = 90.5 bits (224), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 29/75 (38%), Positives = 45/75 (60%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  ++GN  SHA N T+RRFLPNL       +  ++   LR+S   +R ++
Sbjct: 3  MSRVCQVTGKRPVTGNNRSHALNATKRRFLPNLHSHRFWVESEKRFVTLRVSAKGMRVID 62

Query: 61 RQGGLDRFLSNSKKE 75
          ++G +D  LS  +  
Sbjct: 63 KKG-IDVVLSELRAR 76


>gi|88859002|ref|ZP_01133643.1| 50S ribosomal protein L28 [Pseudoalteromonas tunicata D2]
 gi|88819228|gb|EAR29042.1| 50S ribosomal protein L28 [Pseudoalteromonas tunicata D2]
          Length = 78

 Score = 90.5 bits (224), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 26/75 (34%), Positives = 43/75 (57%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS+VC++T K    GN  SHA N T+RRFLPNL       +   +  +LR++   +R ++
Sbjct: 1  MSKVCQVTGKRPAVGNNRSHALNATKRRFLPNLQTHRFWVESENRFVKLRLTTKGMRIID 60

Query: 61 RQGGLDRFLSNSKKE 75
          ++G +D  L+  +  
Sbjct: 61 KKG-IDAVLTEIRAR 74


>gi|226507934|ref|NP_001149701.1| 60S ribosomal protein L24 [Zea mays]
 gi|195629596|gb|ACG36439.1| 60S ribosomal protein L24 [Zea mays]
          Length = 210

 Score = 90.5 bits (224), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 24/94 (25%), Positives = 48/94 (51%), Gaps = 1/94 (1%)

Query: 2   SRVCELTKKTVMSGNKVSH-ANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
           ++      + +  GNKVS    NK+RR + PN+    L S I ++  +++++  ALR ++
Sbjct: 44  AKRGIFAGRHIRFGNKVSEDGGNKSRRSWKPNVQEKRLFSYIHDRHIRVKVTTHALRCID 103

Query: 61  RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSE 94
           + GG+D +L  +    +   M  +    ++KM  
Sbjct: 104 KAGGIDEYLLKTPYNKMDTEMGIVWKAKIEKMYS 137


>gi|260774467|ref|ZP_05883381.1| LSU ribosomal protein L28p [Vibrio metschnikovii CIP 69.14]
 gi|260610594|gb|EEX35799.1| LSU ribosomal protein L28p [Vibrio metschnikovii CIP 69.14]
          Length = 78

 Score = 90.5 bits (224), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 27/75 (36%), Positives = 46/75 (61%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  ++GN  SHA N T+RRFLPNL       +  ++  +LR++   +R ++
Sbjct: 1  MSRVCQVTGKRPITGNNRSHARNATKRRFLPNLQTHRFWVESEKRFVKLRLTAKGMRIID 60

Query: 61 RQGGLDRFLSNSKKE 75
          ++G +D  L + +  
Sbjct: 61 KKG-IDAVLVDIRAR 74


>gi|134074563|emb|CAK38856.1| unnamed protein product [Aspergillus niger]
          Length = 299

 Score = 90.5 bits (224), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 25/87 (28%), Positives = 47/87 (54%), Gaps = 5/87 (5%)

Query: 9   KKTVMSGNKVSHANN--KTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLD 66
              +  GNK+S   N  KTRR + PN+ R  L S+ + +   +++++ ALR++ + GGLD
Sbjct: 156 GAMIQFGNKISQGRNEGKTRRFWKPNVRRKKLYSEALGEDLFIKVTRKALRTIRKAGGLD 215

Query: 67  RFLSNSKK---ENLSARMRTLRSQILK 90
            +L + +      +      LR +I++
Sbjct: 216 NYLLSDRPGRIREMGIFGWELRWKIMQ 242


>gi|169771529|ref|XP_001820234.1| 50S ribosomal protein L24 [Aspergillus oryzae RIB40]
 gi|238485896|ref|XP_002374186.1| 50S ribosomal protein L24 [Aspergillus flavus NRRL3357]
 gi|83768093|dbj|BAE58232.1| unnamed protein product [Aspergillus oryzae]
 gi|220699065|gb|EED55404.1| 50S ribosomal protein L24 [Aspergillus flavus NRRL3357]
          Length = 212

 Score = 90.1 bits (223), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 24/87 (27%), Positives = 49/87 (56%), Gaps = 5/87 (5%)

Query: 9   KKTVMSGNKVSHANN--KTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLD 66
              +  GNK+S   N  KTRR + PN+ R  + S+ +++   +++++ ALR++ + GGLD
Sbjct: 69  GVMIQFGNKISKGRNEGKTRRFWKPNVRRKKIYSEALDEWLFIKVTRKALRTIRKSGGLD 128

Query: 67  RFLSNSKK---ENLSARMRTLRSQILK 90
            +L + +    + L      LR ++++
Sbjct: 129 NYLLDDRPGRVKELGVFGWQLRWKVMQ 155


>gi|320533926|ref|ZP_08034498.1| ribosomal protein L28 [Actinomyces sp. oral taxon 171 str. F0337]
 gi|320133859|gb|EFW26235.1| ribosomal protein L28 [Actinomyces sp. oral taxon 171 str. F0337]
          Length = 82

 Score = 90.1 bits (223), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 22/80 (27%), Positives = 44/80 (55%), Gaps = 3/80 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+  C++T    + G  VSH++ +T RR+ PNL R       + +  +L +S   +R+++
Sbjct: 4  MTTYCQVTGARPVFGRSVSHSHKRTPRRWDPNLQRKRYWVPSLGRTVRLTVSAKGIRTID 63

Query: 61 RQGGLDRFLSN--SKKENLS 78
          + G +D  ++   ++ E LS
Sbjct: 64 KLG-IDVVVAQMLARGEKLS 82


>gi|45439916|ref|NP_991455.1| 50S ribosomal protein L28 [Yersinia pestis biovar Microtus str.
          91001]
 gi|51594405|ref|YP_068596.1| 50S ribosomal protein L28 [Yersinia pseudotuberculosis IP 32953]
 gi|108809483|ref|YP_653399.1| 50S ribosomal protein L28 [Yersinia pestis Antiqua]
 gi|108813960|ref|YP_649727.1| 50S ribosomal protein L28 [Yersinia pestis Nepal516]
 gi|145601095|ref|YP_001165171.1| 50S ribosomal protein L28 [Yersinia pestis Pestoides F]
 gi|150260886|ref|ZP_01917614.1| 50S ribosomal protein L28 [Yersinia pestis CA88-4125]
 gi|153948103|ref|YP_001399063.1| 50S ribosomal protein L28 [Yersinia pseudotuberculosis IP 31758]
 gi|162421887|ref|YP_001604696.1| 50S ribosomal protein L28 [Yersinia pestis Angola]
 gi|165926158|ref|ZP_02221990.1| ribosomal protein L28 [Yersinia pestis biovar Orientalis str.
          F1991016]
 gi|165936126|ref|ZP_02224695.1| ribosomal protein L28 [Yersinia pestis biovar Orientalis str.
          IP275]
 gi|166011434|ref|ZP_02232332.1| ribosomal protein L28 [Yersinia pestis biovar Antiqua str.
          E1979001]
 gi|166213673|ref|ZP_02239708.1| ribosomal protein L28 [Yersinia pestis biovar Antiqua str.
          B42003004]
 gi|167402130|ref|ZP_02307607.1| ribosomal protein L28 [Yersinia pestis biovar Antiqua str.
          UG05-0454]
 gi|167419031|ref|ZP_02310784.1| ribosomal protein L28 [Yersinia pestis biovar Orientalis str.
          MG05-1020]
 gi|167426680|ref|ZP_02318433.1| ribosomal protein L28 [Yersinia pestis biovar Mediaevalis str.
          K1973002]
 gi|170026361|ref|YP_001722866.1| 50S ribosomal protein L28 [Yersinia pseudotuberculosis YPIII]
 gi|186893393|ref|YP_001870505.1| 50S ribosomal protein L28 [Yersinia pseudotuberculosis PB1/+]
 gi|218927271|ref|YP_002345146.1| 50S ribosomal protein L28 [Yersinia pestis CO92]
 gi|229836163|ref|ZP_04456331.1| 50S ribosomal subunit protein L28 [Yersinia pestis Pestoides A]
 gi|229839899|ref|ZP_04460058.1| 50S ribosomal subunit protein L28 [Yersinia pestis biovar
          Orientalis str. PEXU2]
 gi|229841981|ref|ZP_04462136.1| 50S ribosomal subunit protein L28 [Yersinia pestis biovar
          Orientalis str. India 195]
 gi|229904490|ref|ZP_04519601.1| 50S ribosomal subunit protein L28 [Yersinia pestis Nepal516]
 gi|270488489|ref|ZP_06205563.1| ribosomal protein L28 [Yersinia pestis KIM D27]
 gi|20139509|sp|Q8ZJP2|RL28_YERPE RecName: Full=50S ribosomal protein L28
 gi|67461380|sp|Q66GD5|RL28_YERPS RecName: Full=50S ribosomal protein L28
 gi|122382630|sp|Q1C268|RL28_YERPA RecName: Full=50S ribosomal protein L28
 gi|122384027|sp|Q1CD03|RL28_YERPN RecName: Full=50S ribosomal protein L28
 gi|166228174|sp|A4TSD6|RL28_YERPP RecName: Full=50S ribosomal protein L28
 gi|166987918|sp|A7FCT5|RL28_YERP3 RecName: Full=50S ribosomal protein L28
 gi|226699188|sp|B2JYN4|RL28_YERPB RecName: Full=50S ribosomal protein L28
 gi|226699189|sp|A9R675|RL28_YERPG RecName: Full=50S ribosomal protein L28
 gi|226699190|sp|B1JQX2|RL28_YERPY RecName: Full=50S ribosomal protein L28
 gi|45434771|gb|AAS60332.1| 50S ribosomal protein L28 [Yersinia pestis biovar Microtus str.
          91001]
 gi|51587687|emb|CAH19287.1| 50S ribosomal protein L28 [Yersinia pseudotuberculosis IP 32953]
 gi|108777608|gb|ABG20127.1| LSU ribosomal protein L28P [Yersinia pestis Nepal516]
 gi|108781396|gb|ABG15454.1| LSU ribosomal protein L28P [Yersinia pestis Antiqua]
 gi|115345882|emb|CAL18740.1| 50S ribosomal protein L28 [Yersinia pestis CO92]
 gi|145212791|gb|ABP42198.1| LSU ribosomal protein L28P [Yersinia pestis Pestoides F]
 gi|149290294|gb|EDM40371.1| 50S ribosomal protein L28 [Yersinia pestis CA88-4125]
 gi|152959598|gb|ABS47059.1| ribosomal protein L28 [Yersinia pseudotuberculosis IP 31758]
 gi|162354702|gb|ABX88650.1| ribosomal protein L28 [Yersinia pestis Angola]
 gi|165915740|gb|EDR34348.1| ribosomal protein L28 [Yersinia pestis biovar Orientalis str.
          IP275]
 gi|165922018|gb|EDR39195.1| ribosomal protein L28 [Yersinia pestis biovar Orientalis str.
          F1991016]
 gi|165989580|gb|EDR41881.1| ribosomal protein L28 [Yersinia pestis biovar Antiqua str.
          E1979001]
 gi|166205075|gb|EDR49555.1| ribosomal protein L28 [Yersinia pestis biovar Antiqua str.
          B42003004]
 gi|166963025|gb|EDR59046.1| ribosomal protein L28 [Yersinia pestis biovar Orientalis str.
          MG05-1020]
 gi|167048505|gb|EDR59913.1| ribosomal protein L28 [Yersinia pestis biovar Antiqua str.
          UG05-0454]
 gi|167054369|gb|EDR64186.1| ribosomal protein L28 [Yersinia pestis biovar Mediaevalis str.
          K1973002]
 gi|169752895|gb|ACA70413.1| ribosomal protein L28 [Yersinia pseudotuberculosis YPIII]
 gi|186696419|gb|ACC87048.1| ribosomal protein L28 [Yersinia pseudotuberculosis PB1/+]
 gi|229678608|gb|EEO74713.1| 50S ribosomal subunit protein L28 [Yersinia pestis Nepal516]
 gi|229690291|gb|EEO82345.1| 50S ribosomal subunit protein L28 [Yersinia pestis biovar
          Orientalis str. India 195]
 gi|229696265|gb|EEO86312.1| 50S ribosomal subunit protein L28 [Yersinia pestis biovar
          Orientalis str. PEXU2]
 gi|229706611|gb|EEO92617.1| 50S ribosomal subunit protein L28 [Yersinia pestis Pestoides A]
 gi|270336993|gb|EFA47770.1| ribosomal protein L28 [Yersinia pestis KIM D27]
 gi|320013404|gb|ADV96975.1| 50S ribosomal subunit protein L28 [Yersinia pestis biovar
          Medievalis str. Harbin 35]
          Length = 78

 Score = 90.1 bits (223), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 29/75 (38%), Positives = 45/75 (60%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  MSGN  SHA N T+RRFLPNL       +  ++   LR+S   +R ++
Sbjct: 1  MSRVCQVTGKRPMSGNNRSHAMNATKRRFLPNLHSHRFWVEGEKRFVTLRVSAKGMRVID 60

Query: 61 RQGGLDRFLSNSKKE 75
          ++G ++  L+  +  
Sbjct: 61 KKG-IETVLAEIRAR 74


>gi|170766820|ref|ZP_02901273.1| ribosomal protein L28 [Escherichia albertii TW07627]
 gi|170124258|gb|EDS93189.1| ribosomal protein L28 [Escherichia albertii TW07627]
          Length = 78

 Score = 90.1 bits (223), Expect = 9e-17,   Method: Composition-based stats.
 Identities = 28/75 (37%), Positives = 45/75 (60%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  ++GN  SHA N T+RRFLPNL       +  ++   LR+S   +R ++
Sbjct: 1  MSRVCQVTGKRPVTGNNRSHALNATKRRFLPNLHSHRFWVESEKRFVTLRVSAKGMRVID 60

Query: 61 RQGGLDRFLSNSKKE 75
          ++G +D  L+  +  
Sbjct: 61 KKG-IDTVLAELRVR 74


>gi|242237619|ref|YP_002985800.1| 50S ribosomal protein L28 [Dickeya dadantii Ech703]
 gi|251791517|ref|YP_003006238.1| 50S ribosomal protein L28 [Dickeya zeae Ech1591]
 gi|271498729|ref|YP_003331754.1| 50S ribosomal protein L28 [Dickeya dadantii Ech586]
 gi|307133080|ref|YP_003885096.1| 50S ribosomal subunit protein L28 [Dickeya dadantii 3937]
 gi|242129676|gb|ACS83978.1| ribosomal protein L28 [Dickeya dadantii Ech703]
 gi|247540138|gb|ACT08759.1| ribosomal protein L28 [Dickeya zeae Ech1591]
 gi|270342284|gb|ACZ75049.1| ribosomal protein L28 [Dickeya dadantii Ech586]
 gi|306530609|gb|ADN00540.1| 50S ribosomal subunit protein L28 [Dickeya dadantii 3937]
          Length = 78

 Score = 90.1 bits (223), Expect = 9e-17,   Method: Composition-based stats.
 Identities = 27/75 (36%), Positives = 46/75 (61%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  ++GN  SHA N T+RRFLPNL       +  ++   LR+S   +R ++
Sbjct: 1  MSRVCQVTGKRPVTGNNRSHAMNATKRRFLPNLHSHRFWVEGEKRFVTLRVSAKGMRVID 60

Query: 61 RQGGLDRFLSNSKKE 75
          ++G ++  L++ +  
Sbjct: 61 KKG-IEAVLADLRAR 74


>gi|84386868|ref|ZP_00989892.1| ribosomal protein L28 [Vibrio splendidus 12B01]
 gi|86147285|ref|ZP_01065600.1| ribosomal protein L28 [Vibrio sp. MED222]
 gi|218708246|ref|YP_002415867.1| 50S ribosomal protein L28 [Vibrio splendidus LGP32]
 gi|260770728|ref|ZP_05879658.1| LSU ribosomal protein L28p [Vibrio furnissii CIP 102972]
 gi|254801387|sp|B7VHK3|RL28_VIBSL RecName: Full=50S ribosomal protein L28
 gi|84378158|gb|EAP95017.1| ribosomal protein L28 [Vibrio splendidus 12B01]
 gi|85835000|gb|EAQ53143.1| ribosomal protein L28 [Vibrio sp. MED222]
 gi|218321265|emb|CAV17215.1| Ribosomal protein L28 [Vibrio splendidus LGP32]
 gi|260614309|gb|EEX39498.1| LSU ribosomal protein L28p [Vibrio furnissii CIP 102972]
 gi|315178476|gb|ADT85390.1| ribosomal protein L28 [Vibrio furnissii NCTC 11218]
          Length = 78

 Score = 90.1 bits (223), Expect = 9e-17,   Method: Composition-based stats.
 Identities = 27/75 (36%), Positives = 46/75 (61%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  ++GN  SHA N T+RRFLPNL       +  ++  +LR++   +R ++
Sbjct: 1  MSRVCQVTGKRPVTGNNRSHARNATKRRFLPNLQTHRFWVESEKRFVKLRLTAKGMRIID 60

Query: 61 RQGGLDRFLSNSKKE 75
          ++G +D  L + +  
Sbjct: 61 KKG-IDAVLVDIRAR 74


>gi|119194203|ref|XP_001247705.1| hypothetical protein CIMG_01476 [Coccidioides immitis RS]
          Length = 224

 Score = 90.1 bits (223), Expect = 9e-17,   Method: Composition-based stats.
 Identities = 27/92 (29%), Positives = 52/92 (56%), Gaps = 5/92 (5%)

Query: 9   KKTVMSGNKVSHANN--KTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLD 66
             T+  GNK+S   N  KTRR + PN+ +  L S+ +E+   L++    LR+++++GGLD
Sbjct: 67  GATIQFGNKISKGRNEGKTRRIWKPNIRKEKLYSEALEKWLDLKVQHRVLRTIKKEGGLD 126

Query: 67  RFLSN---SKKENLSARMRTLRSQILKKMSEK 95
           ++L +   S+ + L      LR +++   + +
Sbjct: 127 QYLLSDKPSRIKELGVFGWGLRWKVMTSKAMR 158


>gi|238918037|ref|YP_002931551.1| 50S ribosomal protein L28 [Edwardsiella ictaluri 93-146]
 gi|259646736|sp|C5B9D6|RL28_EDWI9 RecName: Full=50S ribosomal protein L28
 gi|238867605|gb|ACR67316.1| ribosomal protein L28, putative [Edwardsiella ictaluri 93-146]
          Length = 78

 Score = 90.1 bits (223), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 27/75 (36%), Positives = 46/75 (61%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  ++GN  SHA N T+RRFLPNL       +  ++   LR+S   +R ++
Sbjct: 1  MSRVCQVTGKRPVTGNNRSHALNATKRRFLPNLHSHRFWVEGEKRFVTLRVSAKGMRVID 60

Query: 61 RQGGLDRFLSNSKKE 75
          ++G ++  L++ +  
Sbjct: 61 KKG-IEAVLADLRAR 74


>gi|82546000|ref|YP_409947.1| 50S ribosomal protein L28 [Shigella boydii Sb227]
 gi|123558301|sp|Q31UY9|RL28_SHIBS RecName: Full=50S ribosomal protein L28
 gi|81247411|gb|ABB68119.1| 50S ribosomal subunit protein L28 [Shigella boydii Sb227]
 gi|332089447|gb|EGI94551.1| ribosomal protein L28 [Shigella boydii 3594-74]
          Length = 78

 Score = 90.1 bits (223), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 28/75 (37%), Positives = 45/75 (60%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  ++GN  SHA N T+RRFLPNL       +  ++   LR+S   +R ++
Sbjct: 1  MSRVCQVTGKRPVTGNNRSHALNATKRRFLPNLHSHRFWVESEKRFVTLRVSAKGMRVID 60

Query: 61 RQGGLDRFLSNSKKE 75
          ++G +D  L+  +  
Sbjct: 61 KKG-IDTVLAELRAR 74


>gi|85710818|ref|ZP_01041879.1| Ribosomal protein L28 [Idiomarina baltica OS145]
 gi|85695222|gb|EAQ33159.1| Ribosomal protein L28 [Idiomarina baltica OS145]
          Length = 78

 Score = 90.1 bits (223), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 28/73 (38%), Positives = 45/73 (61%), Gaps = 1/73 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS+VC++T K  + GN  SHA N T+RRFLPNL       +  ++  +LRIS   +R ++
Sbjct: 1  MSQVCQVTGKRPVVGNNRSHARNATKRRFLPNLQTHRFWVESEKRWVKLRISTKGMRIID 60

Query: 61 RQGGLDRFLSNSK 73
          + G +D  L++ +
Sbjct: 61 KNG-IDSVLADLR 72


>gi|56459352|ref|YP_154633.1| ribosomal protein L28 [Idiomarina loihiensis L2TR]
 gi|67461323|sp|Q5QZB3|RL28_IDILO RecName: Full=50S ribosomal protein L28
 gi|56178362|gb|AAV81084.1| Ribosomal protein L28 [Idiomarina loihiensis L2TR]
          Length = 78

 Score = 90.1 bits (223), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 29/73 (39%), Positives = 45/73 (61%), Gaps = 1/73 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS+VC++T K  + GN  SHA N TRRRFLPNL       +  ++  +LRIS   +R ++
Sbjct: 1  MSQVCQVTGKRPVVGNNRSHARNATRRRFLPNLQSHRFWVESEKRWVKLRISTKGMRIID 60

Query: 61 RQGGLDRFLSNSK 73
          + G +D  L++ +
Sbjct: 61 KNG-IDTVLADLR 72


>gi|291619456|ref|YP_003522198.1| RpmB [Pantoea ananatis LMG 20103]
 gi|304399016|ref|ZP_07380885.1| ribosomal protein L28 [Pantoea sp. aB]
 gi|291154486|gb|ADD79070.1| RpmB [Pantoea ananatis LMG 20103]
 gi|304353476|gb|EFM17854.1| ribosomal protein L28 [Pantoea sp. aB]
 gi|327395779|dbj|BAK13201.1| 50S ribosomal subunit protein L28 RpmB [Pantoea ananatis AJ13355]
          Length = 78

 Score = 90.1 bits (223), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 28/75 (37%), Positives = 46/75 (61%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  ++GN  SHA N T+RRFLPNL       +  ++   LR+S   +R ++
Sbjct: 1  MSRVCQVTGKRPVTGNNRSHAMNATKRRFLPNLHSHRFWVESEKRFVTLRVSVKGMRIID 60

Query: 61 RQGGLDRFLSNSKKE 75
          ++G +D  L++ +  
Sbjct: 61 KKG-IDTVLADMRAR 74


>gi|303311457|ref|XP_003065740.1| ribosomal L28 family protein [Coccidioides posadasii C735 delta
           SOWgp]
 gi|240105402|gb|EER23595.1| ribosomal L28 family protein [Coccidioides posadasii C735 delta
           SOWgp]
 gi|320039613|gb|EFW21547.1| 50S ribosomal protein L24 [Coccidioides posadasii str. Silveira]
          Length = 224

 Score = 90.1 bits (223), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 27/92 (29%), Positives = 52/92 (56%), Gaps = 5/92 (5%)

Query: 9   KKTVMSGNKVSHANN--KTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLD 66
             T+  GNK+S   N  KTRR + PN+ +  L S+ +E+   L++    LR+++++GGLD
Sbjct: 67  GATIQFGNKISKGRNEGKTRRIWKPNIRKEKLYSEALEKWLDLKVQHRVLRTIKKEGGLD 126

Query: 67  RFLSN---SKKENLSARMRTLRSQILKKMSEK 95
           ++L +   S+ + L      LR +++   + +
Sbjct: 127 QYLLSDKPSRIKELGIFGWGLRWKVMTSKAMR 158


>gi|325068208|ref|ZP_08126881.1| 50S ribosomal protein L28 [Actinomyces oris K20]
 gi|326774132|ref|ZP_08233414.1| ribosomal protein L28 [Actinomyces viscosus C505]
 gi|326636271|gb|EGE37175.1| ribosomal protein L28 [Actinomyces viscosus C505]
          Length = 79

 Score = 90.1 bits (223), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 22/80 (27%), Positives = 44/80 (55%), Gaps = 3/80 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+  C++T    + G  VSH++ +T RR+ PNL R       + +  +L +S   +R+++
Sbjct: 1  MTTYCQVTGARPVFGRSVSHSHKRTPRRWDPNLQRKRYWVPSLGRTVRLTVSAKGIRTID 60

Query: 61 RQGGLDRFLSN--SKKENLS 78
          + G +D  ++   ++ E LS
Sbjct: 61 KLG-IDVVVAQMLARGEKLS 79


>gi|331239536|ref|XP_003332421.1| hypothetical protein PGTG_13806 [Puccinia graminis f. sp. tritici
           CRL 75-36-700-3]
 gi|309311411|gb|EFP88002.1| hypothetical protein PGTG_13806 [Puccinia graminis f. sp. tritici
           CRL 75-36-700-3]
          Length = 255

 Score = 89.7 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 28/87 (32%), Positives = 53/87 (60%)

Query: 9   KKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRF 68
              V +G+ VS + ++T+R + PN+ R TL S+++ Q  QL+++  AL+S++R GGLDR+
Sbjct: 81  GLKVRAGDNVSKSKHRTKRTWKPNVQRTTLWSEVLGQSLQLKVTSAALKSIDRMGGLDRY 140

Query: 69  LSNSKKENLSARMRTLRSQILKKMSEK 95
           +    ++ L      +R  ++  M E+
Sbjct: 141 VLQMSEQRLGGMGIRIRELVIAAMQER 167


>gi|269103918|ref|ZP_06156615.1| LSU ribosomal protein L28p [Photobacterium damselae subsp.
          damselae CIP 102761]
 gi|268163816|gb|EEZ42312.1| LSU ribosomal protein L28p [Photobacterium damselae subsp.
          damselae CIP 102761]
          Length = 78

 Score = 89.7 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 28/75 (37%), Positives = 46/75 (61%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  ++GN  SHA N T+RRFLPNL       +  ++  +LR+S   +R ++
Sbjct: 1  MSRVCQVTGKRPVTGNNRSHARNATKRRFLPNLQTHRFWVESEKRFVKLRLSAKGMRIID 60

Query: 61 RQGGLDRFLSNSKKE 75
          ++G +D  L + +  
Sbjct: 61 KKG-IDAVLVDMRAR 74


>gi|117621560|ref|YP_854694.1| 50S ribosomal protein L28 [Aeromonas hydrophila subsp. hydrophila
          ATCC 7966]
 gi|330831604|ref|YP_004394556.1| 50S ribosomal protein L28 [Aeromonas veronii B565]
 gi|166226535|sp|A0KEM9|RL28_AERHH RecName: Full=50S ribosomal protein L28
 gi|117562967|gb|ABK39915.1| ribosomal protein L28 [Aeromonas hydrophila subsp. hydrophila
          ATCC 7966]
 gi|328806740|gb|AEB51939.1| 50S ribosomal protein L28 [Aeromonas veronii B565]
          Length = 78

 Score = 89.7 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 27/63 (42%), Positives = 39/63 (61%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K    GN  SHANN T+RRFLPNL       +  ++   LR+S   +R ++
Sbjct: 1  MSRVCQVTGKRPAVGNNRSHANNATKRRFLPNLHTHRFWVESEKRFVSLRVSAKGMRIID 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KRG 63


>gi|52840724|ref|YP_094523.1| 50S ribosomal protein L28 [Legionella pneumophila subsp.
          pneumophila str. Philadelphia 1]
 gi|54293471|ref|YP_125886.1| 50S ribosomal protein L28 [Legionella pneumophila str. Lens]
 gi|54296513|ref|YP_122882.1| 50S ribosomal protein L28 [Legionella pneumophila str. Paris]
 gi|148360905|ref|YP_001252112.1| 50S ribosomal protein L28 [Legionella pneumophila str. Corby]
 gi|67461335|sp|Q5WZ62|RL28_LEGPL RecName: Full=50S ribosomal protein L28
 gi|67461340|sp|Q5X7R1|RL28_LEGPA RecName: Full=50S ribosomal protein L28
 gi|67461348|sp|Q5ZY93|RL28_LEGPH RecName: Full=50S ribosomal protein L28
 gi|166226585|sp|A5IHB6|RL28_LEGPC RecName: Full=50S ribosomal protein L28
 gi|46430436|emb|CAE45004.1| putative 50s ribosomal protein L28 [Legionella pneumophila str.
          Corby]
 gi|52627835|gb|AAU26576.1| 50S ribosomal protein L28 [Legionella pneumophila subsp.
          pneumophila str. Philadelphia 1]
 gi|53750298|emb|CAH11692.1| 50S ribosomal protein L28 [Legionella pneumophila str. Paris]
 gi|53753303|emb|CAH14750.1| 50S ribosomal protein L28 [Legionella pneumophila str. Lens]
 gi|148282678|gb|ABQ56766.1| 50S ribosomal protein L28 [Legionella pneumophila str. Corby]
          Length = 78

 Score = 89.7 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 30/75 (40%), Positives = 45/75 (60%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  M G+KVSHANNKT+RRFLPN+       +   +   LR+S   +R ++
Sbjct: 1  MSRVCQVTGKRPMVGHKVSHANNKTKRRFLPNIQNHKFWVEEENRFVTLRLSTKGMRIID 60

Query: 61 RQGGLDRFLSNSKKE 75
          + G +   L   + +
Sbjct: 61 KLG-IKAVLDKIRAK 74


>gi|332995182|gb|AEF05237.1| ribosomal protein L28 [Alteromonas sp. SN2]
          Length = 78

 Score = 89.7 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 29/75 (38%), Positives = 43/75 (57%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K    GN  SHA N TRRRFLPNL       +   +  +LR+S   +R ++
Sbjct: 1  MSRVCQVTGKRPTVGNNRSHARNATRRRFLPNLHSHRFWVESENRFVKLRLSAKGMRIID 60

Query: 61 RQGGLDRFLSNSKKE 75
          + G +D  L++ +  
Sbjct: 61 KNG-IDSVLTDIRAR 74


>gi|323143807|ref|ZP_08078474.1| ribosomal protein L28 [Succinatimonas hippei YIT 12066]
 gi|322416399|gb|EFY07066.1| ribosomal protein L28 [Succinatimonas hippei YIT 12066]
          Length = 78

 Score = 89.7 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 27/75 (36%), Positives = 45/75 (60%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K    GN  SHA N  +RRFLPNL       +   +  +LR++  A+R+++
Sbjct: 1  MSRVCQVTGKRPAVGNHRSHAKNAAKRRFLPNLKYHRFWVESEGRFVRLRVTTKAMRTID 60

Query: 61 RQGGLDRFLSNSKKE 75
          ++G +D  L++ +  
Sbjct: 61 KKG-IDSVLADMRAN 74


>gi|256823437|ref|YP_003147400.1| 50S ribosomal protein L28 [Kangiella koreensis DSM 16069]
 gi|256796976|gb|ACV27632.1| ribosomal protein L28 [Kangiella koreensis DSM 16069]
          Length = 78

 Score = 89.7 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 27/75 (36%), Positives = 48/75 (64%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M++VC++T K  ++GN VSHA N+T+RRFLPNL       +  ++  +LR+S   +R ++
Sbjct: 1  MAKVCQVTGKRPVTGNNVSHAKNRTKRRFLPNLHSHRFWVESEKRFVRLRVSAKGMRVID 60

Query: 61 RQGGLDRFLSNSKKE 75
          ++G +D  L+  +  
Sbjct: 61 KKG-IDTVLTELRAR 74


>gi|85060186|ref|YP_455888.1| 50S ribosomal protein L28 [Sodalis glossinidius str. 'morsitans']
 gi|123518742|sp|Q2NQU2|RL28_SODGM RecName: Full=50S ribosomal protein L28
 gi|84780706|dbj|BAE75483.1| 50S ribosomal protein L28 [Sodalis glossinidius str. 'morsitans']
          Length = 78

 Score = 89.7 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 27/63 (42%), Positives = 40/63 (63%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  +SGN  SHA N T+RRFLPNL       +  ++   LR+S   +R ++
Sbjct: 1  MSRVCQVTGKRPVSGNNRSHAMNATKRRFLPNLHSHRFWVESEKRFVTLRVSAKGMRVID 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|293333379|ref|NP_001168906.1| hypothetical protein LOC100382712 [Zea mays]
 gi|223973641|gb|ACN31008.1| unknown [Zea mays]
          Length = 207

 Score = 89.7 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 24/94 (25%), Positives = 48/94 (51%), Gaps = 1/94 (1%)

Query: 2   SRVCELTKKTVMSGNKVSH-ANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
           ++      + +  GNKVS    NK+RR + PN+    L S + +Q  +++++  ALR ++
Sbjct: 44  AKRGIFAGRHIRFGNKVSEDGGNKSRRSWKPNVQEKRLFSYVHDQHIRVKVTTHALRCID 103

Query: 61  RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSE 94
           + GG+D +L  +    +   M  +    ++KM  
Sbjct: 104 KAGGIDEYLLKTPYNKMDTEMGIVWKANIEKMYS 137


>gi|118602956|ref|YP_904171.1| 50S ribosomal protein L28 [Candidatus Ruthia magnifica str. Cm
          (Calyptogena magnifica)]
 gi|166226615|sp|A1AXP3|RL28_RUTMC RecName: Full=50S ribosomal protein L28
 gi|118567895|gb|ABL02700.1| LSU ribosomal protein L28P [Candidatus Ruthia magnifica str. Cm
          (Calyptogena magnifica)]
          Length = 78

 Score = 89.7 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 29/75 (38%), Positives = 46/75 (61%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M++VC +T K  +SGN VSHANN+TRRRF PNL       +   +  +L++S   LR ++
Sbjct: 1  MAKVCVVTGKRPISGNNVSHANNRTRRRFYPNLHTHRFWVENENRFVKLKLSAKGLRIID 60

Query: 61 RQGGLDRFLSNSKKE 75
          ++G +D  L+  +  
Sbjct: 61 KKG-IDTVLAKIRIR 74


>gi|91791694|ref|YP_561345.1| ribosomal protein L28 [Shewanella denitrificans OS217]
 gi|91713696|gb|ABE53622.1| LSU ribosomal protein L28P [Shewanella denitrificans OS217]
          Length = 106

 Score = 89.7 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 31/84 (36%), Positives = 45/84 (53%), Gaps = 6/84 (7%)

Query: 1   MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
           MSR+C++T K  M GN  SHA N TRRRFLPNL       +  ++  QLR+S   +R ++
Sbjct: 29  MSRICQVTGKKPMVGNNRSHAKNSTRRRFLPNLQNHRFWLEEEKRFVQLRVSTKGIRIID 88

Query: 61  RQGGLDRFLSNSKKENLSARMRTL 84
           ++G           + L AR   +
Sbjct: 89  KKG------IEVVVKELRARGEKV 106


>gi|328675491|gb|AEB28166.1| LSU ribosomal protein L28p [Francisella cf. novicida 3523]
          Length = 78

 Score = 89.7 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 31/75 (41%), Positives = 47/75 (62%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS+VC +T K   +GN VSHA NKTRRRFLPNL       +   +  +LR+S   +R ++
Sbjct: 1  MSKVCIVTGKRPATGNNVSHAQNKTRRRFLPNLHTHRFWVESENRYIKLRVSSKGMRIID 60

Query: 61 RQGGLDRFLSNSKKE 75
          ++G +D  LS+ + +
Sbjct: 61 KKG-IDTVLSDLRAQ 74


>gi|308047855|ref|YP_003911421.1| 50S ribosomal protein L28P [Ferrimonas balearica DSM 9799]
 gi|307630045|gb|ADN74347.1| LSU ribosomal protein L28P [Ferrimonas balearica DSM 9799]
          Length = 78

 Score = 89.7 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 29/84 (34%), Positives = 47/84 (55%), Gaps = 6/84 (7%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS+VC++T K  ++GN  SHANN T+RRFLPNL       +  ++  +LR+S   +R ++
Sbjct: 1  MSKVCQVTGKRPVTGNNRSHANNATKRRFLPNLQTHRFWVEGEKRFVKLRVSTKGMRIID 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTL 84
          ++G        +    L AR   +
Sbjct: 61 KKG------IEAVLTELRARGEKI 78


>gi|329945915|ref|ZP_08293602.1| ribosomal protein L28 [Actinomyces sp. oral taxon 170 str. F0386]
 gi|328528363|gb|EGF55341.1| ribosomal protein L28 [Actinomyces sp. oral taxon 170 str. F0386]
          Length = 82

 Score = 89.7 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 22/80 (27%), Positives = 44/80 (55%), Gaps = 3/80 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+  C++T    + G  VSH++ +T RR+ PNL R       + +  +L +S   +R+++
Sbjct: 4  MTTYCQVTGTRPVFGRSVSHSHKRTPRRWNPNLQRKRYWVPSLGRTVRLTVSAKGIRTID 63

Query: 61 RQGGLDRFLSN--SKKENLS 78
          + G +D  ++   ++ E LS
Sbjct: 64 KLG-IDVVVAQMLARGEKLS 82


>gi|212542117|ref|XP_002151213.1| 50S ribosomal protein L24 [Penicillium marneffei ATCC 18224]
 gi|210066120|gb|EEA20213.1| 50S ribosomal protein L24 [Penicillium marneffei ATCC 18224]
          Length = 237

 Score = 89.7 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 26/92 (28%), Positives = 50/92 (54%), Gaps = 5/92 (5%)

Query: 9   KKTVMSGNKVSHANNK--TRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLD 66
             ++  GNK+S   NK  TRR + PN+    + S+ + +   +++++ ALR++ + GGLD
Sbjct: 70  GVSISFGNKISKGRNKGKTRRSWKPNVRWKKMPSEALGEDVFVKLTRKALRTIRKCGGLD 129

Query: 67  RFLSNSKK---ENLSARMRTLRSQILKKMSEK 95
            +L + K    + L      LR +I++  + K
Sbjct: 130 NYLLSDKPSRLKELGLAGWKLRYRIMQSPAMK 161


>gi|88797505|ref|ZP_01113094.1| 50S ribosomal protein L28 [Reinekea sp. MED297]
 gi|88779677|gb|EAR10863.1| 50S ribosomal protein L28 [Reinekea sp. MED297]
          Length = 78

 Score = 89.7 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 26/63 (41%), Positives = 42/63 (66%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  ++GN VSH+  KT+RRFLPNL       +  ++  +LR+S   +R ++
Sbjct: 1  MSRVCQVTGKRPVTGNNVSHSQIKTKRRFLPNLHSHRFWVESEKRFVKLRVSTKGMRIID 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|331005612|ref|ZP_08328982.1| LSU ribosomal protein L28p [gamma proteobacterium IMCC1989]
 gi|330420585|gb|EGG94881.1| LSU ribosomal protein L28p [gamma proteobacterium IMCC1989]
          Length = 78

 Score = 89.7 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 31/84 (36%), Positives = 49/84 (58%), Gaps = 6/84 (7%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  ++GN VSHA N T+RRFLPNL       +  ++  +LR+S   +R ++
Sbjct: 1  MSRVCQVTGKRPVTGNNVSHAKNHTKRRFLPNLHSHRFWVESEKRFVKLRVSTKGMRIID 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTL 84
          ++G        S  E+L +R   +
Sbjct: 61 KKG------IESVLEDLRSRGEKV 78


>gi|146309769|ref|YP_001174843.1| 50S ribosomal protein L28 [Enterobacter sp. 638]
 gi|206578199|ref|YP_002236001.1| ribosomal protein L28 [Klebsiella pneumoniae 342]
 gi|288933008|ref|YP_003437067.1| ribosomal protein L28 [Klebsiella variicola At-22]
 gi|290511801|ref|ZP_06551169.1| 50S ribosomal protein L28 [Klebsiella sp. 1_1_55]
 gi|311277442|ref|YP_003939673.1| ribosomal protein L28 [Enterobacter cloacae SCF1]
 gi|166987912|sp|A4W512|RL28_ENT38 RecName: Full=50S ribosomal protein L28
 gi|226694950|sp|B5XTG6|RL28_KLEP3 RecName: Full=50S ribosomal protein L28
 gi|145316645|gb|ABP58792.1| LSU ribosomal protein L28P [Enterobacter sp. 638]
 gi|206567257|gb|ACI09033.1| ribosomal protein L28 [Klebsiella pneumoniae 342]
 gi|288887737|gb|ADC56055.1| ribosomal protein L28 [Klebsiella variicola At-22]
 gi|289775591|gb|EFD83591.1| 50S ribosomal protein L28 [Klebsiella sp. 1_1_55]
 gi|308746637|gb|ADO46389.1| ribosomal protein L28 [Enterobacter cloacae SCF1]
          Length = 78

 Score = 89.7 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 29/75 (38%), Positives = 45/75 (60%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  ++GN  SHA N T+RRFLPNL       +  ++   LR+S   +R ++
Sbjct: 1  MSRVCQVTGKRPVTGNNRSHALNATKRRFLPNLHSHRFWVESEKRFVTLRVSAKGMRVID 60

Query: 61 RQGGLDRFLSNSKKE 75
          ++G +D  LS  +  
Sbjct: 61 KKG-IDTVLSELRAR 74


>gi|269796915|ref|YP_003316370.1| 50S ribosomal protein L28P [Sanguibacter keddieii DSM 10542]
 gi|269099100|gb|ACZ23536.1| LSU ribosomal protein L28P [Sanguibacter keddieii DSM 10542]
          Length = 78

 Score = 89.7 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 18/63 (28%), Positives = 36/63 (57%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS VC++       G+ +SH++ +T+RRF PN+ +       + +   LR+S   L++++
Sbjct: 1  MSAVCQVLGTQPGFGHTISHSHVRTKRRFNPNIQKKRFWVPSLGRHVTLRVSARGLKTID 60

Query: 61 RQG 63
          + G
Sbjct: 61 KLG 63


>gi|15640248|ref|NP_229875.1| 50S ribosomal protein L28 [Vibrio cholerae O1 biovar El Tor str.
          N16961]
 gi|121729458|ref|ZP_01682087.1| ribosomal protein L28 [Vibrio cholerae V52]
 gi|147673253|ref|YP_001218478.1| 50S ribosomal protein L28 [Vibrio cholerae O395]
 gi|153214734|ref|ZP_01949579.1| ribosomal protein L28 [Vibrio cholerae 1587]
 gi|153800811|ref|ZP_01955397.1| ribosomal protein L28 [Vibrio cholerae MZO-3]
 gi|153820024|ref|ZP_01972691.1| ribosomal protein L28 [Vibrio cholerae NCTC 8457]
 gi|153826353|ref|ZP_01979020.1| ribosomal protein L28 [Vibrio cholerae MZO-2]
 gi|227080438|ref|YP_002808989.1| ribosomal protein L28 [Vibrio cholerae M66-2]
 gi|229506981|ref|ZP_04396489.1| LSU ribosomal protein L28p [Vibrio cholerae BX 330286]
 gi|229509351|ref|ZP_04398834.1| LSU ribosomal protein L28p [Vibrio cholerae B33]
 gi|229512789|ref|ZP_04402257.1| LSU ribosomal protein L28p [Vibrio cholerae TMA 21]
 gi|229516298|ref|ZP_04405746.1| LSU ribosomal protein L28p [Vibrio cholerae RC9]
 gi|229524830|ref|ZP_04414235.1| LSU ribosomal protein L28p [Vibrio cholerae bv. albensis VL426]
 gi|229527279|ref|ZP_04416672.1| LSU ribosomal protein L28p [Vibrio cholerae 12129(1)]
 gi|229606489|ref|YP_002877137.1| 50S ribosomal protein L28 [Vibrio cholerae MJ-1236]
 gi|254225708|ref|ZP_04919315.1| ribosomal protein L28 [Vibrio cholerae V51]
 gi|254851348|ref|ZP_05240698.1| 50S ribosomal protein L28 [Vibrio cholerae MO10]
 gi|255744030|ref|ZP_05417984.1| LSU ribosomal protein L28p [Vibrio cholera CIRS 101]
 gi|258620578|ref|ZP_05715615.1| ribosomal protein L28 [Vibrio mimicus VM573]
 gi|258625888|ref|ZP_05720763.1| ribosomal protein L28 [Vibrio mimicus VM603]
 gi|261210489|ref|ZP_05924783.1| LSU ribosomal protein L28p [Vibrio sp. RC341]
 gi|262161921|ref|ZP_06030938.1| LSU ribosomal protein L28p [Vibrio cholerae INDRE 91/1]
 gi|262163758|ref|ZP_06031498.1| LSU ribosomal protein L28p [Vibrio mimicus VM223]
 gi|262168069|ref|ZP_06035768.1| LSU ribosomal protein L28p [Vibrio cholerae RC27]
 gi|262172689|ref|ZP_06040367.1| LSU ribosomal protein L28p [Vibrio mimicus MB-451]
 gi|262404955|ref|ZP_06081507.1| LSU ribosomal protein L28p [Vibrio sp. RC586]
 gi|297581671|ref|ZP_06943593.1| ribosomal protein L28 [Vibrio cholerae RC385]
 gi|298500860|ref|ZP_07010662.1| ribosomal protein L28 [Vibrio cholerae MAK 757]
 gi|14195136|sp|Q9KVC8|RL28_VIBCH RecName: Full=50S ribosomal protein L28
 gi|172047482|sp|A5F404|RL28_VIBC3 RecName: Full=50S ribosomal protein L28
 gi|254801386|sp|C3LQI0|RL28_VIBCM RecName: Full=50S ribosomal protein L28
 gi|9654626|gb|AAF93394.1| ribosomal protein L28 [Vibrio cholerae O1 biovar El Tor str.
          N16961]
 gi|121628633|gb|EAX61108.1| ribosomal protein L28 [Vibrio cholerae V52]
 gi|124115170|gb|EAY33990.1| ribosomal protein L28 [Vibrio cholerae 1587]
 gi|124123642|gb|EAY42385.1| ribosomal protein L28 [Vibrio cholerae MZO-3]
 gi|125621828|gb|EAZ50155.1| ribosomal protein L28 [Vibrio cholerae V51]
 gi|126509428|gb|EAZ72022.1| ribosomal protein L28 [Vibrio cholerae NCTC 8457]
 gi|146315136|gb|ABQ19675.1| ribosomal protein L28 [Vibrio cholerae O395]
 gi|149739922|gb|EDM54109.1| ribosomal protein L28 [Vibrio cholerae MZO-2]
 gi|227008326|gb|ACP04538.1| ribosomal protein L28 [Vibrio cholerae M66-2]
 gi|227012065|gb|ACP08275.1| ribosomal protein L28 [Vibrio cholerae O395]
 gi|229335287|gb|EEO00771.1| LSU ribosomal protein L28p [Vibrio cholerae 12129(1)]
 gi|229338411|gb|EEO03428.1| LSU ribosomal protein L28p [Vibrio cholerae bv. albensis VL426]
 gi|229346724|gb|EEO11694.1| LSU ribosomal protein L28p [Vibrio cholerae RC9]
 gi|229350299|gb|EEO15251.1| LSU ribosomal protein L28p [Vibrio cholerae TMA 21]
 gi|229353666|gb|EEO18603.1| LSU ribosomal protein L28p [Vibrio cholerae B33]
 gi|229356086|gb|EEO21005.1| LSU ribosomal protein L28p [Vibrio cholerae BX 330286]
 gi|229369144|gb|ACQ59567.1| LSU ribosomal protein L28p [Vibrio cholerae MJ-1236]
 gi|254847053|gb|EET25467.1| 50S ribosomal protein L28 [Vibrio cholerae MO10]
 gi|255738295|gb|EET93686.1| LSU ribosomal protein L28p [Vibrio cholera CIRS 101]
 gi|258581852|gb|EEW06726.1| ribosomal protein L28 [Vibrio mimicus VM603]
 gi|258587093|gb|EEW11805.1| ribosomal protein L28 [Vibrio mimicus VM573]
 gi|260840547|gb|EEX67113.1| LSU ribosomal protein L28p [Vibrio sp. RC341]
 gi|261893765|gb|EEY39751.1| LSU ribosomal protein L28p [Vibrio mimicus MB-451]
 gi|262023602|gb|EEY42304.1| LSU ribosomal protein L28p [Vibrio cholerae RC27]
 gi|262027738|gb|EEY46403.1| LSU ribosomal protein L28p [Vibrio mimicus VM223]
 gi|262028299|gb|EEY46955.1| LSU ribosomal protein L28p [Vibrio cholerae INDRE 91/1]
 gi|262348794|gb|EEY97935.1| LSU ribosomal protein L28p [Vibrio sp. RC586]
 gi|297534078|gb|EFH72917.1| ribosomal protein L28 [Vibrio cholerae RC385]
 gi|297540364|gb|EFH76423.1| ribosomal protein L28 [Vibrio cholerae MAK 757]
          Length = 78

 Score = 89.7 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 27/75 (36%), Positives = 43/75 (57%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K    GN  SHA N T+RRFLPNL       +  ++  +LR++   +R ++
Sbjct: 1  MSRVCQVTGKRPAVGNNRSHAKNATKRRFLPNLQTHRFWVESEKRFVKLRLTAKGMRIID 60

Query: 61 RQGGLDRFLSNSKKE 75
          ++G +D  L   +  
Sbjct: 61 KKG-IDAVLVEIRAR 74


>gi|192361901|ref|YP_001983968.1| 50S ribosomal protein L28 [Cellvibrio japonicus Ueda107]
 gi|226738047|sp|B3PG61|RL28_CELJU RecName: Full=50S ribosomal protein L28
 gi|190688066|gb|ACE85744.1| ribosomal protein L28-related protein [Cellvibrio japonicus
          Ueda107]
          Length = 78

 Score = 89.7 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 25/75 (33%), Positives = 46/75 (61%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS+VC++T K  ++G+ VSHA N T+RRFLPNL       +  ++   LR++   +R ++
Sbjct: 1  MSKVCQVTGKRPITGHNVSHAKNHTKRRFLPNLQTHRFWVEAEKRFVTLRLTPKGMRIID 60

Query: 61 RQGGLDRFLSNSKKE 75
          + G ++  L++ +  
Sbjct: 61 KLG-IEAVLADIRAR 74


>gi|311743542|ref|ZP_07717348.1| 50S ribosomal protein L28 [Aeromicrobium marinum DSM 15272]
 gi|311312672|gb|EFQ82583.1| 50S ribosomal protein L28 [Aeromicrobium marinum DSM 15272]
          Length = 90

 Score = 89.7 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 21/71 (29%), Positives = 42/71 (59%), Gaps = 1/71 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC +T      G+ VSH++ +T+RRF  N+ R    +  + +   L +S   +++V+
Sbjct: 13 MSRVCPVTGAQPGFGHHVSHSHRRTKRRFDVNIQRKRYWAPTLGRHVTLTLSARGIKTVD 72

Query: 61 RQGGLDRFLSN 71
          ++G +D  +++
Sbjct: 73 QRG-IDAVVAD 82


>gi|262374142|ref|ZP_06067419.1| ribosomal protein L28 [Acinetobacter junii SH205]
 gi|262311153|gb|EEY92240.1| ribosomal protein L28 [Acinetobacter junii SH205]
          Length = 78

 Score = 89.7 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 26/63 (41%), Positives = 41/63 (65%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS+VC++T K  + GN VSHANNKT+RRF PNL       +  ++  +LR++   +R ++
Sbjct: 1  MSKVCQVTGKRPIVGNNVSHANNKTKRRFEPNLHHHRFWLESEKRFVRLRLTTKGMRIID 60

Query: 61 RQG 63
          + G
Sbjct: 61 KLG 63


>gi|24375731|ref|NP_719774.1| ribosomal protein L28 [Shewanella oneidensis MR-1]
 gi|113971924|ref|YP_735717.1| 50S ribosomal protein L28 [Shewanella sp. MR-4]
 gi|114045870|ref|YP_736420.1| 50S ribosomal protein L28 [Shewanella sp. MR-7]
 gi|117922201|ref|YP_871393.1| 50S ribosomal protein L28 [Shewanella sp. ANA-3]
 gi|120597170|ref|YP_961744.1| 50S ribosomal protein L28 [Shewanella sp. W3-18-1]
 gi|126172630|ref|YP_001048779.1| 50S ribosomal protein L28 [Shewanella baltica OS155]
 gi|146291570|ref|YP_001181994.1| 50S ribosomal protein L28 [Shewanella putrefaciens CN-32]
 gi|152998928|ref|YP_001364609.1| 50S ribosomal protein L28 [Shewanella baltica OS185]
 gi|160873514|ref|YP_001552830.1| 50S ribosomal protein L28 [Shewanella baltica OS195]
 gi|217971609|ref|YP_002356360.1| 50S ribosomal protein L28 [Shewanella baltica OS223]
 gi|304411667|ref|ZP_07393279.1| ribosomal protein L28 [Shewanella baltica OS183]
 gi|307306281|ref|ZP_07586026.1| ribosomal protein L28 [Shewanella baltica BA175]
 gi|67461528|sp|Q8E9M3|RL28_SHEON RecName: Full=50S ribosomal protein L28
 gi|122945022|sp|Q0HZU2|RL28_SHESR RecName: Full=50S ribosomal protein L28
 gi|123130027|sp|Q0HE57|RL28_SHESM RecName: Full=50S ribosomal protein L28
 gi|166226617|sp|A3CZJ7|RL28_SHEB5 RecName: Full=50S ribosomal protein L28
 gi|166226618|sp|A6WIA7|RL28_SHEB8 RecName: Full=50S ribosomal protein L28
 gi|166226620|sp|A4Y2L2|RL28_SHEPC RecName: Full=50S ribosomal protein L28
 gi|166226621|sp|A0L1R8|RL28_SHESA RecName: Full=50S ribosomal protein L28
 gi|166226622|sp|A1REU5|RL28_SHESW RecName: Full=50S ribosomal protein L28
 gi|189029453|sp|A9KY05|RL28_SHEB9 RecName: Full=50S ribosomal protein L28
 gi|254801375|sp|B8E4J6|RL28_SHEB2 RecName: Full=50S ribosomal protein L28
 gi|24350668|gb|AAN57218.1|AE015857_11 ribosomal protein L28 [Shewanella oneidensis MR-1]
 gi|113886608|gb|ABI40660.1| LSU ribosomal protein L28P [Shewanella sp. MR-4]
 gi|113887312|gb|ABI41363.1| LSU ribosomal protein L28P [Shewanella sp. MR-7]
 gi|117614533|gb|ABK49987.1| LSU ribosomal protein L28P [Shewanella sp. ANA-3]
 gi|120557263|gb|ABM23190.1| LSU ribosomal protein L28P [Shewanella sp. W3-18-1]
 gi|125995835|gb|ABN59910.1| LSU ribosomal protein L28P [Shewanella baltica OS155]
 gi|145563260|gb|ABP74195.1| LSU ribosomal protein L28P [Shewanella putrefaciens CN-32]
 gi|151363546|gb|ABS06546.1| ribosomal protein L28 [Shewanella baltica OS185]
 gi|160859036|gb|ABX47570.1| ribosomal protein L28 [Shewanella baltica OS195]
 gi|217496744|gb|ACK44937.1| ribosomal protein L28 [Shewanella baltica OS223]
 gi|304349855|gb|EFM14261.1| ribosomal protein L28 [Shewanella baltica OS183]
 gi|306911154|gb|EFN41581.1| ribosomal protein L28 [Shewanella baltica BA175]
 gi|315265743|gb|ADT92596.1| ribosomal protein L28 [Shewanella baltica OS678]
 gi|319424743|gb|ADV52817.1| ribosomal protein L28 [Shewanella putrefaciens 200]
          Length = 78

 Score = 89.3 bits (221), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 29/63 (46%), Positives = 40/63 (63%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  M GN  SHA N TRRRFLPNL       +  ++  QLR+S   +R ++
Sbjct: 1  MSRVCQVTGKKPMVGNNRSHAKNATRRRFLPNLQNHRFWLEEEKRFVQLRVSTKGIRLID 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|90023319|ref|YP_529146.1| 50S ribosomal protein L28 [Saccharophagus degradans 2-40]
 gi|123276030|sp|Q21EE5|RL28_SACD2 RecName: Full=50S ribosomal protein L28
 gi|89952919|gb|ABD82934.1| LSU ribosomal protein L28P [Saccharophagus degradans 2-40]
          Length = 78

 Score = 89.3 bits (221), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 27/75 (36%), Positives = 47/75 (62%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M++VC++T K  ++G+ VSHA N T+RRFLPNL       +  ++  +LRIS   +R ++
Sbjct: 1  MAKVCQVTGKRPVTGHNVSHAKNHTKRRFLPNLHSHRFWVESEKRFVKLRISTKGMRIID 60

Query: 61 RQGGLDRFLSNSKKE 75
          ++G +D  L+  +  
Sbjct: 61 KKG-IDTVLAELRAR 74


>gi|115372990|ref|ZP_01460294.1| ribosomal protein L28 [Stigmatella aurantiaca DW4/3-1]
 gi|310818660|ref|YP_003951018.1| 50S ribosomal protein L28 [Stigmatella aurantiaca DW4/3-1]
 gi|115370068|gb|EAU68999.1| ribosomal protein L28 [Stigmatella aurantiaca DW4/3-1]
 gi|309391732|gb|ADO69191.1| 50S ribosomal protein L28 [Stigmatella aurantiaca DW4/3-1]
          Length = 78

 Score = 89.3 bits (221), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 27/63 (42%), Positives = 40/63 (63%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS+VC++T K  + GN VSH+NNKT+RR LPNL       +   +  +LR+S   +R + 
Sbjct: 1  MSKVCQVTGKRPLVGNNVSHSNNKTKRRSLPNLQWKRFWVEKENRFVRLRVSAHGIRIIN 60

Query: 61 RQG 63
          +QG
Sbjct: 61 KQG 63


>gi|123440464|ref|YP_001004458.1| 50S ribosomal protein L28 [Yersinia enterocolitica subsp.
          enterocolitica 8081]
 gi|332159687|ref|YP_004296264.1| 50S ribosomal protein L28 [Yersinia enterocolitica subsp.
          palearctica 105.5R(r)]
 gi|166228173|sp|A1JHR2|RL28_YERE8 RecName: Full=50S ribosomal protein L28
 gi|122087425|emb|CAL10206.1| 50S ribosomal protein L28 [Yersinia enterocolitica subsp.
          enterocolitica 8081]
 gi|318603786|emb|CBY25284.1| LSU ribosomal protein L28p [Yersinia enterocolitica subsp.
          palearctica Y11]
 gi|325663917|gb|ADZ40561.1| 50S ribosomal protein L28 [Yersinia enterocolitica subsp.
          palearctica 105.5R(r)]
 gi|330859990|emb|CBX70318.1| 50S ribosomal protein L28 [Yersinia enterocolitica W22703]
          Length = 78

 Score = 89.3 bits (221), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 28/75 (37%), Positives = 45/75 (60%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  +SGN  SHA N T+RRFLPNL       +  ++   LR+S   +R ++
Sbjct: 1  MSRVCQVTGKRPVSGNNRSHAMNATKRRFLPNLHSHRFWVEGEKRFVTLRVSAKGMRVID 60

Query: 61 RQGGLDRFLSNSKKE 75
          ++G ++  L+  +  
Sbjct: 61 KKG-IETVLAEIRAR 74


>gi|50083741|ref|YP_045251.1| 50S ribosomal protein L28 [Acinetobacter sp. ADP1]
 gi|126640521|ref|YP_001083505.1| 50S ribosomal protein L28 [Acinetobacter baumannii ATCC 17978]
 gi|169634455|ref|YP_001708191.1| 50S ribosomal protein L28 [Acinetobacter baumannii SDF]
 gi|169797300|ref|YP_001715093.1| 50S ribosomal protein L28 [Acinetobacter baumannii AYE]
 gi|184156778|ref|YP_001845117.1| 50S ribosomal protein L28 [Acinetobacter baumannii ACICU]
 gi|213155890|ref|YP_002317935.1| ribosomal protein L28 [Acinetobacter baumannii AB0057]
 gi|215484737|ref|YP_002326972.1| ribosomal protein L28 [Acinetobacter baumannii AB307-0294]
 gi|239500819|ref|ZP_04660129.1| 50S ribosomal protein L28 [Acinetobacter baumannii AB900]
 gi|255321191|ref|ZP_05362357.1| ribosomal protein L28 [Acinetobacter radioresistens SK82]
 gi|260549128|ref|ZP_05823349.1| ribosomal protein L28 [Acinetobacter sp. RUH2624]
 gi|260556188|ref|ZP_05828407.1| ribosomal protein L28 [Acinetobacter baumannii ATCC 19606]
 gi|262280873|ref|ZP_06058656.1| ribosomal protein L28 [Acinetobacter calcoaceticus RUH2202]
 gi|262369955|ref|ZP_06063282.1| ribosomal protein L28 [Acinetobacter johnsonii SH046]
 gi|262375013|ref|ZP_06068247.1| ribosomal protein L28 [Acinetobacter lwoffii SH145]
 gi|262380123|ref|ZP_06073278.1| ribosomal protein L28 [Acinetobacter radioresistens SH164]
 gi|293610244|ref|ZP_06692545.1| 50S ribosomal protein L28 [Acinetobacter sp. SH024]
 gi|299771669|ref|YP_003733695.1| 50S ribosomal protein L28 [Acinetobacter sp. DR1]
 gi|301346579|ref|ZP_07227320.1| 50S ribosomal protein L28 [Acinetobacter baumannii AB056]
 gi|301511046|ref|ZP_07236283.1| 50S ribosomal protein L28 [Acinetobacter baumannii AB058]
 gi|301596908|ref|ZP_07241916.1| 50S ribosomal protein L28 [Acinetobacter baumannii AB059]
 gi|332853001|ref|ZP_08434511.1| ribosomal protein L28 [Acinetobacter baumannii 6013150]
 gi|332866451|ref|ZP_08437020.1| ribosomal protein L28 [Acinetobacter baumannii 6013113]
 gi|332873190|ref|ZP_08441147.1| ribosomal protein L28 [Acinetobacter baumannii 6014059]
 gi|67461401|sp|Q6FES9|RL28_ACIAD RecName: Full=50S ribosomal protein L28
 gi|166226530|sp|A3M1V9|RL28_ACIBT RecName: Full=50S ribosomal protein L28
 gi|226738013|sp|B7H0Q4|RL28_ACIB3 RecName: Full=50S ribosomal protein L28
 gi|226738014|sp|B7I4T0|RL28_ACIB5 RecName: Full=50S ribosomal protein L28
 gi|226738015|sp|B2I392|RL28_ACIBC RecName: Full=50S ribosomal protein L28
 gi|226738016|sp|B0VL79|RL28_ACIBS RecName: Full=50S ribosomal protein L28
 gi|226738017|sp|B0V4N1|RL28_ACIBY RecName: Full=50S ribosomal protein L28
 gi|49529717|emb|CAG67429.1| 50S ribosomal protein L28 [Acinetobacter sp. ADP1]
 gi|126386405|gb|ABO10903.1| 50S ribosomal protein L28 [Acinetobacter baumannii ATCC 17978]
 gi|169150227|emb|CAM88123.1| 50S ribosomal protein L28 [Acinetobacter baumannii AYE]
 gi|169153247|emb|CAP02347.1| 50S ribosomal protein L28 [Acinetobacter baumannii]
 gi|183208372|gb|ACC55770.1| putative ribosomal protein L28 [Acinetobacter baumannii ACICU]
 gi|213055050|gb|ACJ39952.1| ribosomal protein L28 [Acinetobacter baumannii AB0057]
 gi|213986890|gb|ACJ57189.1| ribosomal protein L28 [Acinetobacter baumannii AB307-0294]
 gi|255301745|gb|EET80996.1| ribosomal protein L28 [Acinetobacter radioresistens SK82]
 gi|260407856|gb|EEX01328.1| ribosomal protein L28 [Acinetobacter sp. RUH2624]
 gi|260410243|gb|EEX03542.1| ribosomal protein L28 [Acinetobacter baumannii ATCC 19606]
 gi|262257773|gb|EEY76508.1| ribosomal protein L28 [Acinetobacter calcoaceticus RUH2202]
 gi|262298317|gb|EEY86231.1| ribosomal protein L28 [Acinetobacter radioresistens SH164]
 gi|262310026|gb|EEY91155.1| ribosomal protein L28 [Acinetobacter lwoffii SH145]
 gi|262314994|gb|EEY96034.1| ribosomal protein L28 [Acinetobacter johnsonii SH046]
 gi|292827476|gb|EFF85840.1| 50S ribosomal protein L28 [Acinetobacter sp. SH024]
 gi|298701757|gb|ADI92322.1| 50S ribosomal protein L28 [Acinetobacter sp. DR1]
 gi|322506670|gb|ADX02124.1| rpmB [Acinetobacter baumannii 1656-2]
 gi|323516545|gb|ADX90926.1| 50S ribosomal protein L28 [Acinetobacter baumannii TCDC-AB0715]
 gi|325124423|gb|ADY83946.1| 50S ribosomal protein L28 [Acinetobacter calcoaceticus PHEA-2]
 gi|332728937|gb|EGJ60292.1| ribosomal protein L28 [Acinetobacter baumannii 6013150]
 gi|332734608|gb|EGJ65715.1| ribosomal protein L28 [Acinetobacter baumannii 6013113]
 gi|332738702|gb|EGJ69572.1| ribosomal protein L28 [Acinetobacter baumannii 6014059]
          Length = 78

 Score = 89.3 bits (221), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 26/63 (41%), Positives = 41/63 (65%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS+VC++T K  + GN VSHANNKT+RRF PNL       +  ++  +LR++   +R ++
Sbjct: 1  MSKVCQVTGKRPVVGNNVSHANNKTKRRFEPNLHHHRFWLESEKRFVRLRLTTKGMRIID 60

Query: 61 RQG 63
          + G
Sbjct: 61 KLG 63


>gi|154287660|ref|XP_001544625.1| conserved hypothetical protein [Ajellomyces capsulatus NAm1]
 gi|150408266|gb|EDN03807.1| conserved hypothetical protein [Ajellomyces capsulatus NAm1]
          Length = 191

 Score = 89.3 bits (221), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 26/92 (28%), Positives = 50/92 (54%), Gaps = 5/92 (5%)

Query: 9   KKTVMSGNKVSHANNK--TRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLD 66
             T+  GNK+S   NK  TRR + PN+    L S+ + +  QL++    LR++++ GGLD
Sbjct: 63  GSTIQFGNKISKGRNKGKTRRTWKPNIRHEELYSEALGKTLQLKVQHRVLRTIKKVGGLD 122

Query: 67  RFLSN---SKKENLSARMRTLRSQILKKMSEK 95
           ++L     ++ + L      LR ++++  + +
Sbjct: 123 QYLLGDKPARIKELGIFGWNLRWKVMQSKAMQ 154


>gi|56708623|ref|YP_170519.1| 50S ribosomal protein L28 [Francisella tularensis subsp.
          tularensis SCHU S4]
 gi|89255929|ref|YP_513291.1| 50S ribosomal protein L28 [Francisella tularensis subsp.
          holarctica LVS]
 gi|110671094|ref|YP_667651.1| 50S ribosomal protein L28 [Francisella tularensis subsp.
          tularensis FSC198]
 gi|115314411|ref|YP_763134.1| 50S ribosomal protein L28 [Francisella tularensis subsp.
          holarctica OSU18]
 gi|118496943|ref|YP_897993.1| 50S ribosomal protein L28 [Francisella tularensis subsp. novicida
          U112]
 gi|134301431|ref|YP_001121399.1| 50S ribosomal protein L28 [Francisella tularensis subsp.
          tularensis WY96-3418]
 gi|156501918|ref|YP_001427983.1| 50S ribosomal protein L28 [Francisella tularensis subsp.
          holarctica FTNF002-00]
 gi|167009168|ref|ZP_02274099.1| ribosomal protein L28 [Francisella tularensis subsp. holarctica
          FSC200]
 gi|187931156|ref|YP_001891140.1| 50S ribosomal protein L28 [Francisella tularensis subsp.
          mediasiatica FSC147]
 gi|194324171|ref|ZP_03057945.1| ribosomal protein L28 [Francisella tularensis subsp. novicida
          FTE]
 gi|208780396|ref|ZP_03247737.1| ribosomal protein L28 [Francisella novicida FTG]
 gi|224457816|ref|ZP_03666289.1| 50S ribosomal protein L28 [Francisella tularensis subsp.
          tularensis MA00-2987]
 gi|254367287|ref|ZP_04983314.1| 50S ribosomal protein L28 [Francisella tularensis subsp.
          holarctica 257]
 gi|254368763|ref|ZP_04984776.1| 50S ribosomal protein L28 [Francisella tularensis subsp.
          holarctica FSC022]
 gi|254371256|ref|ZP_04987258.1| 50S ribosomal protein L28 [Francisella tularensis subsp.
          tularensis FSC033]
 gi|254372313|ref|ZP_04987804.1| 50S ribosomal protein L28 [Francisella tularensis subsp. novicida
          GA99-3549]
 gi|254373787|ref|ZP_04989270.1| ribosomal protein L28 [Francisella novicida GA99-3548]
 gi|254875487|ref|ZP_05248197.1| 50S ribosomal protein L28 [Francisella tularensis subsp.
          tularensis MA00-2987]
 gi|290953710|ref|ZP_06558331.1| 50S ribosomal protein L28 [Francisella tularensis subsp.
          holarctica URFT1]
 gi|295312945|ref|ZP_06803664.1| 50S ribosomal protein L28 [Francisella tularensis subsp.
          holarctica URFT1]
 gi|67461296|sp|Q5NEM3|RL28_FRATT RecName: Full=50S ribosomal protein L28
 gi|122325562|sp|Q0BN37|RL28_FRATO RecName: Full=50S ribosomal protein L28
 gi|122501078|sp|Q2A4R1|RL28_FRATH RecName: Full=50S ribosomal protein L28
 gi|123063365|sp|Q14G26|RL28_FRAT1 RecName: Full=50S ribosomal protein L28
 gi|166226572|sp|A7NAM4|RL28_FRATF RecName: Full=50S ribosomal protein L28
 gi|166226573|sp|A0Q4S4|RL28_FRATN RecName: Full=50S ribosomal protein L28
 gi|166226574|sp|A4IWH7|RL28_FRATW RecName: Full=50S ribosomal protein L28
 gi|226694923|sp|B2SFK9|RL28_FRATM RecName: Full=50S ribosomal protein L28
 gi|56605115|emb|CAG46236.1| 50S ribosomal protein L28 [Francisella tularensis subsp.
          tularensis SCHU S4]
 gi|89143760|emb|CAJ78962.1| 50S ribosomal protein L28 [Francisella tularensis subsp.
          holarctica LVS]
 gi|110321427|emb|CAL09619.1| 50S ribosomal protein L28 [Francisella tularensis subsp.
          tularensis FSC198]
 gi|115129310|gb|ABI82497.1| ribosomal protein L28 [Francisella tularensis subsp. holarctica
          OSU18]
 gi|118422849|gb|ABK89239.1| 50S ribosomal protein L28 [Francisella novicida U112]
 gi|134049208|gb|ABO46279.1| ribosomal protein L28 [Francisella tularensis subsp. tularensis
          WY96-3418]
 gi|134253104|gb|EBA52198.1| 50S ribosomal protein L28 [Francisella tularensis subsp.
          holarctica 257]
 gi|151569496|gb|EDN35150.1| 50S ribosomal protein L28 [Francisella tularensis subsp.
          tularensis FSC033]
 gi|151570042|gb|EDN35696.1| 50S ribosomal protein L28 [Francisella novicida GA99-3549]
 gi|151571508|gb|EDN37162.1| ribosomal protein L28 [Francisella novicida GA99-3548]
 gi|156252521|gb|ABU61027.1| ribosomal protein L28 [Francisella tularensis subsp. holarctica
          FTNF002-00]
 gi|157121684|gb|EDO65854.1| 50S ribosomal protein L28 [Francisella tularensis subsp.
          holarctica FSC022]
 gi|187712065|gb|ACD30362.1| 50S ribosomal protein L28 [Francisella tularensis subsp.
          mediasiatica FSC147]
 gi|194321618|gb|EDX19102.1| ribosomal protein L28 [Francisella tularensis subsp. novicida
          FTE]
 gi|208743764|gb|EDZ90067.1| ribosomal protein L28 [Francisella novicida FTG]
 gi|254841486|gb|EET19922.1| 50S ribosomal protein L28 [Francisella tularensis subsp.
          tularensis MA00-2987]
 gi|282159860|gb|ADA79251.1| 50S ribosomal protein L28 [Francisella tularensis subsp.
          tularensis NE061598]
 gi|328676415|gb|AEB27285.1| LSU ribosomal protein L28p [Francisella cf. novicida Fx1]
          Length = 78

 Score = 89.3 bits (221), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 30/75 (40%), Positives = 47/75 (62%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS+VC +T K   +GN VSHA NKT+RRFLPNL       +   +  +LR+S   +R ++
Sbjct: 1  MSKVCIVTGKRPATGNNVSHAQNKTKRRFLPNLHAHRFWVESENRYIKLRVSSKGMRIID 60

Query: 61 RQGGLDRFLSNSKKE 75
          ++G +D  LS+ + +
Sbjct: 61 KKG-IDTVLSDLRAQ 74


>gi|168025860|ref|XP_001765451.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162683301|gb|EDQ69712.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 108

 Score = 89.3 bits (221), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 22/95 (23%), Positives = 46/95 (48%), Gaps = 1/95 (1%)

Query: 2   SRVCELTKKTVMSGNKVSH-ANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
           ++      + +  GN+VS    NK+RR + PN+    + S  +++  ++ I+  ALR ++
Sbjct: 8   AKRGLYAGRHIQFGNQVSEDGGNKSRRTWKPNVQTKRIFSLGLDRYIKMNITMHALRCID 67

Query: 61  RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEK 95
           + GGLD +L  + +  L   +       +  +  K
Sbjct: 68  KAGGLDEYLLTTPEHKLDNDLAREWRTRIAAVYNK 102


>gi|317494720|ref|ZP_07953132.1| ribosomal L28 family protein [Enterobacteriaceae bacterium
          9_2_54FAA]
 gi|316917322|gb|EFV38669.1| ribosomal L28 family protein [Enterobacteriaceae bacterium
          9_2_54FAA]
          Length = 78

 Score = 89.3 bits (221), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 27/75 (36%), Positives = 45/75 (60%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  ++GN  SHA N T+RRFLPNL       +  ++   LR+S   +R ++
Sbjct: 1  MSRVCQVTGKRPVAGNNRSHAMNATKRRFLPNLHSHRFWVEGEKRFVTLRVSAKGMRVID 60

Query: 61 RQGGLDRFLSNSKKE 75
          ++G ++  L+  +  
Sbjct: 61 KKG-IETVLAEIRAR 74


>gi|157373073|ref|YP_001481062.1| 50S ribosomal protein L28 [Serratia proteamaculans 568]
 gi|270265227|ref|ZP_06193489.1| 50S ribosomal protein L28 [Serratia odorifera 4Rx13]
 gi|166987916|sp|A8GLE4|RL28_SERP5 RecName: Full=50S ribosomal protein L28
 gi|157324837|gb|ABV43934.1| ribosomal protein L28 [Serratia proteamaculans 568]
 gi|270040861|gb|EFA13963.1| 50S ribosomal protein L28 [Serratia odorifera 4Rx13]
          Length = 78

 Score = 89.3 bits (221), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 29/83 (34%), Positives = 44/83 (53%), Gaps = 6/83 (7%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  +SGN  SHA N T+RRFLPNL       +  ++   LR+S   +R ++
Sbjct: 1  MSRVCQVTGKRPVSGNNRSHAMNATKRRFLPNLHSHRFWVEAEKRFVTLRVSAKGMRVID 60

Query: 61 RQGGLDRFLSNSKKENLSARMRT 83
          ++G        +   +L  R   
Sbjct: 61 KKG------IETVLADLRTRGEK 77


>gi|320539886|ref|ZP_08039545.1| 50S ribosomal subunit protein L28 [Serratia symbiotica str.
          Tucson]
 gi|322835041|ref|YP_004215068.1| ribosomal protein L28 [Rahnella sp. Y9602]
 gi|320030072|gb|EFW12092.1| 50S ribosomal subunit protein L28 [Serratia symbiotica str.
          Tucson]
 gi|321170242|gb|ADW75941.1| ribosomal protein L28 [Rahnella sp. Y9602]
          Length = 78

 Score = 89.3 bits (221), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 30/83 (36%), Positives = 45/83 (54%), Gaps = 6/83 (7%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  +SGN  SHA N T+RRFLPNL       +  ++   LR+S   +R ++
Sbjct: 1  MSRVCQVTGKRPVSGNNRSHAMNATKRRFLPNLHSHRFWVEAEKRFVTLRVSAKGMRVID 60

Query: 61 RQGGLDRFLSNSKKENLSARMRT 83
          ++G        +   +L AR   
Sbjct: 61 KKG------IETVLADLRARGEK 77


>gi|270159135|ref|ZP_06187791.1| ribosomal protein L28 [Legionella longbeachae D-4968]
 gi|289166031|ref|YP_003456169.1| 50S ribosomal protein L28 [Legionella longbeachae NSW150]
 gi|269987474|gb|EEZ93729.1| ribosomal protein L28 [Legionella longbeachae D-4968]
 gi|288859204|emb|CBJ13136.1| 50S ribosomal protein L28 [Legionella longbeachae NSW150]
          Length = 78

 Score = 89.3 bits (221), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 30/84 (35%), Positives = 50/84 (59%), Gaps = 6/84 (7%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  M+G+KVSHANNKT+RRFLPN+   +   +  ++   L++S   +R ++
Sbjct: 1  MSRVCQVTGKRPMTGHKVSHANNKTKRRFLPNIQNHSFWVEEEKRFVTLKLSTKGMRIID 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTL 84
          + G        +  + L A+   +
Sbjct: 61 KLG------IKAVLDKLRAKGEKI 78


>gi|28896959|ref|NP_796564.1| 50S ribosomal protein L28 [Vibrio parahaemolyticus RIMD 2210633]
 gi|153842080|ref|ZP_01993469.1| ribosomal protein L28 [Vibrio parahaemolyticus AQ3810]
 gi|163803270|ref|ZP_02197149.1| hypothetical protein 1103602000575_AND4_17901 [Vibrio sp. AND4]
 gi|260362384|ref|ZP_05775342.1| ribosomal protein L28 [Vibrio parahaemolyticus K5030]
 gi|260877859|ref|ZP_05890214.1| ribosomal protein L28 [Vibrio parahaemolyticus AN-5034]
 gi|260897662|ref|ZP_05906158.1| ribosomal protein L28 [Vibrio parahaemolyticus Peru-466]
 gi|260899592|ref|ZP_05907987.1| ribosomal protein L28 [Vibrio parahaemolyticus AQ4037]
 gi|31340345|sp|Q87T85|RL28_VIBPA RecName: Full=50S ribosomal protein L28
 gi|28805167|dbj|BAC58448.1| ribosomal protein L28 [Vibrio parahaemolyticus RIMD 2210633]
 gi|149745415|gb|EDM56666.1| ribosomal protein L28 [Vibrio parahaemolyticus AQ3810]
 gi|159172907|gb|EDP57745.1| hypothetical protein AND4_17901 [Vibrio sp. AND4]
 gi|308087500|gb|EFO37195.1| ribosomal protein L28 [Vibrio parahaemolyticus Peru-466]
 gi|308089836|gb|EFO39531.1| ribosomal protein L28 [Vibrio parahaemolyticus AN-5034]
 gi|308108807|gb|EFO46347.1| ribosomal protein L28 [Vibrio parahaemolyticus AQ4037]
 gi|308115155|gb|EFO52695.1| ribosomal protein L28 [Vibrio parahaemolyticus K5030]
 gi|328471755|gb|EGF42632.1| 50S ribosomal protein L28 [Vibrio parahaemolyticus 10329]
          Length = 78

 Score = 88.9 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 27/75 (36%), Positives = 47/75 (62%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  ++GN  SHA N T+RRFLPNL       +  ++  +LR++   +R ++
Sbjct: 1  MSRVCQVTGKRPVTGNNRSHARNATKRRFLPNLQTHRFWVESEKRFVKLRLTAKGMRIID 60

Query: 61 RQGGLDRFLSNSKKE 75
          ++G +D  L++ +  
Sbjct: 61 KKG-IDTVLADIRAR 74


>gi|296417908|ref|XP_002838589.1| hypothetical protein [Tuber melanosporum Mel28]
 gi|295634539|emb|CAZ82780.1| unnamed protein product [Tuber melanosporum]
          Length = 249

 Score = 88.9 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 25/86 (29%), Positives = 45/86 (52%), Gaps = 5/86 (5%)

Query: 9   KKTVMSGNKVSHA--NNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLD 66
            K +  GN V       KTRR+++PN+   ++ S  +   + L I+   LR++++ GGLD
Sbjct: 62  GKHIQFGNNVPENFLRYKTRRQWMPNVRHRSVYSRALGMHFSLDITTSVLRTIDKVGGLD 121

Query: 67  RFLSNSKK---ENLSARMRTLRSQIL 89
            +L+ +K    + L      LR ++L
Sbjct: 122 AYLTGTKPARLKELGPTGWRLRWRVL 147


>gi|308188655|ref|YP_003932786.1| 50S ribosomal protein L28 [Pantoea vagans C9-1]
 gi|308059165|gb|ADO11337.1| 50S ribosomal protein L28 [Pantoea vagans C9-1]
          Length = 78

 Score = 88.9 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 29/75 (38%), Positives = 46/75 (61%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  ++GN  SHA N T+RRFLPNL       +  ++   LR+S   +R ++
Sbjct: 1  MSRVCQVTGKRPVTGNNRSHAMNATKRRFLPNLHSHRFWVESEKRFVTLRVSVKGMRIID 60

Query: 61 RQGGLDRFLSNSKKE 75
          ++G +D  LS+ +  
Sbjct: 61 KKG-IDTVLSDMRAR 74


>gi|300721249|ref|YP_003710519.1| 50S ribosomal subunit protein L28 [Xenorhabdus nematophila ATCC
          19061]
 gi|297627736|emb|CBJ88262.1| 50S ribosomal subunit protein L28 [Xenorhabdus nematophila ATCC
          19061]
          Length = 78

 Score = 88.9 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 29/75 (38%), Positives = 45/75 (60%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  +SGN  SHA N T+RRFLPNL       +  ++   LR+S   +R ++
Sbjct: 1  MSRVCQVTGKRPVSGNNRSHALNATKRRFLPNLHSHRFWVESEKRFVTLRVSVKGMRVID 60

Query: 61 RQGGLDRFLSNSKKE 75
          ++G +D  L+  +  
Sbjct: 61 KKG-IDTVLAELRAR 74


>gi|156369464|ref|XP_001627996.1| predicted protein [Nematostella vectensis]
 gi|156389150|ref|XP_001634855.1| predicted protein [Nematostella vectensis]
 gi|156214961|gb|EDO35933.1| predicted protein [Nematostella vectensis]
 gi|156221942|gb|EDO42792.1| predicted protein [Nematostella vectensis]
          Length = 113

 Score = 88.9 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 24/89 (26%), Positives = 49/89 (55%), Gaps = 1/89 (1%)

Query: 9   KKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRF 68
            K +M G+  + +  KT+R + PN+ R    S+++E+      +  A+R +++ GG D +
Sbjct: 25  GKGIMFGHVETFSGKKTKRAWKPNVHRKKYYSEVLEKNLSYNFTTHAMRCIDKAGGFDNY 84

Query: 69  LSNSKKENLSARMR-TLRSQILKKMSEKS 96
           + N+K   L ++    L++ + K +S KS
Sbjct: 85  ILNTKDSKLQSKAAIELKNLMSKVLSCKS 113


>gi|256422104|ref|YP_003122757.1| ribosomal protein L28 [Chitinophaga pinensis DSM 2588]
 gi|256037012|gb|ACU60556.1| ribosomal protein L28 [Chitinophaga pinensis DSM 2588]
          Length = 78

 Score = 88.9 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 24/63 (38%), Positives = 40/63 (63%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVC++T K  ++G+ VS +N KT+RRFLPNL +        ++   L++S   LR++ 
Sbjct: 1  MARVCQVTGKKPITGHHVSFSNIKTKRRFLPNLQKKRFFLAEEDRWISLKVSADGLRTIN 60

Query: 61 RQG 63
          + G
Sbjct: 61 KNG 63


>gi|239996972|ref|ZP_04717496.1| ribosomal protein L28 [Alteromonas macleodii ATCC 27126]
          Length = 78

 Score = 88.9 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 29/75 (38%), Positives = 44/75 (58%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K    GN  SHA N TRRRFLPNL       +   +  +LR+S   +R ++
Sbjct: 1  MSRVCQVTGKRPTVGNNRSHARNATRRRFLPNLQTHRFWVESENRFVKLRLSAKGMRIID 60

Query: 61 RQGGLDRFLSNSKKE 75
          ++G +D  L++ +  
Sbjct: 61 KKG-IDSVLTDIRTR 74


>gi|227115113|ref|ZP_03828769.1| 50S ribosomal protein L28 [Pectobacterium carotovorum subsp.
          brasiliensis PBR1692]
 gi|227328062|ref|ZP_03832086.1| 50S ribosomal protein L28 [Pectobacterium carotovorum subsp.
          carotovorum WPP14]
 gi|253690460|ref|YP_003019650.1| ribosomal protein L28 [Pectobacterium carotovorum subsp.
          carotovorum PC1]
 gi|261823582|ref|YP_003261688.1| 50S ribosomal protein L28 [Pectobacterium wasabiae WPP163]
 gi|259646746|sp|C6DIC0|RL28_PECCP RecName: Full=50S ribosomal protein L28
 gi|251757038|gb|ACT15114.1| ribosomal protein L28 [Pectobacterium carotovorum subsp.
          carotovorum PC1]
 gi|261607595|gb|ACX90081.1| ribosomal protein L28 [Pectobacterium wasabiae WPP163]
          Length = 78

 Score = 88.9 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 29/83 (34%), Positives = 45/83 (54%), Gaps = 6/83 (7%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  ++GN  SHA N T+RRFLPNL       +  ++   LR+S   +R ++
Sbjct: 1  MSRVCQVTGKRPVAGNNRSHALNATKRRFLPNLHSHRFWVEGEKRFVTLRVSAKGMRVID 60

Query: 61 RQGGLDRFLSNSKKENLSARMRT 83
          ++G        +   +L AR   
Sbjct: 61 KKG------IETVLADLRARGEK 77


>gi|50119107|ref|YP_048274.1| 50S ribosomal protein L28 [Pectobacterium atrosepticum SCRI1043]
 gi|67461395|sp|Q6DAV6|RL28_ERWCT RecName: Full=50S ribosomal protein L28
 gi|49609633|emb|CAG73066.1| 50S ribosomal protein L28 [Pectobacterium atrosepticum SCRI1043]
          Length = 78

 Score = 88.9 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 28/83 (33%), Positives = 44/83 (53%), Gaps = 6/83 (7%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  ++GN  SHA N T+RRFLPNL       +  ++   LR+S   +R ++
Sbjct: 1  MSRVCQVTGKRPVAGNNRSHALNATKRRFLPNLHSHRFWVEGEKRFVTLRVSAKGMRVID 60

Query: 61 RQGGLDRFLSNSKKENLSARMRT 83
          ++G        +   +L  R   
Sbjct: 61 KKG------IETVLADLRTRGEK 77


>gi|310798120|gb|EFQ33013.1| ribosomal L28 family protein [Glomerella graminicola M1.001]
          Length = 256

 Score = 88.9 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 22/90 (24%), Positives = 44/90 (48%), Gaps = 4/90 (4%)

Query: 11  TVMSGNKVSHANNK-TRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFL 69
            +  G+ VS  + + T R + PN+ R  L S+ +    + R++   LR+V R+GG+D ++
Sbjct: 77  RIRHGHNVSEKHGQVTPRTWRPNVHRKRLWSEALGAWVRARLTTRVLRTVRREGGIDAYV 136

Query: 70  SNSKK---ENLSARMRTLRSQILKKMSEKS 96
           + +K      L      LR  +    + ++
Sbjct: 137 TKAKPARVRELGPGGWRLRWLVANSPAFRA 166


>gi|16762581|ref|NP_458198.1| 50S ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Typhi str. CT18]
 gi|16767013|ref|NP_462628.1| 50S ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Typhimurium str. LT2]
 gi|29144070|ref|NP_807412.1| 50S ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Typhi str. Ty2]
 gi|56415618|ref|YP_152693.1| 50S ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Paratyphi A str. ATCC 9150]
 gi|62182221|ref|YP_218638.1| 50S ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Choleraesuis str. SC-B67]
 gi|167549024|ref|ZP_02342783.1| ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Saintpaul str. SARA29]
 gi|167994349|ref|ZP_02575441.1| ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar 4,[5],12:i:- str. CVM23701]
 gi|168235333|ref|ZP_02660391.1| ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Schwarzengrund str. SL480]
 gi|168241907|ref|ZP_02666839.1| ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Heidelberg str. SL486]
 gi|168260518|ref|ZP_02682491.1| ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Hadar str. RI_05P066]
 gi|168464964|ref|ZP_02698856.1| ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Newport str. SL317]
 gi|168818442|ref|ZP_02830442.1| ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Weltevreden str. HI_N05-537]
 gi|194443533|ref|YP_002042978.1| 50S ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Newport str. SL254]
 gi|194451754|ref|YP_002047760.1| 50S ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Heidelberg str. SL476]
 gi|194471286|ref|ZP_03077270.1| ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Kentucky str. CVM29188]
 gi|194736234|ref|YP_002116663.1| 50S ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Schwarzengrund str. CVM19633]
 gi|197250195|ref|YP_002148660.1| 50S ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Agona str. SL483]
 gi|197264661|ref|ZP_03164735.1| ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Saintpaul str. SARA23]
 gi|197364545|ref|YP_002144182.1| 50S ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Paratyphi A str. AKU_12601]
 gi|198242068|ref|YP_002217689.1| 50S ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Dublin str. CT_02021853]
 gi|200387542|ref|ZP_03214154.1| ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Virchow str. SL491]
 gi|204928593|ref|ZP_03219792.1| ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Javiana str. GA_MM04042433]
 gi|205354670|ref|YP_002228471.1| 50S ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Gallinarum str. 287/91]
 gi|207858965|ref|YP_002245616.1| 50S ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Enteritidis str. P125109]
 gi|213029141|ref|ZP_03343588.1| 50S ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Typhi str. 404ty]
 gi|213161282|ref|ZP_03346992.1| 50S ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Typhi str. E00-7866]
 gi|213418640|ref|ZP_03351706.1| 50S ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Typhi str. E01-6750]
 gi|213425230|ref|ZP_03357980.1| 50S ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Typhi str. E02-1180]
 gi|213581868|ref|ZP_03363694.1| 50S ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Typhi str. E98-0664]
 gi|213615653|ref|ZP_03371479.1| 50S ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Typhi str. E98-2068]
 gi|213647925|ref|ZP_03377978.1| 50S ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Typhi str. J185]
 gi|213855128|ref|ZP_03383368.1| 50S ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Typhi str. M223]
 gi|224585528|ref|YP_002639327.1| 50S ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Paratyphi C strain RKS4594]
 gi|238910237|ref|ZP_04654074.1| 50S ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Tennessee str. CDC07-0191]
 gi|289810524|ref|ZP_06541153.1| 50S ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Typhi str. AG3]
 gi|289824122|ref|ZP_06543719.1| 50S ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Typhi str. E98-3139]
 gi|61230438|sp|P0A2A5|RL28_SALTY RecName: Full=50S ribosomal protein L28
 gi|61230442|sp|P0A2A6|RL28_SALTI RecName: Full=50S ribosomal protein L28
 gi|67461312|sp|Q5PC31|RL28_SALPA RecName: Full=50S ribosomal protein L28
 gi|75479872|sp|Q57IA5|RL28_SALCH RecName: Full=50S ribosomal protein L28
 gi|226699156|sp|B5EXE2|RL28_SALA4 RecName: Full=50S ribosomal protein L28
 gi|226699157|sp|B5FM61|RL28_SALDC RecName: Full=50S ribosomal protein L28
 gi|226699158|sp|B5R5G1|RL28_SALEP RecName: Full=50S ribosomal protein L28
 gi|226699159|sp|B5RGF0|RL28_SALG2 RecName: Full=50S ribosomal protein L28
 gi|226699160|sp|B4T9C2|RL28_SALHS RecName: Full=50S ribosomal protein L28
 gi|226699161|sp|B4SXD9|RL28_SALNS RecName: Full=50S ribosomal protein L28
 gi|226699162|sp|B5BI11|RL28_SALPK RecName: Full=50S ribosomal protein L28
 gi|226699163|sp|B4TZX9|RL28_SALSV RecName: Full=50S ribosomal protein L28
 gi|254801374|sp|C0Q1X0|RL28_SALPC RecName: Full=50S ribosomal protein L28
 gi|25295489|pir||AE0971 50S ribosomal chain protein L28 [imported] - Salmonella enterica
          subsp. enterica serovar Typhi (strain CT18)
 gi|2842791|gb|AAC01771.1| L28 [Salmonella enterica subsp. enterica serovar Typhimurium]
 gi|16422296|gb|AAL22587.1| 50S ribosomal subunit protein L28 [Salmonella enterica subsp.
          enterica serovar Typhimurium str. LT2]
 gi|16504886|emb|CAD03265.1| 50S ribosomal subunit protein L28 [Salmonella enterica subsp.
          enterica serovar Typhi]
 gi|29139707|gb|AAO71272.1| 50S ribosomal subunit protein L28 [Salmonella enterica subsp.
          enterica serovar Typhi str. Ty2]
 gi|56129875|gb|AAV79381.1| 50S ribosomal subunit protein L28 [Salmonella enterica subsp.
          enterica serovar Paratyphi A str. ATCC 9150]
 gi|62129854|gb|AAX67557.1| 50S ribosomal subunit protein L28 [Salmonella enterica subsp.
          enterica serovar Choleraesuis str. SC-B67]
 gi|194402196|gb|ACF62418.1| ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Newport str. SL254]
 gi|194410058|gb|ACF70277.1| ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Heidelberg str. SL476]
 gi|194457650|gb|EDX46489.1| ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Kentucky str. CVM29188]
 gi|194711736|gb|ACF90957.1| ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Schwarzengrund str. CVM19633]
 gi|195632365|gb|EDX50849.1| ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Newport str. SL317]
 gi|197096022|emb|CAR61609.1| 50S ribosomal subunit protein L28 [Salmonella enterica subsp.
          enterica serovar Paratyphi A str. AKU_12601]
 gi|197213898|gb|ACH51295.1| ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Agona str. SL483]
 gi|197242916|gb|EDY25536.1| ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Saintpaul str. SARA23]
 gi|197291293|gb|EDY30645.1| ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Schwarzengrund str. SL480]
 gi|197936584|gb|ACH73917.1| ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Dublin str. CT_02021853]
 gi|199604640|gb|EDZ03185.1| ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Virchow str. SL491]
 gi|204322026|gb|EDZ07224.1| ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Javiana str. GA_MM04042433]
 gi|205274451|emb|CAR39483.1| 50S ribosomal subunit protein L28 [Salmonella enterica subsp.
          enterica serovar Gallinarum str. 287/91]
 gi|205325763|gb|EDZ13602.1| ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Saintpaul str. SARA29]
 gi|205327770|gb|EDZ14534.1| ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar 4,[5],12:i:- str. CVM23701]
 gi|205338807|gb|EDZ25571.1| ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Heidelberg str. SL486]
 gi|205344302|gb|EDZ31066.1| ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Weltevreden str. HI_N05-537]
 gi|205350254|gb|EDZ36885.1| ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Hadar str. RI_05P066]
 gi|206710768|emb|CAR35129.1| 50S ribosomal subunit protein L28 [Salmonella enterica subsp.
          enterica serovar Enteritidis str. P125109]
 gi|224470056|gb|ACN47886.1| 50S ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Paratyphi C strain RKS4594]
 gi|261248876|emb|CBG26730.1| 50S ribosomal subunit protein L28 [Salmonella enterica subsp.
          enterica serovar Typhimurium str. D23580]
 gi|267995989|gb|ACY90874.1| 50S ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Typhimurium str. 14028S]
 gi|301160265|emb|CBW19788.1| 50S ribosomal subunit protein L28 [Salmonella enterica subsp.
          enterica serovar Typhimurium str. SL1344]
 gi|312914754|dbj|BAJ38728.1| 50S ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Typhimurium str. T000240]
 gi|320088148|emb|CBY97910.1| 50S ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Weltevreden str. 2007-60-3289-1]
 gi|322612894|gb|EFY09846.1| 50S ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Montevideo str. 315996572]
 gi|322618959|gb|EFY15846.1| 50S ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Montevideo str. 495297-1]
 gi|322625264|gb|EFY22091.1| 50S ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Montevideo str. 495297-3]
 gi|322630069|gb|EFY26842.1| 50S ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Montevideo str. 495297-4]
 gi|322634260|gb|EFY30995.1| 50S ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Montevideo str. 515920-1]
 gi|322635839|gb|EFY32548.1| 50S ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Montevideo str. 515920-2]
 gi|322643023|gb|EFY39600.1| 50S ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Montevideo str. 531954]
 gi|322645049|gb|EFY41580.1| 50S ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Montevideo str. NC_MB110209-0054]
 gi|322649851|gb|EFY46274.1| 50S ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Montevideo str. OH_2009072675]
 gi|322653058|gb|EFY49393.1| 50S ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Montevideo str. CASC_09SCPH15965]
 gi|322661123|gb|EFY57351.1| 50S ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Montevideo str. 19N]
 gi|322662388|gb|EFY58601.1| 50S ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Montevideo str. 81038-01]
 gi|322667266|gb|EFY63432.1| 50S ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Montevideo str. MD_MDA09249507]
 gi|322674357|gb|EFY70450.1| 50S ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Montevideo str. 414877]
 gi|322678435|gb|EFY74496.1| 50S ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Montevideo str. 366867]
 gi|322687123|gb|EFY83096.1| 50S ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Montevideo str. 446600]
 gi|322716709|gb|EFZ08280.1| 50S ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Choleraesuis str. A50]
 gi|323132088|gb|ADX19518.1| 50S ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Typhimurium str. 4/74]
 gi|323195847|gb|EFZ81019.1| 50S ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Montevideo str. 609458-1]
 gi|323198236|gb|EFZ83342.1| 50S ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Montevideo str. 556150-1]
 gi|323200854|gb|EFZ85924.1| 50S ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Montevideo str. 609460]
 gi|323206608|gb|EFZ91566.1| 50S ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Montevideo str. 507440-20]
 gi|323216233|gb|EGA00961.1| 50S ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Montevideo str. MB101509-0077]
 gi|323220456|gb|EGA04910.1| 50S ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Montevideo str. MB102109-0047]
 gi|323225319|gb|EGA09553.1| 50S ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Montevideo str. MB110209-0055]
 gi|323228433|gb|EGA12564.1| 50S ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Montevideo str. MB111609-0052]
 gi|323234254|gb|EGA18342.1| 50S ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Montevideo str. 2009083312]
 gi|323237239|gb|EGA21306.1| 50S ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Montevideo str. 2009085258]
 gi|323244758|gb|EGA28762.1| 50S ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Montevideo str. 315731156]
 gi|323245867|gb|EGA29857.1| 50S ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Montevideo str. IA_2009159199]
 gi|323250950|gb|EGA34826.1| 50S ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Montevideo str. IA_2010008282]
 gi|323262226|gb|EGA45787.1| 50S ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Montevideo str. IA_2010008284]
 gi|323264563|gb|EGA48067.1| 50S ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Montevideo str. IA_2010008285]
 gi|323268853|gb|EGA52311.1| 50S ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Montevideo str. IA_2010008287]
 gi|326625473|gb|EGE31818.1| 50S ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Dublin str. 3246]
 gi|326629809|gb|EGE36152.1| 50S ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Gallinarum str. 9]
 gi|332990577|gb|AEF09560.1| 50S ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Typhimurium str. UK-1]
          Length = 78

 Score = 88.9 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 29/83 (34%), Positives = 44/83 (53%), Gaps = 6/83 (7%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  ++GN  SHA N T+RRFLPNL       +  ++   LR+S   +R ++
Sbjct: 1  MSRVCQVTGKRPVTGNNRSHALNATKRRFLPNLHSHRFWVESEKRFVTLRVSAKGMRIID 60

Query: 61 RQGGLDRFLSNSKKENLSARMRT 83
          ++G        +    L AR   
Sbjct: 61 KKG------IETVLSELRARGEK 77


>gi|70993812|ref|XP_751753.1| 50S ribosomal protein L24 [Aspergillus fumigatus Af293]
 gi|66849387|gb|EAL89715.1| 50S ribosomal protein L24 [Aspergillus fumigatus Af293]
 gi|159125327|gb|EDP50444.1| 50S ribosomal protein L24 [Aspergillus fumigatus A1163]
          Length = 212

 Score = 88.9 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 25/87 (28%), Positives = 48/87 (55%), Gaps = 5/87 (5%)

Query: 9   KKTVMSGNKVSHANN--KTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLD 66
              +  GNK+S   N  KTRR + PN+ R  L S+ + +   +++++ ALR++ + GGLD
Sbjct: 69  GAMIQFGNKISKGRNEGKTRRFWKPNVRRKKLWSEALGEYLFIKVTRKALRTIWKSGGLD 128

Query: 67  RFLSNSKK---ENLSARMRTLRSQILK 90
            +L + +    + L      LR ++++
Sbjct: 129 NYLLDDRPGRIKELGIFGWELRWKVMQ 155


>gi|188532228|ref|YP_001906025.1| 50S ribosomal protein L28 [Erwinia tasmaniensis Et1/99]
 gi|259906760|ref|YP_002647116.1| 50S ribosomal protein L28 [Erwinia pyrifoliae Ep1/96]
 gi|292486567|ref|YP_003529435.1| 50S ribosomal protein L28 [Erwinia amylovora CFBP1430]
 gi|292897805|ref|YP_003537174.1| 50S ribosomal protein L28 [Erwinia amylovora ATCC 49946]
 gi|226694787|sp|B2VF68|RL28_ERWT9 RecName: Full=50S ribosomal protein L28
 gi|188027270|emb|CAO95113.1| 50S ribosomal protein L28 [Erwinia tasmaniensis Et1/99]
 gi|224962382|emb|CAX53837.1| 50S ribosomal protein L28 [Erwinia pyrifoliae Ep1/96]
 gi|283476546|emb|CAY72374.1| 50S ribosomal protein L28 [Erwinia pyrifoliae DSM 12163]
 gi|291197653|emb|CBJ44748.1| 50S ribosomal protein L28 [Erwinia amylovora ATCC 49946]
 gi|291551982|emb|CBA19019.1| 50S ribosomal protein L28 [Erwinia amylovora CFBP1430]
 gi|312170628|emb|CBX78891.1| 50S ribosomal protein L28 [Erwinia amylovora ATCC BAA-2158]
          Length = 78

 Score = 88.9 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 28/83 (33%), Positives = 44/83 (53%), Gaps = 6/83 (7%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  ++GN  SHA N T+RRFLPNL       +  ++   LR+S   +R ++
Sbjct: 1  MSRVCQVTGKRPVTGNNRSHAMNATKRRFLPNLHSHRFWVESEKRFVTLRVSAKGMRVID 60

Query: 61 RQGGLDRFLSNSKKENLSARMRT 83
          ++G        +   +L  R   
Sbjct: 61 KKG------IETVLADLRTRGEK 77


>gi|255533402|ref|YP_003093774.1| 50S ribosomal protein L28 [Pedobacter heparinus DSM 2366]
 gi|255346386|gb|ACU05712.1| ribosomal protein L28 [Pedobacter heparinus DSM 2366]
          Length = 77

 Score = 88.6 bits (219), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 25/63 (39%), Positives = 39/63 (61%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC+LT K  M+G  VSH+N KT+R+F PNL          ++   L++S  A++++ 
Sbjct: 1  MSRVCDLTGKMAMAGFNVSHSNVKTKRKFYPNLQLQKFYIPEEDRWITLKVSTSAIKTIN 60

Query: 61 RQG 63
          + G
Sbjct: 61 KIG 63


>gi|156972976|ref|YP_001443883.1| ribosomal protein L28 [Vibrio harveyi ATCC BAA-1116]
 gi|262392594|ref|YP_003284448.1| 50S ribosomal protein L28p [Vibrio sp. Ex25]
 gi|269959365|ref|ZP_06173748.1| ribosomal protein L28 [Vibrio harveyi 1DA3]
 gi|269965913|ref|ZP_06180006.1| ribosomal protein L28 [Vibrio alginolyticus 40B]
 gi|166228172|sp|A7MSP8|RL28_VIBHB RecName: Full=50S ribosomal protein L28
 gi|156524570|gb|ABU69656.1| hypothetical protein VIBHAR_00654 [Vibrio harveyi ATCC BAA-1116]
 gi|262336188|gb|ACY49983.1| LSU ribosomal protein L28p [Vibrio sp. Ex25]
 gi|269829466|gb|EEZ83707.1| ribosomal protein L28 [Vibrio alginolyticus 40B]
 gi|269835802|gb|EEZ89878.1| ribosomal protein L28 [Vibrio harveyi 1DA3]
          Length = 78

 Score = 88.6 bits (219), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 28/75 (37%), Positives = 47/75 (62%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  ++GN  SHA N T+RRFLPNL       +  ++  +LR+S   +R ++
Sbjct: 1  MSRVCQVTGKRPVTGNNRSHARNATKRRFLPNLQTHRFWVESEKRFVKLRLSAKGMRIID 60

Query: 61 RQGGLDRFLSNSKKE 75
          ++G +D  L++ +  
Sbjct: 61 KKG-IDTVLADMRAR 74


>gi|207342192|gb|EDZ70031.1| YMR193Wp-like protein [Saccharomyces cerevisiae AWRI1631]
          Length = 175

 Score = 88.6 bits (219), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 24/89 (26%), Positives = 52/89 (58%), Gaps = 3/89 (3%)

Query: 9   KKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRF 68
              V  GN +S +  KTR+++LPN+ +  L S+ + +K  ++++   L+++ ++GG+D +
Sbjct: 76  GSFVQFGNNISESKAKTRKKWLPNVVKKGLWSETLNRKISIKMTAKVLKTISKEGGIDNY 135

Query: 69  LSN---SKKENLSARMRTLRSQILKKMSE 94
           L+    ++ + L      LR ++LK+  E
Sbjct: 136 LTKEKSARIKELGPTGWKLRYRVLKRKDE 164


>gi|127514408|ref|YP_001095605.1| ribosomal protein L28 [Shewanella loihica PV-4]
 gi|166226619|sp|A3QIP8|RL28_SHELP RecName: Full=50S ribosomal protein L28
 gi|126639703|gb|ABO25346.1| LSU ribosomal protein L28P [Shewanella loihica PV-4]
          Length = 78

 Score = 88.6 bits (219), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 29/63 (46%), Positives = 40/63 (63%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  M GN  SHA N TRRRFLPNL       +  ++  QLR+S   +R ++
Sbjct: 1  MSRVCQVTGKKPMVGNNRSHAKNATRRRFLPNLQNHRFWLEDEKRFVQLRVSTKGMRIID 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|300714650|ref|YP_003739453.1| 50S ribosomal protein L28 [Erwinia billingiae Eb661]
 gi|299060486|emb|CAX57593.1| 50S ribosomal protein L28 [Erwinia billingiae Eb661]
          Length = 78

 Score = 88.6 bits (219), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 28/83 (33%), Positives = 44/83 (53%), Gaps = 6/83 (7%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  +SGN  SHA N T+RRFLPNL       +  ++   LR++   +R ++
Sbjct: 1  MSRVCQVTGKRPVSGNNRSHAMNATKRRFLPNLHSHRFWVESEKRFVTLRVTAKGMRVID 60

Query: 61 RQGGLDRFLSNSKKENLSARMRT 83
          ++G        +   +L  R   
Sbjct: 61 KKG------IETVLADLRTRGEK 77


>gi|33151901|ref|NP_873254.1| 50S ribosomal protein L28 [Haemophilus ducreyi 35000HP]
 gi|67461505|sp|Q7VN52|RL28_HAEDU RecName: Full=50S ribosomal protein L28
 gi|33148122|gb|AAP95643.1| 50S ribosomal protein L28 [Haemophilus ducreyi 35000HP]
          Length = 78

 Score = 88.6 bits (219), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 28/75 (37%), Positives = 42/75 (56%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K    GN  SHA N TRRRFLPNL       +   +   LR++   +R ++
Sbjct: 1  MSRVCQVTSKRPAVGNNRSHALNATRRRFLPNLHTHRFWVESENRFVTLRLTAKGMRIID 60

Query: 61 RQGGLDRFLSNSKKE 75
          ++G +D  L+  +  
Sbjct: 61 KKG-IDAVLAEIRAR 74


>gi|119773469|ref|YP_926209.1| 50S ribosomal protein L28 [Shewanella amazonensis SB2B]
 gi|166226616|sp|A1S2D3|RL28_SHEAM RecName: Full=50S ribosomal protein L28
 gi|119765969|gb|ABL98539.1| LSU ribosomal protein L28P [Shewanella amazonensis SB2B]
          Length = 78

 Score = 88.6 bits (219), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 29/63 (46%), Positives = 40/63 (63%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  M GN  SHA N TRRRFLPNL       +  ++  QLR+S   +R ++
Sbjct: 1  MSRVCQVTGKRPMVGNNRSHAKNATRRRFLPNLQNHRFWLETEKRFVQLRVSTKGMRIID 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|37678470|ref|NP_933079.1| 50S ribosomal protein L28 [Vibrio vulnificus YJ016]
 gi|320157666|ref|YP_004190045.1| 50S ribosomal protein L28p [Vibrio vulnificus MO6-24/O]
 gi|326423774|ref|NP_759801.2| 50S ribosomal protein L28 [Vibrio vulnificus CMCP6]
 gi|61216002|sp|Q7MPS6|RL28_VIBVY RecName: Full=50S ribosomal protein L28
 gi|37197210|dbj|BAC93050.1| ribosomal protein L28 [Vibrio vulnificus YJ016]
 gi|319932978|gb|ADV87842.1| LSU ribosomal protein L28p [Vibrio vulnificus MO6-24/O]
 gi|319999136|gb|AAO09328.2| ribosomal protein L28 [Vibrio vulnificus CMCP6]
          Length = 78

 Score = 88.6 bits (219), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 27/75 (36%), Positives = 45/75 (60%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K    GN  SHA N T+RRFLPNL       +  ++  +LR++   +R ++
Sbjct: 1  MSRVCQVTGKRPAVGNNRSHARNATKRRFLPNLQTHRFWVESEKRFVKLRLTAKGMRIID 60

Query: 61 RQGGLDRFLSNSKKE 75
          ++G +D  L++ +  
Sbjct: 61 KKG-IDVVLADMRAR 74


>gi|115391337|ref|XP_001213173.1| conserved hypothetical protein [Aspergillus terreus NIH2624]
 gi|114194097|gb|EAU35797.1| conserved hypothetical protein [Aspergillus terreus NIH2624]
          Length = 212

 Score = 88.6 bits (219), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 25/87 (28%), Positives = 48/87 (55%), Gaps = 5/87 (5%)

Query: 9   KKTVMSGNKVSHANN--KTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLD 66
              +  GNK+S   N  KTRR + PN+ R  L S+ + +   +++++ ALR++ + GGLD
Sbjct: 69  GVMIQFGNKISKGRNEGKTRRMWKPNVRRKKLYSEALGEDLYIKVTRKALRTIRKAGGLD 128

Query: 67  RFLSNSKK---ENLSARMRTLRSQILK 90
            +L + +    + L      LR ++++
Sbjct: 129 NYLLDDRPGRIKELGIFGWELRWRVMQ 155


>gi|298373102|ref|ZP_06983092.1| ribosomal protein L28 [Bacteroidetes oral taxon 274 str. F0058]
 gi|298276006|gb|EFI17557.1| ribosomal protein L28 [Bacteroidetes oral taxon 274 str. F0058]
          Length = 86

 Score = 88.6 bits (219), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 31/75 (41%), Positives = 41/75 (54%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  M GN VSH+N KT+R F  NL          +    LRIS   LR++ 
Sbjct: 1  MSRVCQITGKRAMGGNNVSHSNRKTKRLFDVNLFNKKFYYVEEDCWISLRISAAGLRTIN 60

Query: 61 RQGGLDRFLSNSKKE 75
          + G LD  L N+  +
Sbjct: 61 KNG-LDAALKNAVAK 74


>gi|121707801|ref|XP_001271945.1| 50S ribosomal protein L24 [Aspergillus clavatus NRRL 1]
 gi|119400093|gb|EAW10519.1| 50S ribosomal protein L24 [Aspergillus clavatus NRRL 1]
          Length = 212

 Score = 88.6 bits (219), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 25/87 (28%), Positives = 48/87 (55%), Gaps = 5/87 (5%)

Query: 9   KKTVMSGNKVSHANN--KTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLD 66
              +  GNK+S   N  KTRR + PN+ R  L S+ + +   +++++ ALR++ + GGLD
Sbjct: 69  GAMIQFGNKISKGRNEGKTRRSWKPNVRRKKLWSEALGEFLFIKVTRKALRTIWKSGGLD 128

Query: 67  RFLSNSKK---ENLSARMRTLRSQILK 90
            +L + +    + L      LR ++++
Sbjct: 129 NYLLDDRPGRIKELGMFGWELRWKVMQ 155


>gi|312213496|emb|CBX93578.1| similar to 50S ribosomal protein L24 [Leptosphaeria maculans]
          Length = 490

 Score = 88.6 bits (219), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 25/85 (29%), Positives = 48/85 (56%), Gaps = 4/85 (4%)

Query: 11  TVMSGNKVSHAN-NKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFL 69
            +  GN VS     KTRR + PN+   +L S ++++K +LR++   L++++R+GGLD +L
Sbjct: 91  MIQFGNNVSKKTETKTRRVWRPNVLSKSLYSVVLKKKIKLRVTANVLKTIDREGGLDEYL 150

Query: 70  SNS---KKENLSARMRTLRSQILKK 91
                 + + L      LR  ++++
Sbjct: 151 LKDSEHRIKELGPMGWALRWTLMQR 175


>gi|149908602|ref|ZP_01897264.1| 50S ribosomal protein L28 [Moritella sp. PE36]
 gi|149910344|ref|ZP_01898987.1| 50S ribosomal protein L28 [Moritella sp. PE36]
 gi|149806592|gb|EDM66560.1| 50S ribosomal protein L28 [Moritella sp. PE36]
 gi|149808436|gb|EDM68373.1| 50S ribosomal protein L28 [Moritella sp. PE36]
          Length = 78

 Score = 88.6 bits (219), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 28/75 (37%), Positives = 45/75 (60%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS+VC++T K    GN VSHA N+TRRRFLPNL       +   +  +LR++   +R ++
Sbjct: 1  MSKVCQVTGKKPAVGNNVSHAKNRTRRRFLPNLHTHRFWVESENRFVKLRLTCKGMRIID 60

Query: 61 RQGGLDRFLSNSKKE 75
          ++G +D  L+  +  
Sbjct: 61 KKG-IDSVLAEMRAR 74


>gi|332884209|gb|EGK04477.1| 50S ribosomal protein L28 [Dysgonomonas mossii DSM 22836]
          Length = 79

 Score = 88.6 bits (219), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 27/72 (37%), Positives = 40/72 (55%), Gaps = 1/72 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS++C++T K  M GN VSH+N KT+R+F  NL R        +    L +S   LR++ 
Sbjct: 1  MSKICQITGKKAMVGNNVSHSNRKTKRKFNVNLFRKKFYWVEEDCWISLNVSAAGLRTIN 60

Query: 61 RQGGLDRFLSNS 72
          + G LD  L  +
Sbjct: 61 KIG-LDAALKRA 71


>gi|119500374|ref|XP_001266944.1| 50S ribosomal protein L24 [Neosartorya fischeri NRRL 181]
 gi|119415109|gb|EAW25047.1| 50S ribosomal protein L24 [Neosartorya fischeri NRRL 181]
          Length = 212

 Score = 88.6 bits (219), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 25/87 (28%), Positives = 48/87 (55%), Gaps = 5/87 (5%)

Query: 9   KKTVMSGNKVSHANN--KTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLD 66
              +  GNK+S   N  KTRR + PN+ R  L S+ + +   +++++ ALR++ + GGLD
Sbjct: 69  GAMIQFGNKISKGRNEGKTRRFWKPNVRRKKLWSEALGEYLYIKVTRKALRTIWKSGGLD 128

Query: 67  RFLSNSKK---ENLSARMRTLRSQILK 90
            +L + +    + L      LR ++++
Sbjct: 129 NYLLDDRPGRIKELGIFGWELRWKVMQ 155


>gi|237728934|ref|ZP_04559415.1| 50S ribosomal protein L28 [Citrobacter sp. 30_2]
 gi|283787729|ref|YP_003367594.1| 50S ribosomal subunit protein L28 [Citrobacter rodentium ICC168]
 gi|226909556|gb|EEH95474.1| 50S ribosomal protein L28 [Citrobacter sp. 30_2]
 gi|282951183|emb|CBG90876.1| 50S ribosomal subunit protein L28 [Citrobacter rodentium ICC168]
          Length = 78

 Score = 88.2 bits (218), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 29/83 (34%), Positives = 44/83 (53%), Gaps = 6/83 (7%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  ++GN  SHA N T+RRFLPNL       +  ++   LR+S   +R ++
Sbjct: 1  MSRVCQVTGKRPVTGNNRSHALNATKRRFLPNLHSHRFWVESEKRFVTLRVSAKGMRVID 60

Query: 61 RQGGLDRFLSNSKKENLSARMRT 83
          ++G        +    L AR   
Sbjct: 61 KKG------IETVLSELRARGEK 77


>gi|258653985|ref|YP_003203141.1| 50S ribosomal protein L28 [Nakamurella multipartita DSM 44233]
 gi|258557210|gb|ACV80152.1| ribosomal protein L28 [Nakamurella multipartita DSM 44233]
          Length = 78

 Score = 88.2 bits (218), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 22/76 (28%), Positives = 39/76 (51%), Gaps = 1/76 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS  C++T      G  VSH++ +T RR+ PNL         + +  +LR+S   LR ++
Sbjct: 1  MSARCQVTGAEPGFGKSVSHSHQRTNRRWEPNLQHRRFYVPSLRRTVRLRVSTKGLRIID 60

Query: 61 RQGGLDRFLSNSKKEN 76
          R+G +D  ++     +
Sbjct: 61 RRG-IDAVVAQILARD 75


>gi|197286971|ref|YP_002152843.1| 50S ribosomal protein L28 [Proteus mirabilis HI4320]
 gi|227354790|ref|ZP_03839207.1| 50S ribosomal protein L28 [Proteus mirabilis ATCC 29906]
 gi|226699148|sp|B4F0W9|RL28_PROMH RecName: Full=50S ribosomal protein L28
 gi|194684458|emb|CAR46203.1| 50S ribosomal protein L28 [Proteus mirabilis HI4320]
 gi|227165108|gb|EEI49939.1| 50S ribosomal protein L28 [Proteus mirabilis ATCC 29906]
 gi|301072221|gb|ADK56075.1| RpmB [Proteus mirabilis]
 gi|301072244|gb|ADK56097.1| RpmB [Proteus mirabilis]
 gi|312598045|gb|ADQ89979.1| ribosomal protein [Proteus mirabilis]
 gi|312598062|gb|ADQ89995.1| ribosomal protein [Proteus mirabilis]
          Length = 78

 Score = 88.2 bits (218), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 28/75 (37%), Positives = 46/75 (61%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  +SGN  SHA N T+RRFLPNL       +  ++   LR+S   +R ++
Sbjct: 1  MSRVCQVTGKRPVSGNNRSHALNATKRRFLPNLHSHRFWVESEKRFVTLRVSAKGMRVID 60

Query: 61 RQGGLDRFLSNSKKE 75
          ++G ++  L++ +  
Sbjct: 61 KKG-IESVLADLRAR 74


>gi|323358133|ref|YP_004224529.1| ribosomal protein L28 [Microbacterium testaceum StLB037]
 gi|323274504|dbj|BAJ74649.1| ribosomal protein L28 [Microbacterium testaceum StLB037]
          Length = 78

 Score = 88.2 bits (218), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 20/84 (23%), Positives = 43/84 (51%), Gaps = 6/84 (7%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+ VC++T      G+ +SH++ +T+RRF PN+ + T     + +  +L +S   ++ ++
Sbjct: 1  MAAVCQVTGAVPGFGHNISHSHRRTKRRFDPNVQKKTYFVPSLGRNIKLNVSAKGIKVID 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTL 84
           +G        +   +L A+   L
Sbjct: 61 ARG------IEAVVRDLQAKGVKL 78


>gi|194099564|ref|YP_002002694.1| 50S ribosomal protein L28 [Neisseria gonorrhoeae NCCP11945]
 gi|313667723|ref|YP_004048007.1| 50S ribosomal protein L28 [Neisseria lactamica ST-640]
 gi|193934854|gb|ACF30678.1| 50S ribosomal protein L28 [Neisseria gonorrhoeae NCCP11945]
 gi|313005185|emb|CBN86618.1| 50S ribosomal protein L28 [Neisseria lactamica 020-06]
 gi|316984322|gb|EFV63296.1| ribosomal protein L28 [Neisseria meningitidis H44/76]
 gi|317165059|gb|ADV08600.1| 50S ribosomal protein L28 [Neisseria gonorrhoeae TCDC-NG08107]
          Length = 71

 Score = 88.2 bits (218), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 30/68 (44%), Positives = 43/68 (63%), Gaps = 1/68 (1%)

Query: 8  TKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDR 67
          T K  MSGN VSHANNKT+RRFLPNL       +   +  +LR+S  ALR++++ G +D 
Sbjct: 2  TGKRPMSGNNVSHANNKTKRRFLPNLQSRRFWVESENRWVRLRVSNAALRTIDKVG-IDV 60

Query: 68 FLSNSKKE 75
           L++ +  
Sbjct: 61 VLADLRAR 68


>gi|299136010|ref|ZP_07029194.1| ribosomal protein L28 [Acidobacterium sp. MP5ACTX8]
 gi|298602134|gb|EFI58288.1| ribosomal protein L28 [Acidobacterium sp. MP5ACTX8]
          Length = 75

 Score = 88.2 bits (218), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 26/72 (36%), Positives = 45/72 (62%), Gaps = 1/72 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M++VC +T K  ++GN VSHANNKTRRR+ PNL    +      +  ++R+S   +R+++
Sbjct: 1  MAKVCPITGKRTVTGNNVSHANNKTRRRWEPNLQLKRIWIPSENRFVRMRVSARGIRTIQ 60

Query: 61 RQGGLDRFLSNS 72
          + G ++  L  +
Sbjct: 61 KLG-IEAALLKA 71


>gi|31340362|sp|Q8DDY1|RL28_VIBVU RecName: Full=50S ribosomal protein L28
          Length = 78

 Score = 88.2 bits (218), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 28/75 (37%), Positives = 46/75 (61%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K    GN  SHA N T+RRFLPNL  I    +  ++  +LR++   +R ++
Sbjct: 1  MSRVCQVTGKRPAVGNNRSHARNATKRRFLPNLQTIRFWVESEKRFVKLRLTAKGMRIID 60

Query: 61 RQGGLDRFLSNSKKE 75
          ++G +D  L++ +  
Sbjct: 61 KKG-IDVVLADMRAR 74


>gi|67461422|sp|Q6LVN3|RL28_PHOPR RecName: Full=50S ribosomal protein L28
          Length = 78

 Score = 88.2 bits (218), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 27/75 (36%), Positives = 46/75 (61%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  ++GN  SHA N T+RRFLPNL       +  ++  +LR++   +R ++
Sbjct: 1  MSRVCQVTGKRPVTGNNRSHARNATKRRFLPNLQTHRFWVESEKRFVKLRLTAKGMRIID 60

Query: 61 RQGGLDRFLSNSKKE 75
          ++G +D  L+  +  
Sbjct: 61 KKG-IDIVLAEMRVR 74


>gi|92115087|ref|YP_575015.1| 50S ribosomal protein L28P [Chromohalobacter salexigens DSM 3043]
 gi|122419199|sp|Q1QT92|RL28_CHRSD RecName: Full=50S ribosomal protein L28
 gi|91798177|gb|ABE60316.1| LSU ribosomal protein L28P [Chromohalobacter salexigens DSM 3043]
          Length = 78

 Score = 88.2 bits (218), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 28/75 (37%), Positives = 49/75 (65%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS+VC++T K  ++GN VSH+  KTRRRF+PNL       +  ++  +LR+S   +R ++
Sbjct: 1  MSQVCQVTGKRPVTGNNVSHSQRKTRRRFVPNLHTHRFWVEGEKRFVKLRVSSKGMRIID 60

Query: 61 RQGGLDRFLSNSKKE 75
          ++G ++  LS+ +K 
Sbjct: 61 KKG-IEEVLSDIRKR 74


>gi|108762247|ref|YP_634649.1| 50S ribosomal protein L28 [Myxococcus xanthus DK 1622]
 gi|108466127|gb|ABF91312.1| ribosomal protein L28 [Myxococcus xanthus DK 1622]
          Length = 78

 Score = 88.2 bits (218), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 26/63 (41%), Positives = 39/63 (61%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS+VC++T K  + GN VSHANN+ +RR LPNL         M +  +LR+S   +R + 
Sbjct: 1  MSKVCQVTGKRPLVGNTVSHANNRHKRRSLPNLQWHRFWVPSMNRFVKLRVSTHGIRIIN 60

Query: 61 RQG 63
          ++G
Sbjct: 61 QRG 63


>gi|242769719|ref|XP_002341828.1| 50S ribosomal protein L24 [Talaromyces stipitatus ATCC 10500]
 gi|218725024|gb|EED24441.1| 50S ribosomal protein L24 [Talaromyces stipitatus ATCC 10500]
          Length = 247

 Score = 88.2 bits (218), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 29/92 (31%), Positives = 51/92 (55%), Gaps = 5/92 (5%)

Query: 9   KKTVMSGNKVSHANNK--TRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLD 66
             T+  GNK+S   NK  TRR + PN+    L S+ + ++  +++++ ALR++ + GGLD
Sbjct: 73  GVTISFGNKISKGRNKGKTRRSWKPNVRWKKLPSEALGEEVFVKLTRKALRTIRKCGGLD 132

Query: 67  RFLS---NSKKENLSARMRTLRSQILKKMSEK 95
            +L     S+ + L      LR +I++  S K
Sbjct: 133 NYLLCDKPSRLKELGLTGWKLRYRIMQSPSMK 164


>gi|213963580|ref|ZP_03391832.1| ribosomal protein L28 [Capnocytophaga sputigena Capno]
 gi|213953708|gb|EEB65038.1| ribosomal protein L28 [Capnocytophaga sputigena Capno]
          Length = 78

 Score = 88.2 bits (218), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 24/63 (38%), Positives = 39/63 (61%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVC+LT K  + GN VSHA NKT+R+F  NL           +   L++S  A+++++
Sbjct: 1  MARVCDLTGKKALVGNNVSHAMNKTKRKFNVNLRTKRFFIPEENRWITLKVSAAAIKTID 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|260562923|ref|ZP_05833409.1| ribosomal protein L28 [Brucella melitensis bv. 1 str. 16M]
 gi|260152939|gb|EEW88031.1| ribosomal protein L28 [Brucella melitensis bv. 1 str. 16M]
          Length = 59

 Score = 88.2 bits (218), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 42/59 (71%), Positives = 48/59 (81%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSV 59
          MSR CELT K+V  GN VSHANN+TRRRFLPNLC +TLIS+ + Q Y+LRIS  ALRSV
Sbjct: 1  MSRACELTGKSVQYGNNVSHANNRTRRRFLPNLCNVTLISETLGQSYRLRISANALRSV 59


>gi|332139462|ref|YP_004425200.1| ribosomal protein L28 [Alteromonas macleodii str. 'Deep ecotype']
 gi|226738024|sp|B4S2C3|RL28_ALTMD RecName: Full=50S ribosomal protein L28
 gi|327549484|gb|AEA96202.1| ribosomal protein L28 [Alteromonas macleodii str. 'Deep ecotype']
          Length = 78

 Score = 88.2 bits (218), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 29/75 (38%), Positives = 44/75 (58%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K    GN  SHA N TRRRFLPNL       +   +  +LR+S   +R ++
Sbjct: 1  MSRVCQVTGKRPTVGNNRSHARNATRRRFLPNLQTHRFWVESESRFVKLRLSAKGMRIID 60

Query: 61 RQGGLDRFLSNSKKE 75
          ++G +D  L++ +  
Sbjct: 61 KKG-IDSVLTDIRAR 74


>gi|302527617|ref|ZP_07279959.1| ribosomal protein L28 [Streptomyces sp. AA4]
 gi|302436512|gb|EFL08328.1| ribosomal protein L28 [Streptomyces sp. AA4]
          Length = 78

 Score = 87.8 bits (217), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 19/71 (26%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS VC++T +    G +VSH++ +T RR+ PNL         + +  +L++S   +++++
Sbjct: 1  MSAVCQVTGRKPGYGKQVSHSHRRTSRRWEPNLQTRRYYVPSLGRTVRLKVSAKGMKTID 60

Query: 61 RQGGLDRFLSN 71
          ++G +D  +++
Sbjct: 61 KRG-IDAVVAD 70


>gi|167626711|ref|YP_001677211.1| 50S ribosomal protein L28 [Francisella philomiragia subsp.
          philomiragia ATCC 25017]
 gi|241667286|ref|ZP_04754864.1| 50S ribosomal protein L28 [Francisella philomiragia subsp.
          philomiragia ATCC 25015]
 gi|254875837|ref|ZP_05248547.1| 50S ribosomal protein L28 [Francisella philomiragia subsp.
          philomiragia ATCC 25015]
 gi|189029441|sp|B0U0F9|RL28_FRAP2 RecName: Full=50S ribosomal protein L28
 gi|167596712|gb|ABZ86710.1| 50S ribosomal protein L28 [Francisella philomiragia subsp.
          philomiragia ATCC 25017]
 gi|254841858|gb|EET20272.1| 50S ribosomal protein L28 [Francisella philomiragia subsp.
          philomiragia ATCC 25015]
          Length = 78

 Score = 87.8 bits (217), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 30/75 (40%), Positives = 47/75 (62%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS+VC +T K   +GN VSHA NKTRRRFLPNL       +   +  +L++S   +R ++
Sbjct: 1  MSKVCIVTGKRPATGNNVSHAQNKTRRRFLPNLHTHRFWVESENKYIKLKVSSKGMRIID 60

Query: 61 RQGGLDRFLSNSKKE 75
          ++G +D  LS+ + +
Sbjct: 61 KKG-IDTVLSDLRAQ 74


>gi|294142829|ref|YP_003558807.1| 50S ribosomal protein L28 [Shewanella violacea DSS12]
 gi|293329298|dbj|BAJ04029.1| ribosomal protein L28 [Shewanella violacea DSS12]
          Length = 78

 Score = 87.8 bits (217), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 29/63 (46%), Positives = 40/63 (63%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  M GN  SHA N TRRRFLPNL       +  ++  +LRIS   +R ++
Sbjct: 1  MSRVCQVTGKRPMVGNNRSHAKNATRRRFLPNLQNHRFWLEGEKRFVKLRISTKGIRIID 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|317038264|ref|XP_001401958.2| 50S ribosomal protein L24 [Aspergillus niger CBS 513.88]
          Length = 212

 Score = 87.8 bits (217), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 25/87 (28%), Positives = 47/87 (54%), Gaps = 5/87 (5%)

Query: 9   KKTVMSGNKVSHANN--KTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLD 66
              +  GNK+S   N  KTRR + PN+ R  L S+ + +   +++++ ALR++ + GGLD
Sbjct: 69  GAMIQFGNKISQGRNEGKTRRFWKPNVRRKKLYSEALGEDLFIKVTRKALRTIRKAGGLD 128

Query: 67  RFLSNSKK---ENLSARMRTLRSQILK 90
            +L + +      +      LR +I++
Sbjct: 129 NYLLSDRPGRIREMGIFGWELRWKIMQ 155


>gi|327483098|gb|AEA77505.1| LSU ribosomal protein L28p [Vibrio cholerae LMA3894-4]
          Length = 78

 Score = 87.8 bits (217), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 26/75 (34%), Positives = 42/75 (56%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K    GN  SHA N T+ RFLPNL       +  ++  +LR++   +R ++
Sbjct: 1  MSRVCQVTGKRPAVGNNRSHAKNATKYRFLPNLQTHRFWVESEKRFVKLRLTAKGMRIID 60

Query: 61 RQGGLDRFLSNSKKE 75
          ++G +D  L   +  
Sbjct: 61 KKG-IDAVLVEIRAR 74


>gi|297170291|gb|ADI21327.1| hypothetical protein [uncultured gamma proteobacterium
          HF0010_10D20]
          Length = 78

 Score = 87.8 bits (217), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 26/75 (34%), Positives = 45/75 (60%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS++C++T K  M+GN VS A N+T+RRFLPNL +     +   +   L +S   +R ++
Sbjct: 1  MSKICQVTGKKPMAGNNVSKALNRTKRRFLPNLNQHKFWVESENKYVSLTVSAKGMRIID 60

Query: 61 RQGGLDRFLSNSKKE 75
          ++G +D  L + +  
Sbjct: 61 KKG-IDEVLKDIRSR 74


>gi|90580920|ref|ZP_01236722.1| putative ribosomal protein L28 [Vibrio angustum S14]
 gi|330447139|ref|ZP_08310789.1| ribosomal protein L28 [Photobacterium leiognathi subsp.
          mandapamensis svers.1.1.]
 gi|90437991|gb|EAS63180.1| putative ribosomal protein L28 [Vibrio angustum S14]
 gi|328491330|dbj|GAA05286.1| ribosomal protein L28 [Photobacterium leiognathi subsp.
          mandapamensis svers.1.1.]
          Length = 78

 Score = 87.8 bits (217), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 28/75 (37%), Positives = 45/75 (60%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  ++GN  SHA N T+RRFLPNL       +  ++  +LR+S   +R ++
Sbjct: 1  MSRVCQVTGKRPVTGNNRSHARNATKRRFLPNLQTHRFWVESEKRFVKLRLSAKGMRIID 60

Query: 61 RQGGLDRFLSNSKKE 75
          ++G +D  L   +  
Sbjct: 61 KKG-IDVVLGEMRAR 74


>gi|255037319|ref|YP_003087940.1| 50S ribosomal protein L28 [Dyadobacter fermentans DSM 18053]
 gi|254950075|gb|ACT94775.1| ribosomal protein L28 [Dyadobacter fermentans DSM 18053]
          Length = 79

 Score = 87.8 bits (217), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 24/75 (32%), Positives = 44/75 (58%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M++VC+++ K    GN VSHANNKT+R+F PNL +         +   L+++  ALR++ 
Sbjct: 1  MAKVCQISGKRTRVGNNVSHANNKTKRKFFPNLQKKRFFLPSSGEWVTLKVAASALRTIN 60

Query: 61 RQGGLDRFLSNSKKE 75
          + G ++  +  +  +
Sbjct: 61 KNG-IEATIQKAYDK 74


>gi|54307424|ref|YP_128444.1| putative ribosomal protein L28 [Photobacterium profundum SS9]
 gi|46911844|emb|CAG18642.1| putative ribosomal protein L28 [Photobacterium profundum SS9]
          Length = 83

 Score = 87.8 bits (217), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 27/75 (36%), Positives = 46/75 (61%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  ++GN  SHA N T+RRFLPNL       +  ++  +LR++   +R ++
Sbjct: 6  MSRVCQVTGKRPVTGNNRSHARNATKRRFLPNLQTHRFWVESEKRFVKLRLTAKGMRIID 65

Query: 61 RQGGLDRFLSNSKKE 75
          ++G +D  L+  +  
Sbjct: 66 KKG-IDIVLAEMRVR 79


>gi|328868000|gb|EGG16381.1| hypothetical protein DFA_09412 [Dictyostelium fasciculatum]
          Length = 146

 Score = 87.4 bits (216), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 20/95 (21%), Positives = 52/95 (54%)

Query: 2   SRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVER 61
           S+      K +  GN +S ++ KTRR + PN+   T  S +++ + ++ ++   +R +++
Sbjct: 28  SQRGLYGGKLIQYGNIISFSHKKTRRNWKPNVQAKTYFSHLLDAEVKVNVTTYTIRCIDK 87

Query: 62  QGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKS 96
            G  D ++  +K +++++ + T    +LK + ++ 
Sbjct: 88  AGTFDNYILKTKNKDMASELGTDLKSVLKNVLKQQ 122


>gi|152964257|ref|YP_001360041.1| ribosomal protein L28 [Kineococcus radiotolerans SRS30216]
 gi|151358774|gb|ABS01777.1| ribosomal protein L28 [Kineococcus radiotolerans SRS30216]
          Length = 78

 Score = 87.4 bits (216), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 19/63 (30%), Positives = 33/63 (52%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS  C++T      G  VSH++ +T RRF PN+ R       + +   L +S   +++V+
Sbjct: 1  MSARCQVTGAVPGFGKSVSHSHRRTNRRFDPNVQRKRWFVPSLGRTVTLTVSARGIKTVD 60

Query: 61 RQG 63
           +G
Sbjct: 61 ERG 63


>gi|124002613|ref|ZP_01687465.1| ribosomal protein L28 [Microscilla marina ATCC 23134]
 gi|123991841|gb|EAY31228.1| ribosomal protein L28 [Microscilla marina ATCC 23134]
          Length = 83

 Score = 87.4 bits (216), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 28/63 (44%), Positives = 42/63 (66%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+R+CE+T K   SGN VSHANNKTRR+F PNL +     +   +   L++S  A+R++ 
Sbjct: 1  MARICEVTGKRTQSGNNVSHANNKTRRKFYPNLQKKRFFLESKGEWITLKVSTQAIRTIN 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|71279933|ref|YP_266976.1| 50S ribosomal protein L28 [Colwellia psychrerythraea 34H]
 gi|123634189|sp|Q48AD7|RL28_COLP3 RecName: Full=50S ribosomal protein L28
 gi|71145673|gb|AAZ26146.1| ribosomal protein L28 [Colwellia psychrerythraea 34H]
          Length = 78

 Score = 87.4 bits (216), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 27/75 (36%), Positives = 45/75 (60%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS++C++T K  M GN  SHA N TRRRFLPNL       +   +  +LR++   +R ++
Sbjct: 1  MSKICQVTGKVPMVGNNRSHARNATRRRFLPNLQSHRFWVESENRFVKLRLTPKGMRIID 60

Query: 61 RQGGLDRFLSNSKKE 75
          ++G +D  L++ +  
Sbjct: 61 KKG-IDVVLTDIRAR 74


>gi|254784437|ref|YP_003071865.1| 50S ribosomal protein L28 [Teredinibacter turnerae T7901]
 gi|259646751|sp|C5BLG3|RL28_TERTT RecName: Full=50S ribosomal protein L28
 gi|237684904|gb|ACR12168.1| ribosomal protein L28 [Teredinibacter turnerae T7901]
          Length = 78

 Score = 87.4 bits (216), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 24/63 (38%), Positives = 41/63 (65%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M++VC++T K  ++G+ VSHA N T+RRFLPNL       +  ++  +LR+S   +R ++
Sbjct: 1  MAKVCQVTGKRPVTGHNVSHAKNHTKRRFLPNLHTHRFWVESEKRFVKLRVSSKGMRIID 60

Query: 61 RQG 63
          + G
Sbjct: 61 KNG 63


>gi|209693806|ref|YP_002261734.1| 50S ribosomal protein L28 [Aliivibrio salmonicida LFI1238]
 gi|226738023|sp|B6EPP2|RL28_ALISL RecName: Full=50S ribosomal protein L28
 gi|208007757|emb|CAQ77876.1| 50S ribosomal protein L28 [Aliivibrio salmonicida LFI1238]
          Length = 78

 Score = 87.4 bits (216), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 28/75 (37%), Positives = 44/75 (58%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K    GN  SHA N T+RRFLPNL       +  ++  +LR++   +R ++
Sbjct: 1  MSRVCQVTGKRPAVGNNRSHAKNATKRRFLPNLQTHRFWVESEKRFVKLRLTAKGMRIID 60

Query: 61 RQGGLDRFLSNSKKE 75
          ++G +D  LS  +  
Sbjct: 61 KKG-IDVVLSEMRAR 74


>gi|114564977|ref|YP_752491.1| ribosomal protein L28 [Shewanella frigidimarina NCIMB 400]
 gi|122298393|sp|Q07WG2|RL28_SHEFN RecName: Full=50S ribosomal protein L28
 gi|114336270|gb|ABI73652.1| LSU ribosomal protein L28P [Shewanella frigidimarina NCIMB 400]
          Length = 78

 Score = 87.4 bits (216), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 32/84 (38%), Positives = 45/84 (53%), Gaps = 6/84 (7%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  M GN  SHA N TRRRFLPNL       +  ++  QLR+S   +R ++
Sbjct: 1  MSRVCQVTGKKPMVGNNRSHAKNSTRRRFLPNLQNHRFWLEEEKRFVQLRVSTKGIRIID 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTL 84
          ++G           + L AR   +
Sbjct: 61 KKG------IEVIVKELRARGEKV 78


>gi|237806958|ref|YP_002891398.1| 50S ribosomal protein L28 [Tolumonas auensis DSM 9187]
 gi|259646752|sp|C4L813|RL28_TOLAT RecName: Full=50S ribosomal protein L28
 gi|237499219|gb|ACQ91812.1| ribosomal protein L28 [Tolumonas auensis DSM 9187]
          Length = 78

 Score = 87.4 bits (216), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 27/75 (36%), Positives = 43/75 (57%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K    GN  SHA N TRRRFLPNL       +  ++   LR++   +R ++
Sbjct: 1  MSRVCQVTGKRPTVGNNRSHAKNATRRRFLPNLQSHRFWVEGEKRFVTLRLTPKGMRIID 60

Query: 61 RQGGLDRFLSNSKKE 75
          + G ++  L++ +  
Sbjct: 61 KLG-IEAVLADIRAR 74


>gi|254482757|ref|ZP_05095995.1| ribosomal protein L28 [marine gamma proteobacterium HTCC2148]
 gi|214037116|gb|EEB77785.1| ribosomal protein L28 [marine gamma proteobacterium HTCC2148]
          Length = 78

 Score = 87.4 bits (216), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 29/84 (34%), Positives = 49/84 (58%), Gaps = 6/84 (7%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVC++T K  ++GN VSHA N+TRRRFLPNL +     +  ++   LR+S   +R ++
Sbjct: 1  MARVCQVTGKRPVTGNNVSHAKNRTRRRFLPNLHKHRFWVESEKRFVSLRVSSKGMRIID 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTL 84
          ++G        +  E + +R   +
Sbjct: 61 KKG------IETVLEEMRSRGEKV 78


>gi|170728879|ref|YP_001762905.1| 50S ribosomal protein L28 [Shewanella woodyi ATCC 51908]
 gi|226699165|sp|B1KL04|RL28_SHEWM RecName: Full=50S ribosomal protein L28
 gi|169814226|gb|ACA88810.1| ribosomal protein L28 [Shewanella woodyi ATCC 51908]
          Length = 78

 Score = 87.0 bits (215), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 29/63 (46%), Positives = 40/63 (63%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  M GN  SHA N TRRRFLPNL       +  ++  +LRIS   +R ++
Sbjct: 1  MSRVCQVTGKKPMVGNNRSHAKNATRRRFLPNLQNHRFWLEGEKRFVKLRISTKGMRIID 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|118138114|pdb|2I2T|X Chain X, Crystal Structure Of Ribosome With Messenger Rna And The
          Anticodon Stem-Loop Of P-Site Trna. This File Contains
          The 50s Subunit Of One 70s Ribosome. The Entire Crystal
          Structure Contains Two 70s Ribosomes And Is Described
          In Remark 400.
 gi|118138168|pdb|2I2V|X Chain X, Crystal Structure Of Ribosome With Messenger Rna And The
          Anticodon Stem-Loop Of P-Site Trna. This File Contains
          The 50s Subunit Of One 70s Ribosome. The Entire Crystal
          Structure Contains Two 70s Ribosomes And Is Described
          In Remark 400.
 gi|224510753|pdb|3FIK|X Chain X, Ternary Complex-Bound E.Coli 70s Ribosome. This Entry
          Consists Of The 50s Subunit.
 gi|294662241|pdb|2WWQ|0 Chain 0, E.Coli 70s Ribosome Stalled During Translation Of Tnac
          Leader Peptide. This File Contains The 50s, The P-Site
          Trna And The Tnac Leader Peptide (Part 2 Of 2).
 gi|308388030|pdb|3OFQ|X Chain X, Crystal Structure Of The E. Coli Ribosome Bound To
          Erythromycin. This File Contains The 50s Subunit Of The
          Second 70s Ribosome.
 gi|308388061|pdb|3OFR|X Chain X, Crystal Structure Of The E. Coli Ribosome Bound To
          Erythromycin. This File Contains The 50s Subunit Of The
          First 70s Ribosome With Erthromycin Bound.
 gi|309320088|pdb|3OFC|X Chain X, Crystal Structure Of The E. Coli Ribosome Bound To
          Chloramphenicol. This File Contains The 50s Subunit Of
          The First 70s Ribosome With Chloramphenicol Bound.
 gi|309320119|pdb|3OFD|X Chain X, Crystal Structure Of The E. Coli Ribosome Bound To
          Chloramphenicol. This File Contains The 50s Subunit Of
          The Second 70s Ribosome.
 gi|309320192|pdb|3OFZ|X Chain X, Crystal Structure Of The E. Coli Ribosome Bound To
          Clindamycin. This File Contains The 50s Subunit Of The
          First 70s Ribosome Bound To Clindamycin.
 gi|309320223|pdb|3OG0|X Chain X, Crystal Structure Of The E. Coli Ribosome Bound To
          Clindamycin. This File Contains The 50s Subunit Of The
          Second 70s Ribosome.
 gi|315113677|pdb|3OAS|X Chain X, Crystal Structure Of The E. Coli Ribosome Bound To
          Telithromycin. This File Contains The 50s Subunit Of
          The Second 70s Ribosome.
 gi|315113708|pdb|3OAT|X Chain X, Crystal Structure Of The E. Coli Ribosome Bound To
          Telithromycin. This File Contains The 50s Subunit Of
          The First 70s Ribosome With Telithromycin Bound.
 gi|329666039|pdb|3J01|X Chain X, Structure Of The Ribosome-Secye Complex In The Membrane
          Environment
          Length = 77

 Score = 87.0 bits (215), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 27/74 (36%), Positives = 44/74 (59%), Gaps = 1/74 (1%)

Query: 2  SRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVER 61
          SRVC++T K  ++GN  SHA N T+RRFLPNL       +  ++   LR+S   +R +++
Sbjct: 1  SRVCQVTGKRPVTGNNRSHALNATKRRFLPNLHSHRFWVESEKRFVTLRVSAKGMRVIDK 60

Query: 62 QGGLDRFLSNSKKE 75
          +G +D  L+  +  
Sbjct: 61 KG-IDTVLAELRAR 73


>gi|167622370|ref|YP_001672664.1| 50S ribosomal protein L28 [Shewanella halifaxensis HAW-EB4]
 gi|189029454|sp|B0TQL2|RL28_SHEHH RecName: Full=50S ribosomal protein L28
 gi|167352392|gb|ABZ75005.1| ribosomal protein L28 [Shewanella halifaxensis HAW-EB4]
          Length = 78

 Score = 87.0 bits (215), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 30/63 (47%), Positives = 40/63 (63%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  M GN  SHA N TRRRFLPNL       +  ++  QLRIS   +R ++
Sbjct: 1  MSRVCQVTGKRPMVGNNRSHAKNATRRRFLPNLQNHRFWLENEKRFVQLRISTKGMRIID 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|224009912|ref|XP_002293914.1| RM24, ribosomal protein 24 mitochondrial large ribosomal subunit
          [Thalassiosira pseudonana CCMP1335]
 gi|220970586|gb|EED88923.1| RM24, ribosomal protein 24 mitochondrial large ribosomal subunit
          [Thalassiosira pseudonana CCMP1335]
          Length = 70

 Score = 87.0 bits (215), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 24/62 (38%), Positives = 36/62 (58%)

Query: 9  KKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRF 68
           K V  GN V  +  KTRRR+ PN+    + S+I+ +     I+  ALRS+++ GGLD +
Sbjct: 9  GKDVRFGNNVPFSLKKTRRRWNPNVQLKRVYSEILGEMIPFHITTSALRSIDKMGGLDNY 68

Query: 69 LS 70
          L 
Sbjct: 69 LL 70


>gi|332827125|gb|EGJ99910.1| 50S ribosomal protein L28 [Dysgonomonas gadei ATCC BAA-286]
          Length = 79

 Score = 87.0 bits (215), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 25/72 (34%), Positives = 40/72 (55%), Gaps = 1/72 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS++C++T K  M GN VSH+N KT+R+F  NL +        +    L +S   LR++ 
Sbjct: 1  MSKICQITGKKAMVGNNVSHSNRKTKRKFNVNLFKKKFYWVEEDCWVSLNVSAAGLRTIN 60

Query: 61 RQGGLDRFLSNS 72
          + G LD  +  +
Sbjct: 61 KIG-LDAAIKRA 71


>gi|297798834|ref|XP_002867301.1| ribosomal protein L28 family protein [Arabidopsis lyrata subsp.
           lyrata]
 gi|297313137|gb|EFH43560.1| ribosomal protein L28 family protein [Arabidopsis lyrata subsp.
           lyrata]
          Length = 212

 Score = 87.0 bits (215), Expect = 9e-16,   Method: Composition-based stats.
 Identities = 21/95 (22%), Positives = 48/95 (50%), Gaps = 1/95 (1%)

Query: 2   SRVCELTKKTVMSGNKVSH-ANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
           ++      + +  GN+VS    NK+RR + PN+    L S I ++  +++++  ALR ++
Sbjct: 43  AKRGLYAGRHIQYGNRVSEDGGNKSRRCWKPNVQEKRLFSYIFDRHIKVKVTTHALRCID 102

Query: 61  RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEK 95
           + GG+D +L  +  + +   M       +++   +
Sbjct: 103 KAGGIDEYLLKTPYQKMDTEMGLYWKTKVEQRYAE 137


>gi|306822127|ref|ZP_07455509.1| 50S ribosomal protein L28 [Bifidobacterium dentium ATCC 27679]
 gi|304554509|gb|EFM42414.1| 50S ribosomal protein L28 [Bifidobacterium dentium ATCC 27679]
          Length = 110

 Score = 86.6 bits (214), Expect = 9e-16,   Method: Composition-based stats.
 Identities = 21/63 (33%), Positives = 35/63 (55%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS+ C++       GN VSH++ KTRR F PNL R       + +   L ++   +++++
Sbjct: 30 MSKHCQVLGTRAHVGNAVSHSHRKTRRTFSPNLQRKRYYVPSLGRTVTLTLTPKGMKTID 89

Query: 61 RQG 63
          RQG
Sbjct: 90 RQG 92


>gi|221135335|ref|ZP_03561638.1| ribosomal protein L28 [Glaciecola sp. HTCC2999]
          Length = 78

 Score = 86.6 bits (214), Expect = 9e-16,   Method: Composition-based stats.
 Identities = 26/75 (34%), Positives = 43/75 (57%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M++VC++T K    GN  SHA N TRRRFLPNL       +   +  +LR++   +R ++
Sbjct: 1  MAKVCQVTGKRPAVGNNRSHARNATRRRFLPNLQTHRFWVESENRFVKLRLTPKGMRIID 60

Query: 61 RQGGLDRFLSNSKKE 75
          ++G +D  L+  +  
Sbjct: 61 KKG-IDSVLTEMRAR 74


>gi|212635016|ref|YP_002311541.1| 50S ribosomal protein L28 [Shewanella piezotolerans WP3]
 gi|226699164|sp|B8CM30|RL28_SHEPW RecName: Full=50S ribosomal protein L28
 gi|212556500|gb|ACJ28954.1| Ribosomal protein L28 [Shewanella piezotolerans WP3]
          Length = 78

 Score = 86.6 bits (214), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 29/63 (46%), Positives = 40/63 (63%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  M GN  SHA N TRRRFLPNL       +  ++  +LRIS   +R ++
Sbjct: 1  MSRVCQVTGKKPMVGNNRSHAKNATRRRFLPNLQNHRFWLETEKRFVKLRISTKGMRIID 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|332880090|ref|ZP_08447774.1| ribosomal protein L28 [Capnocytophaga sp. oral taxon 329 str.
          F0087]
 gi|332682086|gb|EGJ54999.1| ribosomal protein L28 [Capnocytophaga sp. oral taxon 329 str.
          F0087]
          Length = 78

 Score = 86.6 bits (214), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 24/63 (38%), Positives = 39/63 (61%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVC+LT K  + GN VSHA NKT+R+F  NL           +   L++S  A+++++
Sbjct: 1  MARVCDLTGKKALVGNNVSHAMNKTKRKFNVNLRTKRFFIPEENRWITLKVSAAAIKTID 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|77361557|ref|YP_341132.1| 50S ribosomal subunit protein L28 [Pseudoalteromonas haloplanktis
          TAC125]
 gi|76876468|emb|CAI87690.1| 50S ribosomal subunit protein L28 [Pseudoalteromonas haloplanktis
          TAC125]
          Length = 95

 Score = 86.6 bits (214), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 25/75 (33%), Positives = 42/75 (56%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M++VC++T K    GN  SHA N T+RRFLPNL       +  ++   LR +   +R ++
Sbjct: 18 MAKVCQVTGKRPAVGNHRSHARNATKRRFLPNLQTHRFWVESEKRFVTLRTTTKGMRIID 77

Query: 61 RQGGLDRFLSNSKKE 75
          ++G +D  L+  +  
Sbjct: 78 KKG-IDTVLTEIRAR 91


>gi|119470591|ref|ZP_01613294.1| 50S ribosomal subunit protein L28 [Alteromonadales bacterium
          TW-7]
 gi|119446292|gb|EAW27569.1| 50S ribosomal subunit protein L28 [Alteromonadales bacterium
          TW-7]
          Length = 78

 Score = 86.2 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 27/75 (36%), Positives = 42/75 (56%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS+VC++T K    GN  SHA N TRRRFLPNL       +  ++   LR +   +R ++
Sbjct: 1  MSKVCQVTGKRPAVGNHRSHARNATRRRFLPNLQTHRFWVESEKRFVTLRTTTKGMRIID 60

Query: 61 RQGGLDRFLSNSKKE 75
          ++G +D  L+  +  
Sbjct: 61 KKG-IDAVLTEIRAR 74


>gi|118471258|ref|YP_890290.1| ribosomal protein L28 [Mycobacterium smegmatis str. MC2 155]
 gi|118172545|gb|ABK73441.1| ribosomal protein L28 [Mycobacterium smegmatis str. MC2 155]
          Length = 78

 Score = 86.2 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 20/75 (26%), Positives = 41/75 (54%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS  C++T +    GN VSH++ +T RR+ PN+   T       ++ +LR+S   ++ ++
Sbjct: 1  MSAHCQVTGRGPGFGNSVSHSHRRTPRRWDPNIQNKTYYLPSEGRRIRLRVSAKGIKVID 60

Query: 61 RQGGLDRFLSNSKKE 75
          R G ++  ++  +  
Sbjct: 61 RDG-IEAVVARMRAR 74


>gi|224283446|ref|ZP_03646768.1| ribosomal protein L28 [Bifidobacterium bifidum NCIMB 41171]
          Length = 115

 Score = 86.2 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 21/63 (33%), Positives = 36/63 (57%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS+ C++      +GN+VSH++ KTRRRF PNL         + +   L +S   +++++
Sbjct: 18 MSKQCQILGTRASTGNRVSHSHRKTRRRFNPNLQTKRYWVPSLGRHVTLTVSVKGMKTID 77

Query: 61 RQG 63
          R G
Sbjct: 78 RIG 80


>gi|309802267|ref|ZP_07696375.1| ribosomal protein L28 [Bifidobacterium dentium JCVIHMP022]
 gi|308221150|gb|EFO77454.1| ribosomal protein L28 [Bifidobacterium dentium JCVIHMP022]
          Length = 152

 Score = 86.2 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 21/63 (33%), Positives = 35/63 (55%)

Query: 1   MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
           MS+ C++       GN VSH++ KTRR F PNL R       + +   L ++   +++++
Sbjct: 72  MSKHCQVLGTRAHVGNAVSHSHRKTRRTFSPNLQRKRYYVPSLGRTVTLTLTPKGMKTID 131

Query: 61  RQG 63
           RQG
Sbjct: 132 RQG 134


>gi|15235960|ref|NP_194874.1| ribosomal protein L28 family protein [Arabidopsis thaliana]
 gi|15724234|gb|AAL06510.1|AF412057_1 AT4g31460/F3L17_30 [Arabidopsis thaliana]
 gi|5262757|emb|CAB45905.1| putative protein [Arabidopsis thaliana]
 gi|7270049|emb|CAB79864.1| putative protein [Arabidopsis thaliana]
 gi|21593391|gb|AAM65340.1| unknown [Arabidopsis thaliana]
 gi|30102482|gb|AAP21159.1| At4g31460/F3L17_30 [Arabidopsis thaliana]
 gi|332660516|gb|AEE85916.1| Ribosomal L28 family [Arabidopsis thaliana]
          Length = 212

 Score = 86.2 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 21/95 (22%), Positives = 46/95 (48%), Gaps = 1/95 (1%)

Query: 2   SRVCELTKKTVMSGNKVSH-ANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
           ++      + +  GN+VS    NK+RR + PN+    L S I +   +++++  ALR ++
Sbjct: 43  AKRGLYAGRHIQYGNRVSEDGGNKSRRCWKPNVQEKRLFSYIFDSHIKVKVTTHALRCID 102

Query: 61  RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEK 95
           + GG+D +L  +  + +   M       ++    +
Sbjct: 103 KAGGIDEYLLKTPYQKMDTEMGLYWKTKVEARYAE 137


>gi|157373527|ref|YP_001472127.1| ribosomal protein L28 [Shewanella sediminis HAW-EB3]
 gi|189029456|sp|A8FQ76|RL28_SHESH RecName: Full=50S ribosomal protein L28
 gi|157315901|gb|ABV34999.1| ribosomal protein L28 [Shewanella sediminis HAW-EB3]
          Length = 78

 Score = 86.2 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 29/63 (46%), Positives = 40/63 (63%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  M GN  SHA N TRRRFLPNL       +  ++  +LRIS   +R ++
Sbjct: 1  MSRVCQVTGKKPMVGNNRSHAKNSTRRRFLPNLQNHRFWLEGEKRFVKLRISTKGMRIID 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|255947924|ref|XP_002564729.1| Pc22g07040 [Penicillium chrysogenum Wisconsin 54-1255]
 gi|211591746|emb|CAP97992.1| Pc22g07040 [Penicillium chrysogenum Wisconsin 54-1255]
          Length = 216

 Score = 86.2 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 27/92 (29%), Positives = 50/92 (54%), Gaps = 5/92 (5%)

Query: 9   KKTVMSGNKVSHANN--KTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLD 66
             ++  GNK+S   N  KTRR + PN+ R  + S  + +   +++++ ALRS+ +  GLD
Sbjct: 69  GASIRFGNKISKGRNEGKTRRSWKPNVRRKKIESKALGESVYIKVTRRALRSIYKAKGLD 128

Query: 67  RFLSN---SKKENLSARMRTLRSQILKKMSEK 95
            +L +   ++ + L      LR QI++  + K
Sbjct: 129 NYLLSDRPTRLKELGPFGWNLRHQIMQTPAIK 160


>gi|157963647|ref|YP_001503681.1| 50S ribosomal protein L28 [Shewanella pealeana ATCC 700345]
 gi|189029455|sp|A8H9A9|RL28_SHEPA RecName: Full=50S ribosomal protein L28
 gi|157848647|gb|ABV89146.1| ribosomal protein L28 [Shewanella pealeana ATCC 700345]
          Length = 78

 Score = 86.2 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 30/63 (47%), Positives = 40/63 (63%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  M GN  SHA N TRRRFLPNL       +  ++  QLRIS   +R ++
Sbjct: 1  MSRVCQVTGKRPMVGNNRSHAKNSTRRRFLPNLQNHRFWLENEKRFVQLRISTKGMRIID 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|310287798|ref|YP_003939056.1| ribosomal protein L28 [Bifidobacterium bifidum S17]
 gi|309251734|gb|ADO53482.1| ribosomal protein L28 [Bifidobacterium bifidum S17]
          Length = 115

 Score = 86.2 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 21/63 (33%), Positives = 36/63 (57%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS+ C++      +GN+VSH++ KTRRRF PNL         + +   L +S   +++++
Sbjct: 18 MSKQCQILGTRASTGNRVSHSHRKTRRRFNPNLQTKRYWVPSLGRHVTLTVSVKGMKTID 77

Query: 61 RQG 63
          R G
Sbjct: 78 RIG 80


>gi|295394905|ref|ZP_06805118.1| 50S ribosomal protein L28 [Brevibacterium mcbrellneri ATCC 49030]
 gi|294972238|gb|EFG48100.1| 50S ribosomal protein L28 [Brevibacterium mcbrellneri ATCC 49030]
          Length = 78

 Score = 86.2 bits (213), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 23/84 (27%), Positives = 43/84 (51%), Gaps = 6/84 (7%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+ VC++T  T   G+ VSH+N +T+RRF PN+ +       + +   L +S   ++ ++
Sbjct: 1  MAAVCQVTGTTPGFGHNVSHSNRRTKRRFDPNIQKKKYYVPSLRRNVTLTVSARGIKVID 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTL 84
          R+G       ++    L A+   L
Sbjct: 61 RRG------IDTVVAELLAKGVKL 78


>gi|297171145|gb|ADI22155.1| hypothetical protein [uncultured gamma proteobacterium
          HF0200_24F15]
          Length = 78

 Score = 85.9 bits (212), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 30/75 (40%), Positives = 45/75 (60%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  ++GN VSHANN+ +R F PNL       +   +  +LRIS   LR ++
Sbjct: 1  MSRVCQITGKRSVAGNNVSHANNRNKRLFKPNLHVRKFWVESENRWVRLRISNKGLRIID 60

Query: 61 RQGGLDRFLSNSKKE 75
          + G +D  L + +K 
Sbjct: 61 KNG-IDAVLKDIRKR 74


>gi|313203650|ref|YP_004042307.1| LSU ribosomal protein l28p [Paludibacter propionicigenes WB4]
 gi|312442966|gb|ADQ79322.1| LSU ribosomal protein L28P [Paludibacter propionicigenes WB4]
          Length = 79

 Score = 85.9 bits (212), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 23/75 (30%), Positives = 39/75 (52%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS++C++T K  M GN VSH+  +T+R F  NL          +    L +S   LR++ 
Sbjct: 1  MSKICQITGKKAMVGNNVSHSKRRTKRTFDVNLFTKKFYWVEQDTWVSLNVSANGLRTIN 60

Query: 61 RQGGLDRFLSNSKKE 75
          + G LD  +  + ++
Sbjct: 61 KIG-LDAAIKKASEK 74


>gi|315109324|gb|EFT81300.1| ribosomal protein L28 [Propionibacterium acnes HL030PA2]
          Length = 92

 Score = 85.9 bits (212), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 19/63 (30%), Positives = 35/63 (55%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR C++       GN VSH+   T+RR+ PN+ +       + +K  L ++  A++ ++
Sbjct: 15 MSRRCQVRGTKPEFGNNVSHSQRHTKRRWNPNIQKKRYWVPSLGRKVTLTLTPKAIKEID 74

Query: 61 RQG 63
          R+G
Sbjct: 75 RRG 77


>gi|315127737|ref|YP_004069740.1| 50S ribosomal subunit protein L28 [Pseudoalteromonas sp. SM9913]
 gi|315016251|gb|ADT69589.1| 50S ribosomal subunit protein L28 [Pseudoalteromonas sp. SM9913]
          Length = 95

 Score = 85.9 bits (212), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 26/75 (34%), Positives = 42/75 (56%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS+VC++T K    GN  SHA N T+RRFLPNL       +  ++   LR +   +R ++
Sbjct: 18 MSKVCQVTGKRPAVGNHRSHARNATKRRFLPNLQTHRFWVESEKRFVTLRTTTKGMRIID 77

Query: 61 RQGGLDRFLSNSKKE 75
          ++G +D  L+  +  
Sbjct: 78 KKG-IDTVLTEIRAR 91


>gi|59710734|ref|YP_203510.1| 50S ribosomal protein L28 [Vibrio fischeri ES114]
 gi|197333949|ref|YP_002154895.1| ribosomal protein L28 [Vibrio fischeri MJ11]
 gi|67461221|sp|Q5E8M4|RL28_VIBF1 RecName: Full=50S ribosomal protein L28
 gi|226699183|sp|B5FFF7|RL28_VIBFM RecName: Full=50S ribosomal protein L28
 gi|59478835|gb|AAW84622.1| 50S ribosomal subunit protein L28 [Vibrio fischeri ES114]
 gi|197315439|gb|ACH64886.1| ribosomal protein L28 [Vibrio fischeri MJ11]
          Length = 78

 Score = 85.9 bits (212), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 26/75 (34%), Positives = 45/75 (60%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K    GN  SHA N T+RRFLPNL       +  ++  +LR++   +R ++
Sbjct: 1  MSRVCQVTGKRPAVGNNRSHAKNATKRRFLPNLQTHRFWVESEKRFVKLRLTAKGMRIID 60

Query: 61 RQGGLDRFLSNSKKE 75
          ++G ++  L++ +  
Sbjct: 61 KKG-IETVLADMRAR 74


>gi|297180599|gb|ADI16810.1| hypothetical protein [uncultured gamma proteobacterium
          HF0010_11K06]
          Length = 78

 Score = 85.9 bits (212), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 27/75 (36%), Positives = 44/75 (58%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS+ C++T KT M+GN VS A NKT+R+F+PNL R     +   +   L +S   +R ++
Sbjct: 1  MSKECQVTGKTPMAGNNVSKAVNKTKRKFMPNLHRHKFWVESENKYVTLTLSAKGMRIID 60

Query: 61 RQGGLDRFLSNSKKE 75
          ++G +D  L   +  
Sbjct: 61 KKG-IDVVLKEIRDR 74


>gi|307107886|gb|EFN56127.1| hypothetical protein CHLNCDRAFT_144754 [Chlorella variabilis]
          Length = 146

 Score = 85.9 bits (212), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 26/79 (32%), Positives = 45/79 (56%), Gaps = 1/79 (1%)

Query: 2  SRVCELTKKTVMSGNKVSH-ANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          +R      + V+SGN++S    NKTRR + PN     L S I+ +   LR++  ALR ++
Sbjct: 16 ARRGLYAGRRVLSGNQISEDGGNKTRRTWKPNSHNKRLYSHILARMVPLRVTAAALRDID 75

Query: 61 RQGGLDRFLSNSKKENLSA 79
          + GG+D ++ N+  + L +
Sbjct: 76 KVGGIDAYILNTPDKQLQS 94


>gi|239918397|ref|YP_002957955.1| LSU ribosomal protein L28P [Micrococcus luteus NCTC 2665]
 gi|281415407|ref|ZP_06247149.1| 50S ribosomal protein L28 [Micrococcus luteus NCTC 2665]
 gi|289707032|ref|ZP_06503363.1| ribosomal protein L28 [Micrococcus luteus SK58]
 gi|259646745|sp|C5C6R3|RL28_MICLC RecName: Full=50S ribosomal protein L28
 gi|239839604|gb|ACS31401.1| LSU ribosomal protein L28P [Micrococcus luteus NCTC 2665]
 gi|289556218|gb|EFD49578.1| ribosomal protein L28 [Micrococcus luteus SK58]
          Length = 78

 Score = 85.5 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 20/84 (23%), Positives = 45/84 (53%), Gaps = 6/84 (7%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+  C++T      G+ +SH++ +T+RRF PN+ + T     + +   L +S   +++++
Sbjct: 1  MAAHCQVTGAGPGFGHSISHSHRRTKRRFDPNIQKKTYWVPSLRRNVTLTLSAKGIKTID 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTL 84
           +G +D  ++     +L A+   L
Sbjct: 61 VRG-IDAVVA-----DLIAKGVKL 78


>gi|148245024|ref|YP_001219718.1| 50S ribosomal protein L28 [Candidatus Vesicomyosocius okutanii
          HA]
 gi|166228171|sp|A5CVN4|RL28_VESOH RecName: Full=50S ribosomal protein L28
 gi|146326851|dbj|BAF61994.1| 50S ribosomal protein L28 [Candidatus Vesicomyosocius okutanii
          HA]
          Length = 82

 Score = 85.5 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 27/63 (42%), Positives = 41/63 (65%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M++VC +T K  +SGN VSHANNKTRRRF PNL +     +   +  +L++S    R ++
Sbjct: 1  MAKVCMVTGKRPISGNNVSHANNKTRRRFYPNLHKHRFWVESENRFVKLKLSAKGFRIID 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|262197734|ref|YP_003268943.1| ribosomal protein L28 [Haliangium ochraceum DSM 14365]
 gi|262081081|gb|ACY17050.1| ribosomal protein L28 [Haliangium ochraceum DSM 14365]
          Length = 78

 Score = 85.5 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 27/84 (32%), Positives = 47/84 (55%), Gaps = 6/84 (7%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  + GNKVSH+N+KT+RRF  NL       +   +  +LR+S   ++ ++
Sbjct: 1  MSRVCQVTGKKALVGNKVSHSNHKTKRRFEVNLHDKRFWLEEENRWVKLRVSARGMKIID 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTL 84
          ++G        +  + + AR   +
Sbjct: 61 KRG------LATVVKEMRARGEKI 78


>gi|256820965|ref|YP_003142244.1| 50S ribosomal protein L28 [Capnocytophaga ochracea DSM 7271]
 gi|315224164|ref|ZP_07866004.1| 50S ribosomal protein L28 [Capnocytophaga ochracea F0287]
 gi|256582548|gb|ACU93683.1| ribosomal protein L28 [Capnocytophaga ochracea DSM 7271]
 gi|314945897|gb|EFS97906.1| 50S ribosomal protein L28 [Capnocytophaga ochracea F0287]
          Length = 78

 Score = 85.5 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 24/63 (38%), Positives = 39/63 (61%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVC+LT K  + GN VSHA NKT+R+F  NL           +   L++S  A+++++
Sbjct: 1  MARVCDLTGKKALVGNNVSHAMNKTKRKFNVNLRTKRFFIPEENRWITLKVSATAIKTID 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|319442734|ref|ZP_07991890.1| 50S ribosomal protein L28 [Corynebacterium variabile DSM 44702]
          Length = 78

 Score = 85.5 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 19/75 (25%), Positives = 39/75 (52%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS  C++T +    G  VSH++ +T RR+ PN+ R +       +   L +S   L++++
Sbjct: 1  MSAYCQVTGRKPGFGKSVSHSHRRTNRRWNPNIQRRSFYVPSEGRTITLNVSTKGLKTID 60

Query: 61 RQGGLDRFLSNSKKE 75
          R G ++  ++  +  
Sbjct: 61 RDG-IESVVAKIRAR 74


>gi|9971882|gb|AAG10444.1|AF279106_6 predicted 50S ribosomal protein L28 [uncultured marine gamma
          proteobacterium EBAC31A08]
          Length = 78

 Score = 85.5 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 24/75 (32%), Positives = 43/75 (57%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS++C++T K   SGN VSHA N+T+R+F PNL       +   +   L++S   +R ++
Sbjct: 1  MSKICQVTGKIPQSGNNVSHAKNRTKRKFFPNLHTHKFWVESENRFVNLKVSAKGMRIID 60

Query: 61 RQGGLDRFLSNSKKE 75
          ++G +   L   + +
Sbjct: 61 KKG-ISEVLKELRAK 74


>gi|302755644|ref|XP_002961246.1| hypothetical protein SELMODRAFT_71657 [Selaginella
          moellendorffii]
 gi|302772124|ref|XP_002969480.1| hypothetical protein SELMODRAFT_68550 [Selaginella
          moellendorffii]
 gi|300162956|gb|EFJ29568.1| hypothetical protein SELMODRAFT_68550 [Selaginella
          moellendorffii]
 gi|300172185|gb|EFJ38785.1| hypothetical protein SELMODRAFT_71657 [Selaginella
          moellendorffii]
          Length = 113

 Score = 85.5 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 26/92 (28%), Positives = 46/92 (50%), Gaps = 1/92 (1%)

Query: 2  SRVCELTKKTVMSGNKVS-HANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          ++      + +  GNKVS    NKTRR + PN+    L S  +++  ++ ++  ALR ++
Sbjct: 7  AKRGIFAGRHIQFGNKVSEKGGNKTRRTWKPNVRLKRLYSFSLDRFIRVHVTTHALRCID 66

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKM 92
          + GGLD +L N     L   +     + L+ M
Sbjct: 67 KAGGLDEYLLNKPDHKLENDLCLYWKRELQTM 98


>gi|296393677|ref|YP_003658561.1| 50S ribosomal protein L28 [Segniliparus rotundus DSM 44985]
 gi|296180824|gb|ADG97730.1| ribosomal protein L28 [Segniliparus rotundus DSM 44985]
          Length = 78

 Score = 85.5 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 20/84 (23%), Positives = 39/84 (46%), Gaps = 6/84 (7%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS  C++T +    G  VSH++ +T RR+ PN+ R         +   L +S   +++++
Sbjct: 1  MSAHCQVTGRQPGFGMAVSHSHRRTNRRWNPNIQRRRYFLPSEGRTITLNVSTKGIKTID 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTL 84
          R+G        +    L A+   +
Sbjct: 61 RKG------IEAVVAELRAKGVKV 78


>gi|237745385|ref|ZP_04575866.1| ribosomal protein L28 [Oxalobacter formigenes HOxBLS]
 gi|229378880|gb|EEO28971.1| ribosomal protein L28 [Oxalobacter formigenes HOxBLS]
          Length = 75

 Score = 85.5 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 28/56 (50%), Positives = 36/56 (64%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCAL 56
          M+RVC++T K  MSGN VSHANNK+RRRF+PNL       +   +   LR+S   L
Sbjct: 1  MARVCQVTGKKPMSGNTVSHANNKSRRRFMPNLHYRRFFVESENRWVSLRVSNAGL 56


>gi|326802522|ref|YP_004320341.1| 50S ribosomal protein L28 [Sphingobacterium sp. 21]
 gi|326553286|gb|ADZ81671.1| 50S ribosomal protein L28 [Sphingobacterium sp. 21]
          Length = 77

 Score = 85.5 bits (211), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 24/74 (32%), Positives = 43/74 (58%), Gaps = 3/74 (4%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR+C+LT K  M+G  VS++N KT+R+F PNL           +   L++S  A++++ 
Sbjct: 1  MSRICDLTGKAAMNGYNVSNSNVKTKRKFYPNLQTKRFFIPEENRWITLKVSTSAIKTIN 60

Query: 61 RQGG---LDRFLSN 71
          + G    +++F+  
Sbjct: 61 KNGITAVINKFIKK 74


>gi|327404678|ref|YP_004345516.1| 50S ribosomal protein L28P [Fluviicola taffensis DSM 16823]
 gi|327320186|gb|AEA44678.1| LSU ribosomal protein L28P [Fluviicola taffensis DSM 16823]
          Length = 78

 Score = 85.1 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 30/63 (47%), Positives = 41/63 (65%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC+LT K+VM GN VSH+N KT+R+F PNL          +    L+IS  ALR++ 
Sbjct: 1  MSRVCQLTGKSVMVGNNVSHSNRKTKRKFYPNLLTKKFYVPEDDMYVTLKISASALRTIN 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|229496123|ref|ZP_04389844.1| ribosomal protein L28 [Porphyromonas endodontalis ATCC 35406]
 gi|229316954|gb|EEN82866.1| ribosomal protein L28 [Porphyromonas endodontalis ATCC 35406]
          Length = 79

 Score = 85.1 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 25/75 (33%), Positives = 41/75 (54%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS+ C++T K  M GN VSH+N+KT+R F  NL          +   +L++S   LR + 
Sbjct: 1  MSKACQITGKRAMVGNNVSHSNHKTKRVFNVNLFEKKFYWPEQDCWIRLKVSADGLRLIN 60

Query: 61 RQGGLDRFLSNSKKE 75
          + G L+  L  + ++
Sbjct: 61 KIG-LNEALKRAAEK 74


>gi|109896379|ref|YP_659634.1| ribosomal protein L28 [Pseudoalteromonas atlantica T6c]
 gi|332304439|ref|YP_004432290.1| ribosomal protein L28 [Glaciecola agarilytica 4H-3-7+YE-5]
 gi|123171929|sp|Q15ZV8|RL28_PSEA6 RecName: Full=50S ribosomal protein L28
 gi|109698660|gb|ABG38580.1| LSU ribosomal protein L28P [Pseudoalteromonas atlantica T6c]
 gi|332171768|gb|AEE21022.1| ribosomal protein L28 [Glaciecola agarilytica 4H-3-7+YE-5]
          Length = 78

 Score = 85.1 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 28/75 (37%), Positives = 43/75 (57%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS+VC +T K    GN  SHA N TRRRFLPNL       +   +  +LR+S   +R ++
Sbjct: 1  MSKVCIVTGKRPAVGNNRSHAKNSTRRRFLPNLQTHRFWVESENRFVKLRLSAKGMRIID 60

Query: 61 RQGGLDRFLSNSKKE 75
          ++G +D  L++ +  
Sbjct: 61 KKG-IDSVLTDIRAN 74


>gi|322709867|gb|EFZ01442.1| 50S ribosomal protein L24 [Metarhizium anisopliae ARSEF 23]
          Length = 292

 Score = 85.1 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 20/90 (22%), Positives = 45/90 (50%), Gaps = 4/90 (4%)

Query: 11  TVMSGNKVSHANN-KTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFL 69
            +  GN V+  +N K+RR + PN+   T  S  +  + + R++   L+++ R+GG++ +L
Sbjct: 104 RIRFGNNVAEKHNNKSRRFWRPNVHVKTFFSPSLGARVKTRLTLRVLKTIRREGGIENYL 163

Query: 70  SN---SKKENLSARMRTLRSQILKKMSEKS 96
                ++   L      LR  +++  + + 
Sbjct: 164 LKSKPARIRELGPGGWNLRWILMQTQAVQQ 193


>gi|314967206|gb|EFT11305.1| ribosomal protein L28 [Propionibacterium acnes HL082PA2]
          Length = 105

 Score = 85.1 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 19/63 (30%), Positives = 35/63 (55%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR C++       GN VSH+   T+RR+ PN+ +       + +K  L ++  A++ ++
Sbjct: 1  MSRRCQVRGTKPEFGNNVSHSQRHTKRRWNPNIQKKRYWVPSLGRKVTLTLTPKAIKEID 60

Query: 61 RQG 63
          R+G
Sbjct: 61 RRG 63


>gi|317506812|ref|ZP_07964586.1| ribosomal protein L28 [Segniliparus rugosus ATCC BAA-974]
 gi|316254886|gb|EFV14182.1| ribosomal protein L28 [Segniliparus rugosus ATCC BAA-974]
          Length = 78

 Score = 85.1 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 20/84 (23%), Positives = 39/84 (46%), Gaps = 6/84 (7%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS  C++T +    G  VSH++ +T RR+ PN+ R         +   L +S   +++++
Sbjct: 1  MSAHCQVTGRQPGFGMAVSHSHRRTNRRWNPNIQRRRYFLPSEGRTITLNVSAKGIKTID 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTL 84
          R+G        +    L A+   +
Sbjct: 61 RKG------IETVVAELRAKGVKV 78


>gi|282862693|ref|ZP_06271754.1| ribosomal protein L28 [Streptomyces sp. ACTE]
 gi|282562379|gb|EFB67920.1| ribosomal protein L28 [Streptomyces sp. ACTE]
          Length = 78

 Score = 85.1 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 21/63 (33%), Positives = 34/63 (53%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS  C+LT      GN +SH++ +T RRF PN+ R         +  +L +S  A+R+++
Sbjct: 1  MSAHCQLTGAQPGFGNHISHSHRRTSRRFDPNIQRKRYWLPSEGRHVRLTLSARAIRTID 60

Query: 61 RQG 63
            G
Sbjct: 61 TIG 63


>gi|319953947|ref|YP_004165214.1| lsu ribosomal protein l28p [Cellulophaga algicola DSM 14237]
 gi|319422607|gb|ADV49716.1| LSU ribosomal protein L28P [Cellulophaga algicola DSM 14237]
          Length = 78

 Score = 85.1 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 30/79 (37%), Positives = 46/79 (58%), Gaps = 1/79 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS+VCE+T K  M GN VS + NKTRRRF  NL +     +  ++   L++S  AL+S+ 
Sbjct: 1  MSKVCEITGKRAMFGNNVSFSINKTRRRFNVNLSKKRFYIEEEDRWVTLKVSARALKSIN 60

Query: 61 RQGGLDRFLSNSKKENLSA 79
          ++G +   L  +K   L+ 
Sbjct: 61 KKG-ISAVLKEAKANGLTK 78


>gi|182434338|ref|YP_001822057.1| putative 50S ribosomal protein L28 [Streptomyces griseus subsp.
          griseus NBRC 13350]
 gi|178462854|dbj|BAG17374.1| putative 50S ribosomal protein L28 [Streptomyces griseus subsp.
          griseus NBRC 13350]
          Length = 78

 Score = 84.7 bits (209), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 22/63 (34%), Positives = 34/63 (53%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS  C+LT      GN +SH++ +T RRF PN+ R         +  +L +S  A+R+V+
Sbjct: 1  MSAHCQLTGSKPGFGNNISHSHRRTSRRFDPNVQRKRYWLPGEGRSVRLTLSARAIRTVD 60

Query: 61 RQG 63
            G
Sbjct: 61 SIG 63


>gi|332534469|ref|ZP_08410308.1| 50S ribosomal protein L28 [Pseudoalteromonas haloplanktis
          ANT/505]
 gi|332036122|gb|EGI72598.1| 50S ribosomal protein L28 [Pseudoalteromonas haloplanktis
          ANT/505]
          Length = 78

 Score = 84.7 bits (209), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 27/75 (36%), Positives = 42/75 (56%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS+VC++T K    GN  SHA N TRRRFLPNL       +  ++   LR +   +R ++
Sbjct: 1  MSKVCQVTGKRPAVGNHRSHARNATRRRFLPNLQTHRFWVESEKRFVTLRTTTKGMRIID 60

Query: 61 RQGGLDRFLSNSKKE 75
          ++G +D  L+  +  
Sbjct: 61 KKG-IDTVLTEIRAR 74


>gi|332291042|ref|YP_004429651.1| ribosomal protein L28 [Krokinobacter diaphorus 4H-3-7-5]
 gi|332169128|gb|AEE18383.1| ribosomal protein L28 [Krokinobacter diaphorus 4H-3-7-5]
          Length = 79

 Score = 84.7 bits (209), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 29/75 (38%), Positives = 45/75 (60%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVCELT K  M GN VSHA NKT+R+F  NL +        ++   L++S  AL+++ 
Sbjct: 1  MSRVCELTGKKAMVGNNVSHAMNKTKRKFNVNLMKKRFYLPAEDKWITLKVSTSALKNIN 60

Query: 61 RQGGLDRFLSNSKKE 75
          ++G +D  +  ++  
Sbjct: 61 KKG-IDAVVKEARAN 74


>gi|169609064|ref|XP_001797951.1| hypothetical protein SNOG_07617 [Phaeosphaeria nodorum SN15]
 gi|111063963|gb|EAT85083.1| hypothetical protein SNOG_07617 [Phaeosphaeria nodorum SN15]
          Length = 470

 Score = 84.7 bits (209), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 27/85 (31%), Positives = 46/85 (54%), Gaps = 4/85 (4%)

Query: 11  TVMSGNKVS-HANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFL 69
            +  GN VS     KTRR + PN+    L S  +++K +LRI+   L++++R+GGLD +L
Sbjct: 88  MIHFGNNVSEKTETKTRRDWKPNVLSKGLYSVALKKKIKLRITSRVLKTMDREGGLDEYL 147

Query: 70  SNS---KKENLSARMRTLRSQILKK 91
                 + + L      LR  +++K
Sbjct: 148 LKDNEHRLKELGPLGWALRWTLMQK 172


>gi|325285397|ref|YP_004261187.1| 50S ribosomal protein L28 [Cellulophaga lytica DSM 7489]
 gi|324320851|gb|ADY28316.1| 50S ribosomal protein L28 [Cellulophaga lytica DSM 7489]
          Length = 78

 Score = 84.7 bits (209), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 29/75 (38%), Positives = 44/75 (58%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS+VCE+T K  M GN VS + NKTRRRF  NL +        ++   L++S  AL+S+ 
Sbjct: 1  MSKVCEITGKKAMFGNNVSFSINKTRRRFDVNLSKKRFYIPEEDRWITLKVSTRALKSIN 60

Query: 61 RQGGLDRFLSNSKKE 75
          ++G +   L  +K +
Sbjct: 61 KKG-ISEVLKEAKAQ 74


>gi|126661955|ref|ZP_01732954.1| 50S ribosomal protein L28 [Flavobacteria bacterium BAL38]
 gi|126625334|gb|EAZ96023.1| 50S ribosomal protein L28 [Flavobacteria bacterium BAL38]
          Length = 80

 Score = 84.7 bits (209), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 32/75 (42%), Positives = 44/75 (58%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVCELT K  M GN VSHA NKT+R+F  NL +        ++   L+IS  AL+++ 
Sbjct: 1  MSRVCELTGKRAMVGNNVSHAMNKTKRKFSVNLVKKRFYIPEEDRWVTLKISTAALKTIN 60

Query: 61 RQGGLDRFLSNSKKE 75
          + G +   L N+K  
Sbjct: 61 KNG-IAAVLKNAKAN 74


>gi|305667749|ref|YP_003864036.1| 50S ribosomal protein L28 [Maribacter sp. HTCC2170]
 gi|88707586|gb|EAQ99828.1| 50S ribosomal protein L28 [Maribacter sp. HTCC2170]
          Length = 78

 Score = 84.7 bits (209), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 30/77 (38%), Positives = 45/77 (58%), Gaps = 1/77 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS+VCE+T K  M GN VS + NKTRRRF  NL +        ++   L++S  AL+S+ 
Sbjct: 1  MSKVCEITGKRAMFGNNVSFSINKTRRRFNVNLSKKRFYIPEEDRWVTLKVSAKALKSIN 60

Query: 61 RQGGLDRFLSNSKKENL 77
          ++G +   L  +K + L
Sbjct: 61 KKG-ISAVLKEAKAQGL 76


>gi|320012235|gb|ADW07085.1| ribosomal protein L28 [Streptomyces flavogriseus ATCC 33331]
          Length = 78

 Score = 84.7 bits (209), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 22/63 (34%), Positives = 35/63 (55%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS  C+LT      GNK+SH++ +T RRF PN+ R         +  +L +S  A+R+++
Sbjct: 1  MSAHCQLTGSRPGFGNKISHSHRRTPRRFDPNVQRKRYWLPGEGRYVRLTLSARAVRTID 60

Query: 61 RQG 63
            G
Sbjct: 61 AIG 63


>gi|325676326|ref|ZP_08156005.1| 50S ribosomal protein L28 [Rhodococcus equi ATCC 33707]
 gi|325552887|gb|EGD22570.1| 50S ribosomal protein L28 [Rhodococcus equi ATCC 33707]
          Length = 78

 Score = 84.7 bits (209), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 19/63 (30%), Positives = 35/63 (55%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS  C++T +    G  VSH++ +T RR+ PN+   T       ++  LR++   +R+++
Sbjct: 1  MSAHCQVTGRRPGFGRSVSHSHRRTNRRWNPNIQTKTYFLPGEGRRITLRVTPKGIRTID 60

Query: 61 RQG 63
          R G
Sbjct: 61 RDG 63


>gi|237785096|ref|YP_002905801.1| 50S ribosomal protein L28 [Corynebacterium kroppenstedtii DSM
          44385]
 gi|259646731|sp|C4LHF3|RL28_CORK4 RecName: Full=50S ribosomal protein L28
 gi|237758008|gb|ACR17258.1| 50S ribosomal protein L28 [Corynebacterium kroppenstedtii DSM
          44385]
          Length = 78

 Score = 84.7 bits (209), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 23/84 (27%), Positives = 39/84 (46%), Gaps = 6/84 (7%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS  C++T +    G  VSH++ +T RR+ PN+ R +       +   L +S   L++++
Sbjct: 1  MSAYCQVTGRKPSFGKSVSHSHRRTNRRWNPNIQRRSFYLPSEGRTITLNVSTKGLKTID 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTL 84
          R G        S    L AR   +
Sbjct: 61 RYG------IESVVAKLRARGEKI 78


>gi|303283017|ref|XP_003060800.1| predicted protein [Micromonas pusilla CCMP1545]
 gi|226458271|gb|EEH55569.1| predicted protein [Micromonas pusilla CCMP1545]
          Length = 208

 Score = 84.7 bits (209), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 26/77 (33%), Positives = 45/77 (58%), Gaps = 1/77 (1%)

Query: 22  NNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFLSNSKKENL-SAR 80
           N +TRRR+ PN  R  L S+ +++  ++ ++  ALR +++ GGLD +L N+  + L S +
Sbjct: 99  NPRTRRRWKPNAQRKRLYSEALDELVRVNVTTYALRWIDKAGGLDAYLLNTTPQKLMSYK 158

Query: 81  MRTLRSQILKKMSEKSS 97
              LR ++L     K S
Sbjct: 159 ALELRKRVLDAKGIKES 175


>gi|86131782|ref|ZP_01050379.1| 50S ribosomal protein L28 [Dokdonia donghaensis MED134]
 gi|85817604|gb|EAQ38778.1| 50S ribosomal protein L28 [Dokdonia donghaensis MED134]
          Length = 79

 Score = 84.3 bits (208), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 29/75 (38%), Positives = 45/75 (60%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVCELT K  M GN VSHA NKT+R+F  NL +        ++   L++S  AL+++ 
Sbjct: 1  MSRVCELTGKKAMVGNNVSHAMNKTKRKFNVNLMKKRFYLPAEDKWITLKVSASALKNIN 60

Query: 61 RQGGLDRFLSNSKKE 75
          ++G +D  +  ++  
Sbjct: 61 KKG-IDAVVKEARAN 74


>gi|219118234|ref|XP_002179896.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gi|217408949|gb|EEC48882.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
          Length = 89

 Score = 84.3 bits (208), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 23/75 (30%), Positives = 42/75 (56%)

Query: 2  SRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVER 61
          SR      K V +GN VS +   T+R F PN+    + S+I+++  +  ++   LRS+++
Sbjct: 15 SRRGLYDGKDVRTGNNVSFSMRATKRTFKPNVMIKRVYSEILDEMVKFHLTTSTLRSIDK 74

Query: 62 QGGLDRFLSNSKKEN 76
           GGLD +L  ++ + 
Sbjct: 75 AGGLDNYLLKNEYKE 89


>gi|268315599|ref|YP_003289318.1| 50S ribosomal protein L28 [Rhodothermus marinus DSM 4252]
 gi|262333133|gb|ACY46930.1| ribosomal protein L28 [Rhodothermus marinus DSM 4252]
          Length = 78

 Score = 84.3 bits (208), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 26/63 (41%), Positives = 41/63 (65%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+R  +LT K  +SG+ VSHANNKT+RRFLPNL +        ++   LR+S   ++++ 
Sbjct: 1  MARRDQLTGKGPVSGHNVSHANNKTKRRFLPNLQKKRFYIPEEKRWITLRVSAKTMKTIN 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|168025999|ref|XP_001765520.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162683158|gb|EDQ69570.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 129

 Score = 84.3 bits (208), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 24/62 (38%), Positives = 38/62 (61%)

Query: 2   SRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVER 61
           SR C+LT K   +G KVS +N++T+    PNL    L  +  ++  +LRIS  AL+++E+
Sbjct: 53  SRRCDLTGKKANNGYKVSFSNHRTKHLQQPNLQYKRLWWEEGKRFVKLRISTKALKTIEK 112

Query: 62  QG 63
            G
Sbjct: 113 NG 114


>gi|325103019|ref|YP_004272673.1| LSU ribosomal protein L28P [Pedobacter saltans DSM 12145]
 gi|324971867|gb|ADY50851.1| LSU ribosomal protein L28P [Pedobacter saltans DSM 12145]
          Length = 77

 Score = 84.3 bits (208), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 24/63 (38%), Positives = 38/63 (60%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR+C+LT K  M G+ VSH+N KT R+F PNL          ++   L++S  A++++ 
Sbjct: 1  MSRICDLTGKAAMKGHHVSHSNVKTIRKFYPNLQLKKFYIPEEDRWITLKVSTSAIKTIN 60

Query: 61 RQG 63
          + G
Sbjct: 61 KIG 63


>gi|328849475|gb|EGF98654.1| hypothetical protein MELLADRAFT_50935 [Melampsora larici-populina
           98AG31]
          Length = 244

 Score = 84.3 bits (208), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 22/87 (25%), Positives = 50/87 (57%)

Query: 9   KKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRF 68
              V +G+ +  + ++T+R + PN+ + +L S+++ Q  QL+++  AL+++++ GGLDR+
Sbjct: 72  GLKVKAGDNIPKSKHRTKRVWNPNVQKSSLWSEVLNQSLQLKLTTAALKTIDKVGGLDRY 131

Query: 69  LSNSKKENLSARMRTLRSQILKKMSEK 95
           +     + L      +R  ++  M  K
Sbjct: 132 VLQMSDQRLGGTGIRIRELVISAMKAK 158


>gi|322693338|gb|EFY85202.1| 50S ribosomal protein L24 [Metarhizium acridum CQMa 102]
          Length = 292

 Score = 84.3 bits (208), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 20/90 (22%), Positives = 45/90 (50%), Gaps = 4/90 (4%)

Query: 11  TVMSGNKVSHANN-KTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFL 69
            +  GN V+  +N K+RR + PN+   T  S  +  + + R++   L+++ R+GG++ +L
Sbjct: 104 RIRFGNNVAEKHNNKSRRFWRPNVHVKTFFSPSLGARVKTRLTLRVLKTIRREGGIENYL 163

Query: 70  SN---SKKENLSARMRTLRSQILKKMSEKS 96
                ++   L      LR  +++  + + 
Sbjct: 164 LKSKPARIRELGPGGWNLRWILMQTQAVQQ 193


>gi|254777316|ref|ZP_05218832.1| ribosomal protein L28 [Mycobacterium avium subsp. avium ATCC
          25291]
          Length = 78

 Score = 84.3 bits (208), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 20/63 (31%), Positives = 36/63 (57%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS  C++T +    GN VSH++ +T RR+ PN+   T       ++ +LR+S   ++ ++
Sbjct: 1  MSAHCQVTGRRPSFGNAVSHSHRRTPRRWSPNIQLKTYYLPSEGRRVRLRVSAKGIKVID 60

Query: 61 RQG 63
          R G
Sbjct: 61 RDG 63


>gi|66812698|ref|XP_640528.1| hypothetical protein DDB_G0281601 [Dictyostelium discoideum AX4]
 gi|60468559|gb|EAL66562.1| hypothetical protein DDB_G0281601 [Dictyostelium discoideum AX4]
          Length = 142

 Score = 84.3 bits (208), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 19/96 (19%), Positives = 51/96 (53%), Gaps = 1/96 (1%)

Query: 2   SRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVER 61
           ++      K ++  ++ S +  KTRR + PN+   T  SD+++   ++ ++   +R +++
Sbjct: 20  AQRGLYGGKDIIFSDQSSFSTRKTRRTWKPNVQTKTYHSDVLDSNIRVSLTTYTIRCIDK 79

Query: 62  QGGLDRFLSNSKKENL-SARMRTLRSQILKKMSEKS 96
            G  D ++ ++K ++L S     L+  +  ++ +K+
Sbjct: 80  AGSFDNYIIHTKDKDLASELGSDLKVAMKHELQKKA 115


>gi|134097360|ref|YP_001103021.1| 50S ribosomal protein L28 [Saccharopolyspora erythraea NRRL 2338]
 gi|291009081|ref|ZP_06567054.1| 50S ribosomal protein L28 [Saccharopolyspora erythraea NRRL 2338]
 gi|133909983|emb|CAM00095.1| 50S ribosomal protein L28 [Saccharopolyspora erythraea NRRL 2338]
          Length = 78

 Score = 83.9 bits (207), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 21/63 (33%), Positives = 39/63 (61%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS  C++T K    G +VSH++ +T RR++PN+ R         +  +LR+S  A+++++
Sbjct: 1  MSVRCQVTGKKPGYGKQVSHSHVRTNRRWMPNVQRRRYWLPSEGRWVRLRLSAKAMKTID 60

Query: 61 RQG 63
          R+G
Sbjct: 61 RRG 63


>gi|29653643|ref|NP_819335.1| 50S ribosomal protein L28 [Coxiella burnetii RSA 493]
 gi|153208650|ref|ZP_01946902.1| ribosomal protein L28 [Coxiella burnetii 'MSU Goat Q177']
 gi|154707613|ref|YP_001425122.1| 50S ribosomal protein L28 [Coxiella burnetii Dugway 5J108-111]
 gi|161830851|ref|YP_001596241.1| 50S ribosomal protein L28 [Coxiella burnetii RSA 331]
 gi|165919768|ref|ZP_02219511.1| ribosomal protein L28 [Coxiella burnetii RSA 334]
 gi|212213200|ref|YP_002304136.1| 50S ribosomal protein L28 [Coxiella burnetii CbuG_Q212]
 gi|212218126|ref|YP_002304913.1| 50S ribosomal protein L28 [Coxiella burnetii CbuK_Q154]
 gi|67461514|sp|Q83EM4|RL28_COXBU RecName: Full=50S ribosomal protein L28
 gi|189042431|sp|A9KGS7|RL28_COXBN RecName: Full=50S ribosomal protein L28
 gi|189042432|sp|A9NB26|RL28_COXBR RecName: Full=50S ribosomal protein L28
 gi|226738060|sp|B6J5S6|RL28_COXB1 RecName: Full=50S ribosomal protein L28
 gi|226738061|sp|B6J213|RL28_COXB2 RecName: Full=50S ribosomal protein L28
 gi|29540905|gb|AAO89849.1| LSU ribosomal protein L28P [Coxiella burnetii RSA 493]
 gi|120575836|gb|EAX32460.1| ribosomal protein L28 [Coxiella burnetii 'MSU Goat Q177']
 gi|154356899|gb|ABS78361.1| LSU ribosomal protein L28P [Coxiella burnetii Dugway 5J108-111]
 gi|161762718|gb|ABX78360.1| ribosomal protein L28 [Coxiella burnetii RSA 331]
 gi|165916851|gb|EDR35455.1| ribosomal protein L28 [Coxiella burnetii RSA 334]
 gi|212011610|gb|ACJ18991.1| LSU ribosomal protein L28P [Coxiella burnetii CbuG_Q212]
 gi|212012388|gb|ACJ19768.1| LSU ribosomal protein L28P [Coxiella burnetii CbuK_Q154]
          Length = 79

 Score = 83.9 bits (207), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 27/76 (35%), Positives = 43/76 (56%), Gaps = 1/76 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M++VC++T K   SGN VSHAN KT RRFLPNL +        ++   L +S   +R ++
Sbjct: 1  MAKVCQVTGKRPQSGNNVSHANKKTNRRFLPNLKKRRFWLPDEKRFITLTVSTHGMRIID 60

Query: 61 RQGGLDRFLSNSKKEN 76
          + G ++  L   ++  
Sbjct: 61 KLG-INAVLKKIRERE 75


>gi|146302710|ref|YP_001197301.1| ribosomal protein L28 [Flavobacterium johnsoniae UW101]
 gi|189029440|sp|A5F9Z1|RL28_FLAJO RecName: Full=50S ribosomal protein L28
 gi|146157128|gb|ABQ07982.1| LSU ribosomal protein L28P [Flavobacterium johnsoniae UW101]
          Length = 78

 Score = 83.9 bits (207), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 27/75 (36%), Positives = 43/75 (57%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC+LT K  M GN VSHA NKT+R+F  NL +        ++   LR++   ++++ 
Sbjct: 1  MSRVCDLTGKRAMVGNNVSHAMNKTKRKFSVNLVKKRFYLPEEDRWITLRVAASTIKTIN 60

Query: 61 RQGGLDRFLSNSKKE 75
          + G +   L  ++ E
Sbjct: 61 KNG-ITAVLKKAQSE 74


>gi|312888453|ref|ZP_07748027.1| LSU ribosomal protein L28P [Mucilaginibacter paludis DSM 18603]
 gi|311299081|gb|EFQ76176.1| LSU ribosomal protein L28P [Mucilaginibacter paludis DSM 18603]
          Length = 77

 Score = 83.9 bits (207), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 24/63 (38%), Positives = 39/63 (61%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR+C+LT K  M+G  VS++N KT+RRF PNL          ++   L++S  A++++ 
Sbjct: 1  MSRICDLTGKGSMNGFNVSNSNVKTKRRFYPNLQTKKFYIPEEDKWITLKVSTAAIKTIS 60

Query: 61 RQG 63
          + G
Sbjct: 61 KNG 63


>gi|120436590|ref|YP_862276.1| 50S ribosomal protein L28 [Gramella forsetii KT0803]
 gi|166226577|sp|A0M3L4|RL28_GRAFK RecName: Full=50S ribosomal protein L28
 gi|117578740|emb|CAL67209.1| 50S ribosomal protein L28 [Gramella forsetii KT0803]
          Length = 79

 Score = 83.9 bits (207), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 28/75 (37%), Positives = 43/75 (57%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVCELT K  M GN VSHA NKT+R+F  NL +        ++   L++   AL+ + 
Sbjct: 1  MSRVCELTGKRAMVGNNVSHAMNKTKRKFNANLVKKRFFLPEEDRWVTLKVCTSALKDIN 60

Query: 61 RQGGLDRFLSNSKKE 75
          ++G +   +  +K +
Sbjct: 61 KKG-ISAVIKEAKAK 74


>gi|213966101|ref|ZP_03394289.1| conserved domain protein [Corynebacterium amycolatum SK46]
 gi|213951299|gb|EEB62693.1| conserved domain protein [Corynebacterium amycolatum SK46]
          Length = 135

 Score = 83.9 bits (207), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 18/75 (24%), Positives = 39/75 (52%), Gaps = 1/75 (1%)

Query: 1   MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
           MS +C++T +    G  VSH++ +T RR+ PN+ R         +   L +S   L++++
Sbjct: 58  MSAICQVTGRKPSFGKTVSHSHRRTSRRWNPNVQRKKFYLASEGRHITLNVSPKGLKTID 117

Query: 61  RQGGLDRFLSNSKKE 75
           + G ++  ++  +  
Sbjct: 118 KYG-IEAVVAQIRAR 131


>gi|184200006|ref|YP_001854213.1| 50S ribosomal protein L28 [Kocuria rhizophila DC2201]
 gi|226694951|sp|B2GG84|RL28_KOCRD RecName: Full=50S ribosomal protein L28
 gi|183580236|dbj|BAG28707.1| 50S ribosomal protein L28 [Kocuria rhizophila DC2201]
          Length = 78

 Score = 83.9 bits (207), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 18/84 (21%), Positives = 41/84 (48%), Gaps = 6/84 (7%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+  C++T      G+ +SH++ +T+RR+ PN+ +       + +   L +S   ++ ++
Sbjct: 1  MAAHCQVTGAQPGFGHSISHSHRRTKRRWNPNIQKKRYWVPSLRRNVTLNLSAKGIKVID 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTL 84
           +G +D  +       L AR   +
Sbjct: 61 ARG-IDAVV-----NELIARGEKI 78


>gi|68536621|ref|YP_251326.1| 50S ribosomal protein L28 [Corynebacterium jeikeium K411]
 gi|260577822|ref|ZP_05845756.1| 50S ribosomal protein L28 [Corynebacterium jeikeium ATCC 43734]
 gi|123650515|sp|Q4JTZ9|RL28_CORJK RecName: Full=50S ribosomal protein L28
 gi|68264220|emb|CAI37708.1| 50S ribosomal protein L28 [Corynebacterium jeikeium K411]
 gi|258604049|gb|EEW17292.1| 50S ribosomal protein L28 [Corynebacterium jeikeium ATCC 43734]
          Length = 78

 Score = 83.9 bits (207), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 20/75 (26%), Positives = 39/75 (52%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS  C++T +    G  VSH++ +T RR+ PN+ R T       +   L +S   L++++
Sbjct: 1  MSAYCQVTGRKPSFGKSVSHSHRRTNRRWNPNIQRRTFYLPSEGRSITLNVSTKGLKTID 60

Query: 61 RQGGLDRFLSNSKKE 75
          R G ++  ++  +  
Sbjct: 61 RDG-IESVVAKIRAR 74


>gi|294505837|ref|YP_003569895.1| 50S Ribosomal protein L28 [Salinibacter ruber M8]
 gi|294342165|emb|CBH22943.1| 50S Ribosomal protein L28 [Salinibacter ruber M8]
          Length = 166

 Score = 83.9 bits (207), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 21/75 (28%), Positives = 42/75 (56%), Gaps = 1/75 (1%)

Query: 1   MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
           M+R  ++T +  ++GN VS +N KT RRF  NL          ++  +L++S   L+++ 
Sbjct: 89  MARKDDVTGEGPVTGNSVSDSNQKTNRRFKRNLHEKRFYIPSEDRHVKLKVSSKTLKTIN 148

Query: 61  RQGGLDRFLSNSKKE 75
           ++G +   L  ++K+
Sbjct: 149 KKG-IQAVLEEARKQ 162


>gi|298209275|ref|YP_003717454.1| ribosomal protein L28 [Croceibacter atlanticus HTCC2559]
 gi|83849202|gb|EAP87071.1| ribosomal protein L28 [Croceibacter atlanticus HTCC2559]
          Length = 79

 Score = 83.9 bits (207), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 29/75 (38%), Positives = 45/75 (60%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVCELT K  M GN VSHA NKT+R+F  NL +        ++   L+IS  AL+++ 
Sbjct: 1  MSRVCELTGKRAMVGNNVSHAMNKTKRKFNVNLIKKRFYIPEEDKWMTLKISTSALKTIN 60

Query: 61 RQGGLDRFLSNSKKE 75
          ++G +   +  ++ +
Sbjct: 61 KKG-ISAVIKEARAK 74


>gi|154492235|ref|ZP_02031861.1| hypothetical protein PARMER_01869 [Parabacteroides merdae ATCC
          43184]
 gi|218261813|ref|ZP_03476528.1| hypothetical protein PRABACTJOHN_02199 [Parabacteroides johnsonii
          DSM 18315]
 gi|154087460|gb|EDN86505.1| hypothetical protein PARMER_01869 [Parabacteroides merdae ATCC
          43184]
 gi|218223759|gb|EEC96409.1| hypothetical protein PRABACTJOHN_02199 [Parabacteroides johnsonii
          DSM 18315]
          Length = 79

 Score = 83.5 bits (206), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 24/75 (32%), Positives = 40/75 (53%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS++C++T K  M GN VSH+  +T+R+F  NL          +    L IS   LR++ 
Sbjct: 1  MSKICQITGKKAMVGNNVSHSKRRTKRKFDVNLFTKKFYWVEQDCWVSLNISAAGLRTIN 60

Query: 61 RQGGLDRFLSNSKKE 75
          + G LD  +  + ++
Sbjct: 61 KLG-LDAAIKKAAEK 74


>gi|118464773|ref|YP_883997.1| ribosomal protein L28 [Mycobacterium avium 104]
 gi|118166060|gb|ABK66957.1| ribosomal protein L28 [Mycobacterium avium 104]
          Length = 78

 Score = 83.5 bits (206), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 20/63 (31%), Positives = 36/63 (57%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS  C++T +    GN VSH++ +T RR+ PN+   T       ++ +LR+S   ++ ++
Sbjct: 1  MSADCQVTGRRPSFGNAVSHSHRRTPRRWSPNIQLKTYYLPSEGRRIRLRVSAKGIKVID 60

Query: 61 RQG 63
          R G
Sbjct: 61 RDG 63


>gi|29468214|gb|AAO85450.1| 50S ribosomal protein L28 Rpl28 [Pyrocystis lunula]
          Length = 81

 Score = 83.5 bits (206), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 29/70 (41%), Positives = 44/70 (62%), Gaps = 1/70 (1%)

Query: 2  SRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVER 61
          SR+C+LT K  ++GN VSH+N KT+RRFLPNL +        E+   L++S  ALR++ +
Sbjct: 1  SRICQLTGKRPITGNNVSHSNRKTKRRFLPNLFKKRFFIPETEEWVTLKVSSTALRNINK 60

Query: 62 QGGLDRFLSN 71
           G +  +L  
Sbjct: 61 LG-IYAYLKK 69


>gi|163787977|ref|ZP_02182423.1| uridine kinase [Flavobacteriales bacterium ALC-1]
 gi|159876297|gb|EDP70355.1| uridine kinase [Flavobacteriales bacterium ALC-1]
          Length = 78

 Score = 83.5 bits (206), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 29/75 (38%), Positives = 44/75 (58%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVCELT K  M GN VSHA NKT+R+F  NL +        ++   L++S  AL+++ 
Sbjct: 1  MSRVCELTGKKAMVGNNVSHAMNKTKRKFNANLVKKRFFIPEEDKWVTLKVSTSALKTIN 60

Query: 61 RQGGLDRFLSNSKKE 75
          + G +   L  ++ +
Sbjct: 61 KIG-ISAMLKEARAK 74


>gi|150025492|ref|YP_001296318.1| 50S ribosomal protein L28 [Flavobacterium psychrophilum JIP02/86]
 gi|166226571|sp|A6GZI6|RL28_FLAPJ RecName: Full=50S ribosomal protein L28
 gi|149772033|emb|CAL43509.1| 50S ribosomal protein L28 [Flavobacterium psychrophilum JIP02/86]
          Length = 78

 Score = 83.5 bits (206), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 25/72 (34%), Positives = 41/72 (56%), Gaps = 1/72 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR+C+LT K  M GN VSHA NKT+R+F  NL +        ++   LR++   ++++ 
Sbjct: 1  MSRICDLTGKRAMVGNNVSHAMNKTKRKFSVNLIKKRFYLPEEDRWITLRVAASTIKTIN 60

Query: 61 RQGGLDRFLSNS 72
          + G +   L  +
Sbjct: 61 KNG-ISAVLKKA 71


>gi|227539205|ref|ZP_03969254.1| ribosomal protein L28 [Sphingobacterium spiritivorum ATCC 33300]
 gi|300770679|ref|ZP_07080558.1| 50S ribosomal protein L28 [Sphingobacterium spiritivorum ATCC
          33861]
 gi|227240887|gb|EEI90902.1| ribosomal protein L28 [Sphingobacterium spiritivorum ATCC 33300]
 gi|300763155|gb|EFK59972.1| 50S ribosomal protein L28 [Sphingobacterium spiritivorum ATCC
          33861]
          Length = 77

 Score = 83.5 bits (206), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 23/63 (36%), Positives = 40/63 (63%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR+C+LT KT ++G +VS++N KT+R+F PNL           +   L++S  A++++ 
Sbjct: 1  MSRICDLTGKTALNGYRVSNSNAKTKRKFYPNLQTKRFFIPEENRWITLKVSTSAIKTIN 60

Query: 61 RQG 63
          + G
Sbjct: 61 KNG 63


>gi|307326225|ref|ZP_07605422.1| ribosomal protein L28 [Streptomyces violaceusniger Tu 4113]
 gi|306888168|gb|EFN19157.1| ribosomal protein L28 [Streptomyces violaceusniger Tu 4113]
          Length = 78

 Score = 83.5 bits (206), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 19/63 (30%), Positives = 35/63 (55%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS  C+LT +    G+ +SH++ +T+RRF PN+           +  +L +S  A+++V+
Sbjct: 1  MSAHCQLTGRQPGFGHHISHSHRRTKRRFDPNIQHKRYWLPSEGRHIRLTLSTKAIKTVD 60

Query: 61 RQG 63
            G
Sbjct: 61 TIG 63


>gi|302540597|ref|ZP_07292939.1| ribosomal protein L28 [Streptomyces hygroscopicus ATCC 53653]
 gi|302458215|gb|EFL21308.1| ribosomal protein L28 [Streptomyces himastatinicus ATCC 53653]
          Length = 78

 Score = 83.5 bits (206), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 22/63 (34%), Positives = 36/63 (57%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS  C+LT +    GN VSH++ +T+RRF PN+ R         +  +L +S  A+++V+
Sbjct: 1  MSAHCQLTGRRPGFGNHVSHSHRRTKRRFDPNIQRKRYWLPSEGRHVRLTLSARAVKTVD 60

Query: 61 RQG 63
            G
Sbjct: 61 SIG 63


>gi|189200168|ref|XP_001936421.1| 50S ribosomal protein L24 [Pyrenophora tritici-repentis Pt-1C-BFP]
 gi|187983520|gb|EDU49008.1| 50S ribosomal protein L24 [Pyrenophora tritici-repentis Pt-1C-BFP]
          Length = 488

 Score = 83.2 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 26/86 (30%), Positives = 49/86 (56%), Gaps = 4/86 (4%)

Query: 10  KTVMSGNKVSHAN-NKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRF 68
           K +  GN VS     KTRR + PN+ + +L S  +++K +L ++K  L+ ++R+GGLD +
Sbjct: 91  KRIRFGNNVSKKTETKTRRNWKPNVLQKSLYSVALKKKIKLVLAKHILKIIDREGGLDEY 150

Query: 69  LSN---SKKENLSARMRTLRSQILKK 91
           L     ++ + L      LR  ++++
Sbjct: 151 LLKDSEARIKELGPMGWALRWTLMQR 176


>gi|332284893|ref|YP_004416804.1| 50S ribosomal protein L28 [Pusillimonas sp. T7-7]
 gi|330428846|gb|AEC20180.1| 50S ribosomal protein L28 [Pusillimonas sp. T7-7]
          Length = 66

 Score = 83.2 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 27/63 (42%), Positives = 40/63 (63%), Gaps = 1/63 (1%)

Query: 13 MSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFLSNS 72
          M GN VSHANNKT+RRFLPNL       +   +  +LR+S  ALR++++ G +D  L++ 
Sbjct: 1  MVGNNVSHANNKTKRRFLPNLQSRRFWVESENRWVRLRVSTSALRTIDKNG-IDSVLADM 59

Query: 73 KKE 75
          +  
Sbjct: 60 RAR 62


>gi|220914458|ref|YP_002489767.1| 50S ribosomal protein L28 [Arthrobacter chlorophenolicus A6]
 gi|254801497|sp|B8H776|RL28_ARTCA RecName: Full=50S ribosomal protein L28
 gi|219861336|gb|ACL41678.1| ribosomal protein L28 [Arthrobacter chlorophenolicus A6]
          Length = 78

 Score = 83.2 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 15/71 (21%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+  C++T      G+ +SH++ + +RRF PN+ +       + +   L++S   +++++
Sbjct: 1  MAAHCQVTGAEPGFGHSISHSHRRNKRRFDPNIQKKRYWVPSLRRNVTLQVSARGIKTID 60

Query: 61 RQGGLDRFLSN 71
           +G +D  +++
Sbjct: 61 VRG-IDAVVAS 70


>gi|296140972|ref|YP_003648215.1| ribosomal protein L28 [Tsukamurella paurometabola DSM 20162]
 gi|296029106|gb|ADG79876.1| ribosomal protein L28 [Tsukamurella paurometabola DSM 20162]
          Length = 78

 Score = 83.2 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 20/71 (28%), Positives = 42/71 (59%), Gaps = 1/71 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS  C++T +    G +VSH++ +T RR+ PN+ R       + +   LR+S   +++++
Sbjct: 1  MSAHCQVTGRAPGFGKRVSHSHVRTSRRWDPNIQRRRYYVPSLGRTVVLRVSAKGIKTID 60

Query: 61 RQGGLDRFLSN 71
          R+G +D  +++
Sbjct: 61 RRG-IDAVVAD 70


>gi|50955925|ref|YP_063213.1| 50S ribosomal protein L28 [Leifsonia xyli subsp. xyli str.
          CTCB07]
 gi|67461387|sp|Q6ABY4|RL28_LEIXX RecName: Full=50S ribosomal protein L28
 gi|50952407|gb|AAT90108.1| 50S ribosomal protein L28 [Leifsonia xyli subsp. xyli str.
          CTCB07]
          Length = 78

 Score = 83.2 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 21/84 (25%), Positives = 44/84 (52%), Gaps = 6/84 (7%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+ VC++T  T   G+ +SH++ +T+RRF PN+ + T     + +   L +S   ++ ++
Sbjct: 1  MAAVCQVTGATPGFGHSISHSHRRTKRRFDPNIQKKTYYVPSLRRNVTLTLSAKGIKVID 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTL 84
           +G        +  ++L AR   +
Sbjct: 61 ARG------IEAVVKDLLARGEKI 78


>gi|163755937|ref|ZP_02163054.1| 50S ribosomal protein L28 [Kordia algicida OT-1]
 gi|161324108|gb|EDP95440.1| 50S ribosomal protein L28 [Kordia algicida OT-1]
          Length = 78

 Score = 83.2 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 28/75 (37%), Positives = 45/75 (60%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR+CELT K  M GN VSHA NKT+R+F  NL +        ++   L++S  AL+++ 
Sbjct: 1  MSRICELTGKKAMVGNNVSHAMNKTKRKFNANLTKKRFYIPEEDKWVTLKVSTSALKTIN 60

Query: 61 RQGGLDRFLSNSKKE 75
          ++G +   L  ++ +
Sbjct: 61 KKG-ISAVLKEARAK 74


>gi|160872438|ref|ZP_02062570.1| conserved domain protein [Rickettsiella grylli]
 gi|159121237|gb|EDP46575.1| conserved domain protein [Rickettsiella grylli]
          Length = 82

 Score = 83.2 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 29/75 (38%), Positives = 45/75 (60%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVC++T K  M G+ VSH+N KT+RRF  NL    L     ++  +LRI+   LR +E
Sbjct: 5  MARVCQVTGKKPMVGHNVSHSNRKTKRRFQINLHIRRLWVASEKRFVKLRITSQGLRIIE 64

Query: 61 RQGGLDRFLSNSKKE 75
          + G +D  L+  ++ 
Sbjct: 65 KLG-IDNVLATLRRR 78


>gi|219847552|ref|YP_002461985.1| 50S ribosomal protein L28 [Chloroflexus aggregans DSM 9485]
 gi|219541811|gb|ACL23549.1| ribosomal protein L28 [Chloroflexus aggregans DSM 9485]
          Length = 83

 Score = 83.2 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 28/85 (32%), Positives = 44/85 (51%), Gaps = 9/85 (10%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+R C+LT K    G+ VS +  +T RR+LPN+    +     ++  +L++S  ALR + 
Sbjct: 1  MARRCDLTGKGPSFGHHVSFSKRRTNRRWLPNVQTRRIWVPEEQRYVKLKLSAAALREIN 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLR 85
          R+G     L  +    L  R  TLR
Sbjct: 61 RKG-----LLKA----LRDRGLTLR 76


>gi|28493080|ref|NP_787241.1| 50S ribosomal protein L28 [Tropheryma whipplei str. Twist]
 gi|28572288|ref|NP_789068.1| 50S ribosomal protein L28 [Tropheryma whipplei TW08/27]
 gi|67461516|sp|Q83GW8|RL28_TROWT RecName: Full=50S ribosomal protein L28
 gi|67461518|sp|Q83IB6|RL28_TROW8 RecName: Full=50S ribosomal protein L28
 gi|28410419|emb|CAD66805.1| 50s ribosomal protein L28 [Tropheryma whipplei TW08/27]
 gi|28476120|gb|AAO44210.1| 50S ribosomal protein L28 [Tropheryma whipplei str. Twist]
          Length = 78

 Score = 82.8 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 25/84 (29%), Positives = 45/84 (53%), Gaps = 6/84 (7%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS VC++T  +   G  VSH++ +T+RRF PN+ R T     + ++  L +S   LR ++
Sbjct: 1  MSSVCQVTGASPGFGYAVSHSHRRTKRRFDPNVRRRTFYVATLGRRVTLNVSVKGLRLID 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTL 84
          ++G +D  +      +L  +   L
Sbjct: 61 KRG-IDAVV-----RDLIKKGVKL 78


>gi|261416330|ref|YP_003250013.1| ribosomal protein L28 [Fibrobacter succinogenes subsp.
          succinogenes S85]
 gi|261372786|gb|ACX75531.1| ribosomal protein L28 [Fibrobacter succinogenes subsp.
          succinogenes S85]
 gi|302326400|gb|ADL25601.1| ribosomal protein L28 [Fibrobacter succinogenes subsp.
          succinogenes S85]
          Length = 73

 Score = 82.8 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 24/63 (38%), Positives = 36/63 (57%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR+CE+T K  + GN VSH+N K   + LPNL +        ++   LR+S   LR++ 
Sbjct: 1  MSRICEVTGKAGLVGNMVSHSNRKKLMKQLPNLQKKRFYIPEEDRWVTLRVSAAGLRTIN 60

Query: 61 RQG 63
          + G
Sbjct: 61 KLG 63


>gi|150007342|ref|YP_001302085.1| 50S ribosomal protein L28 [Parabacteroides distasonis ATCC 8503]
 gi|256839632|ref|ZP_05545141.1| ribosomal protein L28 [Parabacteroides sp. D13]
 gi|262382084|ref|ZP_06075222.1| ribosomal protein L28 [Bacteroides sp. 2_1_33B]
 gi|298375329|ref|ZP_06985286.1| ribosomal protein L28 [Bacteroides sp. 3_1_19]
 gi|301310657|ref|ZP_07216596.1| ribosomal protein L28 [Bacteroides sp. 20_3]
 gi|166226594|sp|A6L9U9|RL28_PARD8 RecName: Full=50S ribosomal protein L28
 gi|149935766|gb|ABR42463.1| ribosomal protein L28 [Parabacteroides distasonis ATCC 8503]
 gi|256738562|gb|EEU51887.1| ribosomal protein L28 [Parabacteroides sp. D13]
 gi|262297261|gb|EEY85191.1| ribosomal protein L28 [Bacteroides sp. 2_1_33B]
 gi|298267829|gb|EFI09485.1| ribosomal protein L28 [Bacteroides sp. 3_1_19]
 gi|300832231|gb|EFK62862.1| ribosomal protein L28 [Bacteroides sp. 20_3]
          Length = 79

 Score = 82.8 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 24/75 (32%), Positives = 40/75 (53%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS++C++T K  M GN VSH+  +T+R+F  NL          +    L IS   LR++ 
Sbjct: 1  MSKICQITGKRAMVGNNVSHSKRRTKRKFNVNLFTKKFYWVEQDCWVSLNISAAGLRTIN 60

Query: 61 RQGGLDRFLSNSKKE 75
          + G LD  +  + ++
Sbjct: 61 KLG-LDAAIKMAAEK 74


>gi|260063513|ref|YP_003196593.1| 50S ribosomal protein L28 [Robiginitalea biformata HTCC2501]
 gi|88782957|gb|EAR14131.1| 50S ribosomal protein L28 [Robiginitalea biformata HTCC2501]
          Length = 78

 Score = 82.8 bits (204), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 29/75 (38%), Positives = 44/75 (58%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS+VCELT K    GN VS + NKTRRRF  NL +        ++   L++S  AL+++ 
Sbjct: 1  MSKVCELTGKRAQFGNNVSFSINKTRRRFDVNLSKKRFYIPEEDRWITLKVSARALKAIN 60

Query: 61 RQGGLDRFLSNSKKE 75
          R+G +   L  +K++
Sbjct: 61 RKG-ISAVLKEAKQK 74


>gi|325965085|ref|YP_004242991.1| 50S ribosomal protein L28P [Arthrobacter phenanthrenivorans
          Sphe3]
 gi|323471172|gb|ADX74857.1| LSU ribosomal protein L28P [Arthrobacter phenanthrenivorans
          Sphe3]
          Length = 78

 Score = 82.8 bits (204), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 14/63 (22%), Positives = 35/63 (55%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+  C++T      G+ +SH++ + +RRF PN+ +       + +   L++S   +++++
Sbjct: 1  MAAHCQVTGAEPGFGHSISHSHRRNKRRFDPNIQKKRYWVPSLRRNVTLQVSARGIKTID 60

Query: 61 RQG 63
           +G
Sbjct: 61 VRG 63


>gi|239945969|ref|ZP_04697906.1| putative 50S ribosomal protein L28 [Streptomyces roseosporus NRRL
          15998]
 gi|239992438|ref|ZP_04713102.1| putative 50S ribosomal protein L28 [Streptomyces roseosporus NRRL
          11379]
 gi|291449424|ref|ZP_06588814.1| 50S ribosomal protein L28 [Streptomyces roseosporus NRRL 15998]
 gi|291352371|gb|EFE79275.1| 50S ribosomal protein L28 [Streptomyces roseosporus NRRL 15998]
          Length = 78

 Score = 82.8 bits (204), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 23/63 (36%), Positives = 36/63 (57%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS  C+LT      GNK+SH++++T RRF PN+ R         +  +L +S  A+R+V+
Sbjct: 1  MSAHCQLTGSKPGFGNKISHSHHRTSRRFDPNIQRKRYWLPGEGRYVRLTLSVRAIRTVD 60

Query: 61 RQG 63
            G
Sbjct: 61 SIG 63


>gi|227487783|ref|ZP_03918099.1| 50S ribosomal protein L28 [Corynebacterium glucuronolyticum ATCC
          51867]
 gi|227542424|ref|ZP_03972473.1| 50S ribosomal protein L28 [Corynebacterium glucuronolyticum ATCC
          51866]
 gi|227092285|gb|EEI27597.1| 50S ribosomal protein L28 [Corynebacterium glucuronolyticum ATCC
          51867]
 gi|227181622|gb|EEI62594.1| 50S ribosomal protein L28 [Corynebacterium glucuronolyticum ATCC
          51866]
          Length = 78

 Score = 82.8 bits (204), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 19/75 (25%), Positives = 38/75 (50%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS +C++T +    G  VSH++ +T RR+ PN+ R         +   L +S   L+ ++
Sbjct: 1  MSAICQVTGRKPGFGKSVSHSHRRTNRRWNPNIQRRKFYLPSEGRTITLNVSTKGLKVID 60

Query: 61 RQGGLDRFLSNSKKE 75
          R G ++  ++  +  
Sbjct: 61 RDG-IEAVVARIRAR 74


>gi|170097237|ref|XP_001879838.1| predicted protein [Laccaria bicolor S238N-H82]
 gi|164645241|gb|EDR09489.1| predicted protein [Laccaria bicolor S238N-H82]
          Length = 192

 Score = 82.8 bits (204), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 20/77 (25%), Positives = 42/77 (54%)

Query: 9   KKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRF 68
            K    GN V  + +K+RR +LPN+ +  + S  +    +++++  AL+++++ GGLD++
Sbjct: 28  GKNKQYGNNVPFSKHKSRRTWLPNVQQKRIPSATLGMPIRVKLTTRALKTIKKHGGLDKY 87

Query: 69  LSNSKKENLSARMRTLR 85
           +  +    L      LR
Sbjct: 88  VEKTPAVLLGHEGMRLR 104


>gi|116672463|ref|YP_833396.1| 50S ribosomal protein L28 [Arthrobacter sp. FB24]
 gi|166226539|sp|A0K1X6|RL28_ARTS2 RecName: Full=50S ribosomal protein L28
 gi|116612572|gb|ABK05296.1| LSU ribosomal protein L28P [Arthrobacter sp. FB24]
          Length = 78

 Score = 82.8 bits (204), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 14/63 (22%), Positives = 35/63 (55%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+  C++T      G+ +SH++ + +RRF PN+ +       + +   L++S   +++++
Sbjct: 1  MAAHCQVTGAEPGFGHSISHSHRRNKRRFDPNIQKKRYWVPSLRRNVTLQVSARGIKTID 60

Query: 61 RQG 63
           +G
Sbjct: 61 VRG 63


>gi|328886753|emb|CCA59992.1| LSU ribosomal protein L28p [Streptomyces venezuelae ATCC 10712]
          Length = 78

 Score = 82.4 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 18/63 (28%), Positives = 33/63 (52%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS  C+LT      G+ +SH++ ++ RRF PN+           +  +L +S  A+++V+
Sbjct: 1  MSAHCQLTGAKPGFGHTISHSHRRSPRRFDPNIQHKRYWLPSEGRHVRLTLSARAIKTVD 60

Query: 61 RQG 63
            G
Sbjct: 61 AIG 63


>gi|320167558|gb|EFW44457.1| hypothetical protein CAOG_02482 [Capsaspora owczarzaki ATCC 30864]
          Length = 640

 Score = 82.4 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 26/84 (30%), Positives = 51/84 (60%), Gaps = 1/84 (1%)

Query: 9   KKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRF 68
              +  GN++SH++ KTRRR+LPN+   T    ++++  +L  +  A R+++  GG++R+
Sbjct: 24  GVRIGYGNQISHSHRKTRRRWLPNVHLRTPYLSLLDKHVRLNTTSKATRTIDLAGGIERY 83

Query: 69  LSN-SKKENLSARMRTLRSQILKK 91
           L N + +   S R   LR+Q+ ++
Sbjct: 84  LLNLNPERVASKRGDELRAQLRQR 107


>gi|326336203|ref|ZP_08202375.1| 50S ribosomal protein L28 [Capnocytophaga sp. oral taxon 338 str.
          F0234]
 gi|325691712|gb|EGD33679.1| 50S ribosomal protein L28 [Capnocytophaga sp. oral taxon 338 str.
          F0234]
          Length = 100

 Score = 82.4 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 29/75 (38%), Positives = 45/75 (60%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M++VCELT K  M GN VSHA NKT+R+F  NL          ++   LR+S  A++++ 
Sbjct: 23 MAQVCELTGKKAMGGNNVSHAMNKTKRKFKANLTTKRFYIPEEDRWITLRVSTSAIKTIN 82

Query: 61 RQGGLDRFLSNSKKE 75
          ++G +   L  +KK+
Sbjct: 83 KKG-ITAVLKEAKKQ 96


>gi|288924981|ref|ZP_06418917.1| 50S ribosomal protein L28 [Prevotella buccae D17]
 gi|315608015|ref|ZP_07883008.1| 50S ribosomal protein L28 [Prevotella buccae ATCC 33574]
 gi|288338171|gb|EFC76521.1| 50S ribosomal protein L28 [Prevotella buccae D17]
 gi|315250484|gb|EFU30480.1| 50S ribosomal protein L28 [Prevotella buccae ATCC 33574]
          Length = 94

 Score = 82.4 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 25/95 (26%), Positives = 44/95 (46%), Gaps = 1/95 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS+VC++T K    G  VSH+ ++T+R F  NL               L+IS   LR + 
Sbjct: 1  MSKVCQITGKKAQIGCNVSHSKHRTKRSFDVNLFSKKFFWVEENCWITLKISAAGLRLIN 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEK 95
          + G LD  +  +  +   + ++ +      K++E 
Sbjct: 61 KIG-LDAAIKQAVAKGYLSEIKVIAEANSAKVAEA 94


>gi|332521173|ref|ZP_08397631.1| ribosomal protein L28 [Lacinutrix algicola 5H-3-7-4]
 gi|332043266|gb|EGI79463.1| ribosomal protein L28 [Lacinutrix algicola 5H-3-7-4]
          Length = 78

 Score = 82.4 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 29/75 (38%), Positives = 45/75 (60%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVCELT K  M GN VSHA NKT+R+F  NL +        ++   L++S  AL+++ 
Sbjct: 1  MSRVCELTGKKAMVGNNVSHAMNKTKRKFNANLIKKRFFLPEEDKWITLKVSTSALKTIN 60

Query: 61 RQGGLDRFLSNSKKE 75
          + G +   L +++ +
Sbjct: 61 KIG-IAAALKDARAK 74


>gi|296128027|ref|YP_003635277.1| ribosomal protein L28 [Cellulomonas flavigena DSM 20109]
 gi|296019842|gb|ADG73078.1| ribosomal protein L28 [Cellulomonas flavigena DSM 20109]
          Length = 78

 Score = 82.4 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 20/63 (31%), Positives = 35/63 (55%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS  C++  K    G  VSH+  +T RRF+PN+ R       + +  +LR+S   ++ ++
Sbjct: 1  MSNHCQVLGKAPTFGRTVSHSGRRTPRRFVPNIQRRRYWVPSLGRHVRLRVSTDGIKVID 60

Query: 61 RQG 63
          R+G
Sbjct: 61 RRG 63


>gi|302562726|ref|ZP_07315068.1| ribosomal protein L28 [Streptomyces griseoflavus Tu4000]
 gi|302480344|gb|EFL43437.1| ribosomal protein L28 [Streptomyces griseoflavus Tu4000]
          Length = 78

 Score = 82.4 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 21/63 (33%), Positives = 34/63 (53%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS  C+LT      GN +SH++ +T RRF PN+ R         +  +L +S  A+++V+
Sbjct: 1  MSAHCQLTGAQPGFGNTISHSHRRTSRRFDPNIQRKRYWLPSEGRHVRLTLSAKAIKTVD 60

Query: 61 RQG 63
            G
Sbjct: 61 SIG 63


>gi|260912087|ref|ZP_05918645.1| 50S ribosomal protein L28 [Prevotella sp. oral taxon 472 str.
          F0295]
 gi|288928193|ref|ZP_06422040.1| 50S ribosomal protein L28 [Prevotella sp. oral taxon 317 str.
          F0108]
 gi|260633785|gb|EEX51917.1| 50S ribosomal protein L28 [Prevotella sp. oral taxon 472 str.
          F0295]
 gi|288331027|gb|EFC69611.1| 50S ribosomal protein L28 [Prevotella sp. oral taxon 317 str.
          F0108]
          Length = 87

 Score = 82.4 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 25/75 (33%), Positives = 38/75 (50%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS++C++T K  M GN VSH+ ++T+R F  NL               L+IS   LR + 
Sbjct: 1  MSKICQITGKKAMVGNNVSHSKHRTKRSFDVNLFSKKFYYVEEGCWISLKISAAGLRLIN 60

Query: 61 RQGGLDRFLSNSKKE 75
          + G LD  L  +  +
Sbjct: 61 KVG-LDAALKQAVSK 74


>gi|149371253|ref|ZP_01890739.1| 50S ribosomal protein L28 [unidentified eubacterium SCB49]
 gi|149355391|gb|EDM43950.1| 50S ribosomal protein L28 [unidentified eubacterium SCB49]
          Length = 79

 Score = 82.4 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 29/75 (38%), Positives = 44/75 (58%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVCELT K  M GN VSHA NKT+R+F  NL +        ++   LR+S  AL+++ 
Sbjct: 1  MSRVCELTGKKAMVGNNVSHAMNKTKRKFNVNLMKKRFYIPEEDKWITLRVSTSALKNIN 60

Query: 61 RQGGLDRFLSNSKKE 75
          ++G +   +  ++  
Sbjct: 61 KKG-ISAVIKEARAN 74


>gi|163848340|ref|YP_001636384.1| 50S ribosomal protein L28 [Chloroflexus aurantiacus J-10-fl]
 gi|222526259|ref|YP_002570730.1| 50S ribosomal protein L28 [Chloroflexus sp. Y-400-fl]
 gi|163669629|gb|ABY35995.1| ribosomal protein L28 [Chloroflexus aurantiacus J-10-fl]
 gi|222450138|gb|ACM54404.1| ribosomal protein L28 [Chloroflexus sp. Y-400-fl]
          Length = 84

 Score = 82.4 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 28/85 (32%), Positives = 46/85 (54%), Gaps = 9/85 (10%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR C+LT ++   G  VS +  +T RR+LPN+ +  +     ++  +L++S  ALR +E
Sbjct: 1  MSRRCDLTGRSPSFGYNVSFSKRRTNRRWLPNVQKRRIWVPEEQRFVRLKLSAAALREIE 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTLR 85
          R+G     L  +    L  R  TL+
Sbjct: 61 RKG-----LLQA----LRDRGLTLK 76


>gi|300932567|ref|ZP_07147823.1| 50S ribosomal protein L28 [Corynebacterium resistens DSM 45100]
          Length = 78

 Score = 82.4 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 19/75 (25%), Positives = 39/75 (52%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS  C++T +    G  VSH++ +T RR+ PN+ R +       +   L +S   L++++
Sbjct: 1  MSAHCQVTGREPKFGKTVSHSHRRTSRRWNPNIQRRSFYLPSEGRTITLNVSTKGLKTID 60

Query: 61 RQGGLDRFLSNSKKE 75
          R G ++  ++  +  
Sbjct: 61 RDG-IESVVAKIRAR 74


>gi|313793640|gb|EFS41671.1| ribosomal protein L28 [Propionibacterium acnes HL110PA1]
 gi|327455973|gb|EGF02628.1| ribosomal protein L28 [Propionibacterium acnes HL092PA1]
          Length = 78

 Score = 82.4 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 19/63 (30%), Positives = 35/63 (55%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR C++       GN VSH+   T+RR+ PN+ +       + +K  L ++  A++ ++
Sbjct: 1  MSRRCQVRGTKPEFGNNVSHSQRHTKRRWNPNIQKKRYWVPSLGRKVTLTLTPQAIKEID 60

Query: 61 RQG 63
          R+G
Sbjct: 61 RRG 63


>gi|282878495|ref|ZP_06287278.1| ribosomal protein L28 [Prevotella buccalis ATCC 35310]
 gi|281299383|gb|EFA91769.1| ribosomal protein L28 [Prevotella buccalis ATCC 35310]
          Length = 87

 Score = 82.4 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 24/72 (33%), Positives = 36/72 (50%), Gaps = 1/72 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS++C++T K    GN VSH+ ++T+R F  NL               L+IS   LR + 
Sbjct: 1  MSKICQITGKKAQIGNNVSHSKHRTKRSFDVNLFSKKFYYVEEGCWISLKISAAGLRLIN 60

Query: 61 RQGGLDRFLSNS 72
          + G LD  L  +
Sbjct: 61 KVG-LDAALKKA 71


>gi|163841607|ref|YP_001626012.1| 50S ribosomal protein L28P [Renibacterium salmoninarum ATCC 33209]
 gi|162955083|gb|ABY24598.1| LSU ribosomal protein L28P [Renibacterium salmoninarum ATCC 33209]
          Length = 114

 Score = 82.4 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 15/69 (21%), Positives = 38/69 (55%), Gaps = 1/69 (1%)

Query: 1   MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
           M+  C++T      G+ +SH++ + +RRF PN+ +       + +   L++S   +++++
Sbjct: 37  MAAHCQVTGAEPGFGHSISHSHRRNKRRFDPNIQKKRYWVPSLRRNVTLQVSARGIKTID 96

Query: 61  RQGGLDRFL 69
            +G +D  +
Sbjct: 97  VRG-IDAVV 104


>gi|313159483|gb|EFR58846.1| ribosomal protein L28 [Alistipes sp. HGB5]
          Length = 77

 Score = 82.0 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 21/61 (34%), Positives = 39/61 (63%)

Query: 3  RVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQ 62
          +VCE+T K  + GN VSH+++KT+R+F PNL      S+   +   L++S   ++++ ++
Sbjct: 2  KVCEITGKVAIVGNNVSHSHHKTKRKFSPNLKTKRFWSEQEGRWITLKVSAAGMKTINKK 61

Query: 63 G 63
          G
Sbjct: 62 G 62


>gi|255327425|ref|ZP_05368499.1| ribosomal protein L28 [Rothia mucilaginosa ATCC 25296]
 gi|283458733|ref|YP_003363371.1| 50S ribosomal protein L28 [Rothia mucilaginosa DY-18]
 gi|300743694|ref|ZP_07072714.1| ribosomal protein L28 [Rothia dentocariosa M567]
 gi|311112945|ref|YP_003984167.1| 50S ribosomal protein L28 [Rothia dentocariosa ATCC 17931]
 gi|255295705|gb|EET75048.1| ribosomal protein L28 [Rothia mucilaginosa ATCC 25296]
 gi|283134786|dbj|BAI65551.1| ribosomal protein L28 [Rothia mucilaginosa DY-18]
 gi|300380055|gb|EFJ76618.1| ribosomal protein L28 [Rothia dentocariosa M567]
 gi|310944439|gb|ADP40733.1| 50S ribosomal protein L28 [Rothia dentocariosa ATCC 17931]
          Length = 78

 Score = 82.0 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 18/71 (25%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+ VC++T      G+ +SH++ + +RRF PN+ + T     + +K  L +S   ++ ++
Sbjct: 1  MAAVCQVTGAVPGFGHSISHSHRRNKRRFDPNVQKKTYWVPSLRRKVTLNVSAKGIKVID 60

Query: 61 RQGGLDRFLSN 71
           +G +D  ++ 
Sbjct: 61 ARG-IDAVVAE 70


>gi|300776246|ref|ZP_07086104.1| 50S ribosomal protein L28 [Chryseobacterium gleum ATCC 35910]
 gi|300501756|gb|EFK32896.1| 50S ribosomal protein L28 [Chryseobacterium gleum ATCC 35910]
          Length = 80

 Score = 82.0 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 27/63 (42%), Positives = 37/63 (58%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR+C++T K  M GN VSHANNKT+RRF  NL          ++   L++S   LR + 
Sbjct: 1  MSRICQITGKRAMVGNNVSHANNKTKRRFEINLLEKKFYLPEQDKHVTLKVSAHGLRVIN 60

Query: 61 RQG 63
          + G
Sbjct: 61 KIG 63


>gi|254796704|ref|YP_003081540.1| ribosomal protein L28 [Neorickettsia risticii str. Illinois]
 gi|254589934|gb|ACT69296.1| ribosomal protein L28 [Neorickettsia risticii str. Illinois]
          Length = 86

 Score = 82.0 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 36/76 (47%), Positives = 57/76 (75%)

Query: 18 VSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFLSNSKKENL 77
          VSH+N KT++RF+PNL RIT+ SD+++QK++ ++S   +R+V+ +GGLD FL N+K   L
Sbjct: 2  VSHSNRKTKKRFMPNLQRITVFSDVLKQKFRFKVSAKTIRTVDFKGGLDDFLRNTKNSKL 61

Query: 78 SARMRTLRSQILKKMS 93
          S     L+ +I+KK+S
Sbjct: 62 SKSALALKKRIMKKVS 77


>gi|333030358|ref|ZP_08458419.1| 50S ribosomal protein L28 [Bacteroides coprosuis DSM 18011]
 gi|332740955|gb|EGJ71437.1| 50S ribosomal protein L28 [Bacteroides coprosuis DSM 18011]
          Length = 86

 Score = 82.0 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 24/75 (32%), Positives = 37/75 (49%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS++C++T K  M GN VSH+  +T++ F  NL               L IS   LR++ 
Sbjct: 1  MSKICQITGKKAMVGNNVSHSKRRTKKTFDVNLFNKKFYYVEQGCWISLSISAAGLRTIN 60

Query: 61 RQGGLDRFLSNSKKE 75
          + G LD  L  +  +
Sbjct: 61 KIG-LDAALHEAVDK 74


>gi|330995105|ref|ZP_08319022.1| ribosomal protein L28 [Paraprevotella xylaniphila YIT 11841]
 gi|329576681|gb|EGG58184.1| ribosomal protein L28 [Paraprevotella xylaniphila YIT 11841]
          Length = 86

 Score = 82.0 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 27/75 (36%), Positives = 42/75 (56%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS++C++T K  M GN VSH+  +T+RRF  NL          +    L+IS   LR + 
Sbjct: 1  MSKICQITGKKAMVGNNVSHSKRRTKRRFDVNLFTKKFYYVEQDCWISLKISAAGLRYIN 60

Query: 61 RQGGLDRFLSNSKKE 75
          + G LD  L+N+ ++
Sbjct: 61 KVG-LDAALANAVEK 74


>gi|50843596|ref|YP_056823.1| 50S ribosomal protein L28 [Propionibacterium acnes KPA171202]
 gi|282854930|ref|ZP_06264264.1| ribosomal protein L28 [Propionibacterium acnes J139]
 gi|289426052|ref|ZP_06427799.1| ribosomal protein L28 [Propionibacterium acnes SK187]
 gi|295131679|ref|YP_003582342.1| ribosomal protein L28 [Propionibacterium acnes SK137]
 gi|67461385|sp|Q6A5U8|RL28_PROAC RecName: Full=50S ribosomal protein L28
 gi|50841198|gb|AAT83865.1| 50S ribosomal protein L28 [Propionibacterium acnes KPA171202]
 gi|282582076|gb|EFB87459.1| ribosomal protein L28 [Propionibacterium acnes J139]
 gi|289153595|gb|EFD02309.1| ribosomal protein L28 [Propionibacterium acnes SK187]
 gi|291376781|gb|ADE00636.1| ribosomal protein L28 [Propionibacterium acnes SK137]
 gi|313765615|gb|EFS36979.1| ribosomal protein L28 [Propionibacterium acnes HL013PA1]
 gi|313771824|gb|EFS37790.1| ribosomal protein L28 [Propionibacterium acnes HL074PA1]
 gi|313802950|gb|EFS44161.1| ribosomal protein L28 [Propionibacterium acnes HL110PA2]
 gi|313810684|gb|EFS48398.1| ribosomal protein L28 [Propionibacterium acnes HL083PA1]
 gi|313813722|gb|EFS51436.1| ribosomal protein L28 [Propionibacterium acnes HL025PA1]
 gi|313816596|gb|EFS54310.1| ribosomal protein L28 [Propionibacterium acnes HL059PA1]
 gi|313829673|gb|EFS67387.1| ribosomal protein L28 [Propionibacterium acnes HL063PA2]
 gi|313831494|gb|EFS69208.1| ribosomal protein L28 [Propionibacterium acnes HL007PA1]
 gi|313833456|gb|EFS71170.1| ribosomal protein L28 [Propionibacterium acnes HL056PA1]
 gi|313839416|gb|EFS77130.1| ribosomal protein L28 [Propionibacterium acnes HL086PA1]
 gi|314916637|gb|EFS80468.1| ribosomal protein L28 [Propionibacterium acnes HL005PA4]
 gi|314918904|gb|EFS82735.1| ribosomal protein L28 [Propionibacterium acnes HL050PA1]
 gi|314920915|gb|EFS84746.1| ribosomal protein L28 [Propionibacterium acnes HL050PA3]
 gi|314924411|gb|EFS88242.1| ribosomal protein L28 [Propionibacterium acnes HL001PA1]
 gi|314931407|gb|EFS95238.1| ribosomal protein L28 [Propionibacterium acnes HL067PA1]
 gi|314956634|gb|EFT00886.1| ribosomal protein L28 [Propionibacterium acnes HL027PA1]
 gi|314959514|gb|EFT03616.1| ribosomal protein L28 [Propionibacterium acnes HL002PA1]
 gi|314964710|gb|EFT08810.1| ribosomal protein L28 [Propionibacterium acnes HL082PA1]
 gi|314968886|gb|EFT12984.1| ribosomal protein L28 [Propionibacterium acnes HL037PA1]
 gi|314974811|gb|EFT18906.1| ribosomal protein L28 [Propionibacterium acnes HL053PA1]
 gi|314977862|gb|EFT21956.1| ribosomal protein L28 [Propionibacterium acnes HL045PA1]
 gi|314981661|gb|EFT25754.1| ribosomal protein L28 [Propionibacterium acnes HL110PA3]
 gi|314984728|gb|EFT28820.1| ribosomal protein L28 [Propionibacterium acnes HL005PA1]
 gi|315079353|gb|EFT51354.1| ribosomal protein L28 [Propionibacterium acnes HL053PA2]
 gi|315082404|gb|EFT54380.1| ribosomal protein L28 [Propionibacterium acnes HL078PA1]
 gi|315092300|gb|EFT64276.1| ribosomal protein L28 [Propionibacterium acnes HL110PA4]
 gi|315095631|gb|EFT67607.1| ribosomal protein L28 [Propionibacterium acnes HL038PA1]
 gi|315100282|gb|EFT72258.1| ribosomal protein L28 [Propionibacterium acnes HL059PA2]
 gi|315102421|gb|EFT74397.1| ribosomal protein L28 [Propionibacterium acnes HL046PA1]
 gi|315104670|gb|EFT76646.1| ribosomal protein L28 [Propionibacterium acnes HL050PA2]
 gi|315107723|gb|EFT79699.1| ribosomal protein L28 [Propionibacterium acnes HL030PA1]
 gi|327332918|gb|EGE74650.1| ribosomal protein L28 [Propionibacterium acnes HL096PA2]
 gi|327335323|gb|EGE77033.1| ribosomal protein L28 [Propionibacterium acnes HL097PA1]
 gi|327448621|gb|EGE95275.1| ribosomal protein L28 [Propionibacterium acnes HL043PA1]
 gi|327451152|gb|EGE97806.1| ribosomal protein L28 [Propionibacterium acnes HL043PA2]
 gi|327455738|gb|EGF02393.1| ribosomal protein L28 [Propionibacterium acnes HL087PA3]
 gi|327458087|gb|EGF04742.1| ribosomal protein L28 [Propionibacterium acnes HL083PA2]
 gi|328757247|gb|EGF70863.1| ribosomal protein L28 [Propionibacterium acnes HL087PA1]
 gi|328757633|gb|EGF71249.1| ribosomal protein L28 [Propionibacterium acnes HL025PA2]
 gi|328761968|gb|EGF75475.1| ribosomal protein L28 [Propionibacterium acnes HL099PA1]
          Length = 78

 Score = 82.0 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 19/63 (30%), Positives = 35/63 (55%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR C++       GN VSH+   T+RR+ PN+ +       + +K  L ++  A++ ++
Sbjct: 1  MSRRCQVRGTKPEFGNNVSHSQRHTKRRWNPNIQKKRYWVPSLGRKVTLTLTPKAIKEID 60

Query: 61 RQG 63
          R+G
Sbjct: 61 RRG 63


>gi|19552095|ref|NP_600097.1| 50S ribosomal protein L28 [Corynebacterium glutamicum ATCC 13032]
 gi|62389758|ref|YP_225160.1| 50S ribosomal protein L28 [Corynebacterium glutamicum ATCC 13032]
 gi|145295039|ref|YP_001137860.1| 50S ribosomal protein L28 [Corynebacterium glutamicum R]
 gi|23822039|sp|Q8NS15|RL28_CORGL RecName: Full=50S ribosomal protein L28
 gi|166226568|sp|A4QCL1|RL28_CORGB RecName: Full=50S ribosomal protein L28
 gi|21323635|dbj|BAB98262.1| Ribosomal protein L28 [Corynebacterium glutamicum ATCC 13032]
 gi|41325093|emb|CAF19574.1| 50S RIBOSOMAL PROTEIN L28 [Corynebacterium glutamicum ATCC 13032]
 gi|140844959|dbj|BAF53958.1| hypothetical protein [Corynebacterium glutamicum R]
          Length = 78

 Score = 82.0 bits (202), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 19/75 (25%), Positives = 37/75 (49%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS  C++T +    G  VSH++ +T RR+ PN+ R         +   L +S   L+ ++
Sbjct: 1  MSAHCQVTGRKPSFGKSVSHSHRRTSRRWNPNVQRRKFYVPSEGRTITLTVSTKGLKVID 60

Query: 61 RQGGLDRFLSNSKKE 75
          R G ++  ++  +  
Sbjct: 61 RDG-IEAVVAQIRAR 74


>gi|255536299|ref|YP_003096670.1| LSU ribosomal protein L28p [Flavobacteriaceae bacterium 3519-10]
 gi|255342495|gb|ACU08608.1| LSU ribosomal protein L28p [Flavobacteriaceae bacterium 3519-10]
          Length = 95

 Score = 82.0 bits (202), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 28/63 (44%), Positives = 37/63 (58%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR+C++T K  M GN VSHANNKT+RRF  NL          E+   L++S   LR + 
Sbjct: 15 MSRICQITGKRAMVGNNVSHANNKTKRRFEINLLEKKFYLPEQEKSVTLKVSAHGLRIIN 74

Query: 61 RQG 63
          + G
Sbjct: 75 KVG 77


>gi|326774850|ref|ZP_08234115.1| ribosomal protein L28 [Streptomyces cf. griseus XylebKG-1]
 gi|326655183|gb|EGE40029.1| ribosomal protein L28 [Streptomyces cf. griseus XylebKG-1]
          Length = 78

 Score = 82.0 bits (202), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 21/63 (33%), Positives = 33/63 (52%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS  C+L       GN +SH++ +T RRF PN+ R         +  +L +S  A+R+V+
Sbjct: 1  MSAHCQLAGSKPGFGNNISHSHRRTSRRFDPNVQRKRYWLPGEGRSVRLTLSARAIRTVD 60

Query: 61 RQG 63
            G
Sbjct: 61 SIG 63


>gi|325003295|ref|ZP_08124407.1| 50S ribosomal protein L28 [Pseudonocardia sp. P1]
          Length = 78

 Score = 82.0 bits (202), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 20/63 (31%), Positives = 34/63 (53%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR C+LT +    G  VSH++ +T RR+ PN+           +  +L +S   +++V+
Sbjct: 1  MSRRCDLTGREPSFGKAVSHSHRRTSRRWDPNVQSKRYWFADEGRWVRLSLSAKGIKTVD 60

Query: 61 RQG 63
          R G
Sbjct: 61 RIG 63


>gi|313140599|ref|ZP_07802792.1| 50S ribosomal protein L28-2 [Bifidobacterium bifidum NCIMB 41171]
 gi|313133109|gb|EFR50726.1| 50S ribosomal protein L28-2 [Bifidobacterium bifidum NCIMB 41171]
          Length = 98

 Score = 82.0 bits (202), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 21/63 (33%), Positives = 36/63 (57%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS+ C++      +GN+VSH++ KTRRRF PNL         + +   L +S   +++++
Sbjct: 1  MSKQCQILGTRASTGNRVSHSHRKTRRRFNPNLQTKRYWVPSLGRHVTLTVSVKGMKTID 60

Query: 61 RQG 63
          R G
Sbjct: 61 RIG 63


>gi|302868521|ref|YP_003837158.1| 50S ribosomal protein L28 [Micromonospora aurantiaca ATCC 27029]
 gi|302571380|gb|ADL47582.1| ribosomal protein L28 [Micromonospora aurantiaca ATCC 27029]
          Length = 78

 Score = 82.0 bits (202), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 23/63 (36%), Positives = 37/63 (58%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR C++T      GN VSH++ +TRRR+ PNL           +  +L ++  AL++V+
Sbjct: 1  MSRRCDVTGAKPSFGNAVSHSHRRTRRRWNPNLQNHRFWLPSERRWVRLNLTAKALKTVD 60

Query: 61 RQG 63
          R+G
Sbjct: 61 RKG 63


>gi|296118268|ref|ZP_06836849.1| ribosomal protein L28 [Corynebacterium ammoniagenes DSM 20306]
 gi|295968826|gb|EFG82070.1| ribosomal protein L28 [Corynebacterium ammoniagenes DSM 20306]
          Length = 78

 Score = 81.6 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 18/75 (24%), Positives = 39/75 (52%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS +C++T +    G +VSH++ +T RR+ PN+ R         +   L +S   ++ ++
Sbjct: 1  MSAICQVTGREPSFGKQVSHSHRRTSRRWNPNVQRRRYYLPSEGRTITLNVSTKGIKIID 60

Query: 61 RQGGLDRFLSNSKKE 75
          R G ++  ++  +  
Sbjct: 61 RDG-IESVVAKIRAR 74


>gi|295835223|ref|ZP_06822156.1| ribosomal protein L28 [Streptomyces sp. SPB74]
 gi|197698184|gb|EDY45117.1| ribosomal protein L28 [Streptomyces sp. SPB74]
          Length = 78

 Score = 81.6 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 22/63 (34%), Positives = 34/63 (53%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS  C+LT      GNKVSH++ +T RRF PN+ R         +  +L +S   +++V+
Sbjct: 1  MSAHCQLTGSKPAFGNKVSHSHRRTPRRFDPNIQRKRYWLPSEGRYVRLVLSAKGIKTVD 60

Query: 61 RQG 63
            G
Sbjct: 61 AIG 63


>gi|238882178|gb|EEQ45816.1| conserved hypothetical protein [Candida albicans WO-1]
          Length = 265

 Score = 81.6 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 22/81 (27%), Positives = 45/81 (55%), Gaps = 3/81 (3%)

Query: 19  SHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFLSN---SKKE 75
           S   NKT R   PN     L S+ + ++ +LR++   L+++ ++GGLD++L     ++ +
Sbjct: 104 SEYLNKTLRAHRPNAQWTKLWSETLNRRLRLRVATRVLKTISKEGGLDQYLLKSTPARVK 163

Query: 76  NLSARMRTLRSQILKKMSEKS 96
            +  +   LR +IL++  +K 
Sbjct: 164 TMGLKAWQLRYRILQEREQKQ 184


>gi|332879563|ref|ZP_08447258.1| ribosomal protein L28 [Capnocytophaga sp. oral taxon 329 str.
          F0087]
 gi|332682529|gb|EGJ55431.1| ribosomal protein L28 [Capnocytophaga sp. oral taxon 329 str.
          F0087]
          Length = 86

 Score = 81.6 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 26/75 (34%), Positives = 40/75 (53%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS++C++T K  M GN VSH+  +T+RRF  NL          +    L IS   LR + 
Sbjct: 1  MSKICQITGKKAMVGNNVSHSKRRTKRRFNVNLFTKKFYYVEQDCWISLNISAAGLRYIN 60

Query: 61 RQGGLDRFLSNSKKE 75
          + G LD  L+++  +
Sbjct: 61 KVG-LDAALASAVAK 74


>gi|282880709|ref|ZP_06289411.1| ribosomal protein L28 [Prevotella timonensis CRIS 5C-B1]
 gi|281305435|gb|EFA97493.1| ribosomal protein L28 [Prevotella timonensis CRIS 5C-B1]
          Length = 87

 Score = 81.6 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 24/75 (32%), Positives = 37/75 (49%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS++C++T K    GN VSH+ ++T+R F  NL               L+IS   LR + 
Sbjct: 1  MSKICQITGKKAQIGNNVSHSKHRTKRSFDVNLFSKKFYYVEEGCWISLKISAAGLRLIN 60

Query: 61 RQGGLDRFLSNSKKE 75
          + G LD  L  +  +
Sbjct: 61 KVG-LDAALKQAVSK 74


>gi|188579179|ref|YP_001916108.1| ribosomal protein L28 [Xanthomonas oryzae pv. oryzae PXO99A]
 gi|188523631|gb|ACD61576.1| ribosomal protein L28 [Xanthomonas oryzae pv. oryzae PXO99A]
          Length = 72

 Score = 81.6 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 31/76 (40%), Positives = 43/76 (56%), Gaps = 6/76 (7%)

Query: 9  KKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRF 68
           K V +GN VSHANN+TRRRFLPNL           +  +LR+S  ALR++++ G +D  
Sbjct: 3  GKRVQTGNNVSHANNRTRRRFLPNLHERRFWVASENRWVKLRVSAHALRTIDKNG-IDAV 61

Query: 69 LSNSKKENLSARMRTL 84
          L     + L AR   +
Sbjct: 62 L-----KELRARGEKV 72


>gi|228474070|ref|ZP_04058811.1| ribosomal protein L28 [Capnocytophaga gingivalis ATCC 33624]
 gi|228274584|gb|EEK13425.1| ribosomal protein L28 [Capnocytophaga gingivalis ATCC 33624]
          Length = 78

 Score = 81.6 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 29/75 (38%), Positives = 45/75 (60%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M++VCELT K  M GN VSHA NKT+R+F  NL          ++   LR+S  A++++ 
Sbjct: 1  MAQVCELTGKKAMGGNNVSHAMNKTKRKFKVNLTTKRFYIPEEDRWITLRVSTNAIKTIN 60

Query: 61 RQGGLDRFLSNSKKE 75
          ++G +   L  +KK+
Sbjct: 61 KKG-ISAVLKEAKKQ 74


>gi|161353680|ref|NP_627635.2| 50S ribosomal protein L28 [Streptomyces coelicolor A3(2)]
 gi|14195690|sp|Q9X8K8|RL28B_STRCO RecName: Full=50S ribosomal protein L28-2
          Length = 78

 Score = 81.6 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 21/63 (33%), Positives = 33/63 (52%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS  C LT      GN++SH++ +T RRF PN+           +  +LR+S   +R+V+
Sbjct: 1  MSAHCMLTGARPGFGNRISHSHRRTSRRFDPNIQTKRYWLPSENRHVRLRLSTKGIRTVD 60

Query: 61 RQG 63
            G
Sbjct: 61 SIG 63


>gi|313206700|ref|YP_004045877.1| LSU ribosomal protein l28p [Riemerella anatipestifer DSM 15868]
 gi|312446016|gb|ADQ82371.1| LSU ribosomal protein L28P [Riemerella anatipestifer DSM 15868]
 gi|315023767|gb|EFT36769.1| LSU ribosomal protein L28p [Riemerella anatipestifer RA-YM]
          Length = 78

 Score = 81.6 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 28/63 (44%), Positives = 37/63 (58%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR+C++T K  M GN VSHANNKT+RRF  NL          E+   L++S   LR + 
Sbjct: 1  MSRICQITGKRAMVGNHVSHANNKTKRRFEINLLEKKFYLPEQEKHITLKVSAHGLRVIN 60

Query: 61 RQG 63
          + G
Sbjct: 61 KIG 63


>gi|94676711|ref|YP_588640.1| ribosomal protein L28 [Baumannia cicadellinicola str. Hc
          (Homalodisca coagulata)]
 gi|166226545|sp|Q1LTS4|RL28_BAUCH RecName: Full=50S ribosomal protein L28
 gi|94219861|gb|ABF14020.1| ribosomal protein L28 [Baumannia cicadellinicola str. Hc
          (Homalodisca coagulata)]
          Length = 75

 Score = 81.6 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 24/63 (38%), Positives = 40/63 (63%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR C++T K  +SGN  S+A N T+RRFLPNL       +  ++  ++R+S   +R ++
Sbjct: 1  MSRFCQVTGKRSVSGNNRSYAMNATKRRFLPNLHFHRFWIEAEKRFIKIRVSAKGMRVID 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|54026949|ref|YP_121191.1| 50S ribosomal protein L28 [Nocardia farcinica IFM 10152]
 gi|67461561|sp|Q5YPR4|RL282_NOCFA RecName: Full=50S ribosomal protein L28 2
 gi|54018457|dbj|BAD59827.1| putative ribosomal protein L28 [Nocardia farcinica IFM 10152]
          Length = 78

 Score = 81.6 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 22/84 (26%), Positives = 40/84 (47%), Gaps = 6/84 (7%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS  C++T +    G  VSH++ +T RR+ PN+ R T       ++  L +S   +++++
Sbjct: 1  MSAHCQVTGRKPGFGKSVSHSHVRTNRRWDPNIQRKTYYLPSEGRRITLTVSAKGIKTID 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTL 84
          R G        +    L AR   +
Sbjct: 61 RDG------IEAVVARLRARGEKI 78


>gi|167753007|ref|ZP_02425134.1| hypothetical protein ALIPUT_01271 [Alistipes putredinis DSM
          17216]
 gi|167659321|gb|EDS03451.1| hypothetical protein ALIPUT_01271 [Alistipes putredinis DSM
          17216]
          Length = 77

 Score = 81.6 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 21/61 (34%), Positives = 39/61 (63%)

Query: 3  RVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQ 62
          +VCE+T K  + GN VSH+++KT+R+F PNL      S+   +   L++S   ++++ ++
Sbjct: 2  KVCEITGKVAVIGNNVSHSHHKTKRKFSPNLKNKRFWSEEEGRWITLKVSAAGIKTINKK 61

Query: 63 G 63
          G
Sbjct: 62 G 62


>gi|89076359|ref|ZP_01162692.1| putative ribosomal protein L28 [Photobacterium sp. SKA34]
 gi|89047930|gb|EAR53521.1| putative ribosomal protein L28 [Photobacterium sp. SKA34]
          Length = 75

 Score = 81.6 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 25/72 (34%), Positives = 42/72 (58%), Gaps = 1/72 (1%)

Query: 4  VCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQG 63
          VC++T K  ++GN  SHA N T+RRFLPNL       +  ++  +LR+S   +R ++++G
Sbjct: 1  VCQVTGKRPVTGNNRSHARNATKRRFLPNLQTHRFWVESEKRFVKLRLSAKGMRIIDKKG 60

Query: 64 GLDRFLSNSKKE 75
           +D  L   +  
Sbjct: 61 -IDVVLGEMRAR 71


>gi|68469645|ref|XP_721074.1| likely mitochondrial ribosomal protein (E. coli L28) [Candida
           albicans SC5314]
 gi|68469884|ref|XP_720952.1| likely mitochondrial ribosomal protein (E. coli L28) [Candida
           albicans SC5314]
 gi|46442846|gb|EAL02132.1| likely mitochondrial ribosomal protein (E. coli L28) [Candida
           albicans SC5314]
 gi|46442975|gb|EAL02260.1| likely mitochondrial ribosomal protein (E. coli L28) [Candida
           albicans SC5314]
          Length = 265

 Score = 81.6 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 22/81 (27%), Positives = 45/81 (55%), Gaps = 3/81 (3%)

Query: 19  SHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFLSN---SKKE 75
           S   NKT R   PN     L S+ + ++ +LR++   L+++ ++GGLD++L     ++ +
Sbjct: 104 SEYLNKTLRAHRPNAQWTKLWSETLNRRLRLRVATRVLKTISKEGGLDQYLLKSTPARVK 163

Query: 76  NLSARMRTLRSQILKKMSEKS 96
            +  +   LR +IL++  +K 
Sbjct: 164 TMGLKAWQLRYRILQEREQKQ 184


>gi|227504195|ref|ZP_03934244.1| 50S ribosomal protein L28 [Corynebacterium striatum ATCC 6940]
 gi|227199239|gb|EEI79287.1| 50S ribosomal protein L28 [Corynebacterium striatum ATCC 6940]
          Length = 78

 Score = 81.6 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 18/75 (24%), Positives = 39/75 (52%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS +C++T +    G +VSH++ +T RR+ PN+ R         +   L +S   ++ ++
Sbjct: 1  MSAICQVTGRKPEFGKQVSHSHRRTSRRWNPNVQRRRYYLPSEGRTITLNVSTKGIKIID 60

Query: 61 RQGGLDRFLSNSKKE 75
          R G ++  ++  +  
Sbjct: 61 RDG-IESVVAKIRAR 74


>gi|293339967|ref|XP_001061401.2| PREDICTED: mitochondrial ribosomal protein L28-like [Rattus
           norvegicus]
 gi|293351387|ref|XP_573060.3| PREDICTED: mitochondrial ribosomal protein L28 [Rattus norvegicus]
 gi|149052177|gb|EDM03994.1| similar to 39S ribosomal protein L28, mitochondrial precursor
           (L28mt) (MRP-L28) [Rattus norvegicus]
          Length = 257

 Score = 81.6 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 16/93 (17%), Positives = 48/93 (51%), Gaps = 4/93 (4%)

Query: 7   LTKKTVMSGNKVSHAN---NKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQG 63
              + ++ G + ++ +   N+ ++ + P L    L S+I+++K+ + ++   L  ++   
Sbjct: 80  WGGEGLILGYRYANNDKLSNRVKKVWKPQLFTRELYSEILDKKFTVTVTMRTLDLIDEAY 139

Query: 64  GLDRFLSNSKKENL-SARMRTLRSQILKKMSEK 95
           G D ++  + +E+L S     L+  +L +++ +
Sbjct: 140 GFDFYILKTPEEDLCSKFGMDLKRGMLLRLARQ 172


>gi|256786964|ref|ZP_05525395.1| 50S ribosomal protein L28 [Streptomyces lividans TK24]
 gi|289770857|ref|ZP_06530235.1| 50S ribosomal protein L28 [Streptomyces lividans TK24]
 gi|289701056|gb|EFD68485.1| 50S ribosomal protein L28 [Streptomyces lividans TK24]
          Length = 78

 Score = 81.6 bits (201), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 21/63 (33%), Positives = 33/63 (52%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS  C LT      GN++SH++ +T RRF PN+           +  +LR+S   +R+V+
Sbjct: 1  MSAHCMLTGARPGFGNRISHSHRRTSRRFDPNIQTRRYWLPSENRHVRLRLSTKGIRTVD 60

Query: 61 RQG 63
            G
Sbjct: 61 SIG 63


>gi|293606876|ref|ZP_06689224.1| 50S ribosomal protein L28 [Achromobacter piechaudii ATCC 43553]
 gi|292814728|gb|EFF73861.1| 50S ribosomal protein L28 [Achromobacter piechaudii ATCC 43553]
          Length = 66

 Score = 81.6 bits (201), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 26/63 (41%), Positives = 39/63 (61%), Gaps = 1/63 (1%)

Query: 13 MSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFLSNS 72
          M GN VSHANNKT+RRFLPNL       +   +  +LR+S  A+R++++ G +D  L+  
Sbjct: 1  MVGNNVSHANNKTKRRFLPNLQSRRFWVESENRWVRLRVSAKAIRTIDKNG-IDAVLAEM 59

Query: 73 KKE 75
          +  
Sbjct: 60 RAR 62


>gi|25027499|ref|NP_737553.1| 50S ribosomal protein L28 [Corynebacterium efficiens YS-314]
 gi|67461532|sp|Q8FR24|RL28_COREF RecName: Full=50S ribosomal protein L28
 gi|23492781|dbj|BAC17753.1| putative 50S ribosomal protein L28 [Corynebacterium efficiens
          YS-314]
          Length = 78

 Score = 81.6 bits (201), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 20/75 (26%), Positives = 38/75 (50%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS  C++T +    G  VSH++ +T RR+ PN+ R       M +   L +S   L+ ++
Sbjct: 1  MSAHCQVTGRQPSFGKSVSHSHRRTSRRWNPNVQRRKFFVPSMGRTITLTVSTKGLKVID 60

Query: 61 RQGGLDRFLSNSKKE 75
          R G ++  ++  +  
Sbjct: 61 RDG-IEAVVAQIRAR 74


>gi|224024939|ref|ZP_03643305.1| hypothetical protein BACCOPRO_01670 [Bacteroides coprophilus DSM
          18228]
 gi|224018175|gb|EEF76173.1| hypothetical protein BACCOPRO_01670 [Bacteroides coprophilus DSM
          18228]
          Length = 86

 Score = 81.2 bits (200), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 24/72 (33%), Positives = 37/72 (51%), Gaps = 1/72 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS++C++T K  M GN VSH+  +T+R F  NL          +    L I    LR + 
Sbjct: 1  MSKICQITGKKAMIGNNVSHSKRRTKRTFDVNLFTKKFYYVEQDCWISLNICANGLRVIN 60

Query: 61 RQGGLDRFLSNS 72
          ++G LD  L+ +
Sbjct: 61 KKG-LDAALNEA 71


>gi|319950952|ref|ZP_08024824.1| 50S ribosomal protein L28 [Dietzia cinnamea P4]
 gi|319435374|gb|EFV90622.1| 50S ribosomal protein L28 [Dietzia cinnamea P4]
          Length = 78

 Score = 81.2 bits (200), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 18/75 (24%), Positives = 40/75 (53%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS  C++T +    G  VSH++ +T RR+ PN+ R +       ++  L +S   +++++
Sbjct: 1  MSAHCQVTGRKPGFGKSVSHSHRRTNRRWNPNIQRRSYFLPSEGRRVTLTVSTKGIKTID 60

Query: 61 RQGGLDRFLSNSKKE 75
          R G ++  ++  +  
Sbjct: 61 RDG-IEAVVARIRAR 74


>gi|301065048|ref|ZP_07205393.1| ribosomal protein L28 [delta proteobacterium NaphS2]
 gi|300440897|gb|EFK05317.1| ribosomal protein L28 [delta proteobacterium NaphS2]
          Length = 97

 Score = 81.2 bits (200), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 20/58 (34%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS 58
          MS+VC++  K  ++G  VSHA+NKT++R+ PNL  +  + D   Q  +++     ++S
Sbjct: 28 MSKVCDICGKGPLTGYNVSHAHNKTKKRWYPNLQSVRCVRD--GQNVKIKACTSCIKS 83


>gi|307564684|ref|ZP_07627214.1| 50S ribosomal protein L28 [Prevotella amnii CRIS 21A-A]
 gi|307346612|gb|EFN91919.1| 50S ribosomal protein L28 [Prevotella amnii CRIS 21A-A]
          Length = 87

 Score = 81.2 bits (200), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 24/75 (32%), Positives = 38/75 (50%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS++C++T K    GN VSH+ ++T+R F  NL          +    L+IS   LR + 
Sbjct: 1  MSKICQITGKKAQIGNNVSHSKHRTKRSFDVNLFSKKFYYVEEDCWISLKISAAGLRLIN 60

Query: 61 RQGGLDRFLSNSKKE 75
          + G LD  L  +  +
Sbjct: 61 KVG-LDAALKKAVAK 74


>gi|119964156|ref|YP_949436.1| 50S ribosomal protein L28 [Arthrobacter aurescens TC1]
 gi|166226538|sp|A1RB24|RL28_ARTAT RecName: Full=50S ribosomal protein L28
 gi|119951015|gb|ABM09926.1| ribosomal protein L28 [Arthrobacter aurescens TC1]
          Length = 78

 Score = 81.2 bits (200), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 14/63 (22%), Positives = 34/63 (53%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+  C++T      G+ +SH++ + +RRF PN+ +       + +   L +S   +++++
Sbjct: 1  MAAHCQVTGAEPGFGHSISHSHRRNKRRFDPNIQKKRYWVPSLRRNVTLTLSARGIKTID 60

Query: 61 RQG 63
           +G
Sbjct: 61 VRG 63


>gi|227501466|ref|ZP_03931515.1| 50S ribosomal protein L28 [Corynebacterium accolens ATCC 49725]
 gi|255324830|ref|ZP_05365943.1| ribosomal protein L28 [Corynebacterium tuberculostearicum SK141]
 gi|306835627|ref|ZP_07468636.1| 50S ribosomal protein L28 [Corynebacterium accolens ATCC 49726]
 gi|311740878|ref|ZP_07714705.1| 50S ribosomal protein L28 [Corynebacterium pseudogenitalium ATCC
          33035]
 gi|227077491|gb|EEI15454.1| 50S ribosomal protein L28 [Corynebacterium accolens ATCC 49725]
 gi|255298130|gb|EET77434.1| ribosomal protein L28 [Corynebacterium tuberculostearicum SK141]
 gi|304568471|gb|EFM44027.1| 50S ribosomal protein L28 [Corynebacterium accolens ATCC 49726]
 gi|311304398|gb|EFQ80474.1| 50S ribosomal protein L28 [Corynebacterium pseudogenitalium ATCC
          33035]
          Length = 78

 Score = 81.2 bits (200), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 18/75 (24%), Positives = 39/75 (52%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS +C++T +    G +VSH++ +T RR+ PN+ R         +   L +S   ++ ++
Sbjct: 1  MSAICQVTGRKPEFGKQVSHSHRRTSRRWNPNVQRRRYYLPSEGRTITLNVSTKGMKIID 60

Query: 61 RQGGLDRFLSNSKKE 75
          R G ++  ++  +  
Sbjct: 61 RDG-IESVVAKIRAR 74


>gi|311064682|ref|YP_003971407.1| 50S ribosomal protein L28P RpmB [Bifidobacterium bifidum PRL2010]
 gi|310867001|gb|ADP36370.1| RpmB LSU ribosomal protein L28P [Bifidobacterium bifidum PRL2010]
          Length = 98

 Score = 81.2 bits (200), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 21/63 (33%), Positives = 36/63 (57%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS+ C++      +GN+VSH++ KTRRRF PNL         + +   L +S   +++++
Sbjct: 1  MSKQCQILGTRASTGNRVSHSHRKTRRRFNPNLQTKRYWVPSLGRHVTLTVSVKGMKTID 60

Query: 61 RQG 63
          R G
Sbjct: 61 RIG 63


>gi|213692825|ref|YP_002323411.1| ribosomal protein L28 [Bifidobacterium longum subsp. infantis
          ATCC 15697]
 gi|213524286|gb|ACJ53033.1| ribosomal protein L28 [Bifidobacterium longum subsp. infantis
          ATCC 15697]
 gi|320458995|dbj|BAJ69616.1| 50S ribosomal protein L28 [Bifidobacterium longum subsp. infantis
          ATCC 15697]
          Length = 78

 Score = 81.2 bits (200), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 20/63 (31%), Positives = 35/63 (55%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS+ C++       GN+VSH++ KTRR F PNL         +++   L +S   +++++
Sbjct: 1  MSKTCQILGTRAGVGNRVSHSHRKTRRTFAPNLQSKRYWVPSLQRHVTLTVSAKGIKTID 60

Query: 61 RQG 63
          R G
Sbjct: 61 RIG 63


>gi|325279590|ref|YP_004252132.1| 50S ribosomal protein L28 [Odoribacter splanchnicus DSM 20712]
 gi|324311399|gb|ADY31952.1| 50S ribosomal protein L28 [Odoribacter splanchnicus DSM 20712]
          Length = 80

 Score = 81.2 bits (200), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 41/77 (53%), Gaps = 1/77 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++T K  M GN VSH+  + +R F  NL +        ++  +L +S   LR + 
Sbjct: 1  MSRVCQITGKRAMGGNHVSHSKRRVKRTFSINLFKRNFYWPEEDRWIRLNVSADGLRLIN 60

Query: 61 RQGGLDRFLSNSKKENL 77
          ++G L+  L ++    L
Sbjct: 61 KRG-LNACLKDATAAGL 76


>gi|239978057|ref|ZP_04700581.1| putative 50S ribosomal protein L28 [Streptomyces albus J1074]
 gi|291449958|ref|ZP_06589348.1| 50S ribosomal protein L28 [Streptomyces albus J1074]
 gi|291352907|gb|EFE79809.1| 50S ribosomal protein L28 [Streptomyces albus J1074]
          Length = 78

 Score = 81.2 bits (200), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 20/63 (31%), Positives = 34/63 (53%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS  C+LT      GN +SH++ +T RRF PN+ R         +  +L +S  A+++++
Sbjct: 1  MSAHCQLTGAKPGFGNSISHSHRRTSRRFDPNIQRRRYWLPSEGRTVRLTLSARAVKTID 60

Query: 61 RQG 63
            G
Sbjct: 61 VIG 63


>gi|295133100|ref|YP_003583776.1| 50S ribosomal protein L28 [Zunongwangia profunda SM-A87]
 gi|294981115|gb|ADF51580.1| 50S ribosomal protein L28 [Zunongwangia profunda SM-A87]
          Length = 79

 Score = 81.2 bits (200), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 28/75 (37%), Positives = 45/75 (60%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVCELT K  M GN VSHA NKT+R+F  NL +        ++   L++S  AL+++ 
Sbjct: 1  MSRVCELTGKKAMVGNNVSHAMNKTKRKFNANLVKKRFFIPEEDKWITLKVSTSALKNIN 60

Query: 61 RQGGLDRFLSNSKKE 75
          ++G +   +  ++ +
Sbjct: 61 KKG-ISAVIKEARAK 74


>gi|228471213|ref|ZP_04056026.1| ribosomal protein L28 [Porphyromonas uenonis 60-3]
 gi|313887404|ref|ZP_07821094.1| ribosomal protein L28 [Porphyromonas asaccharolytica PR426713P-I]
 gi|332300840|ref|YP_004442761.1| ribosomal protein L28 [Porphyromonas asaccharolytica DSM 20707]
 gi|228307028|gb|EEK16110.1| ribosomal protein L28 [Porphyromonas uenonis 60-3]
 gi|312923172|gb|EFR33991.1| ribosomal protein L28 [Porphyromonas asaccharolytica PR426713P-I]
 gi|332177903|gb|AEE13593.1| ribosomal protein L28 [Porphyromonas asaccharolytica DSM 20707]
          Length = 82

 Score = 80.9 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 25/74 (33%), Positives = 39/74 (52%), Gaps = 1/74 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS++C++T K  M GN VSH+  +T+R F  NL R        ++   L++S   LR + 
Sbjct: 1  MSKICQITGKKAMVGNNVSHSKRRTKRTFDVNLFRKKFYWPEEDRWISLKVSAAGLRLIN 60

Query: 61 RQGGLDRFLSNSKK 74
          R G L+  L  +  
Sbjct: 61 RVG-LNEALRRASD 73


>gi|172040222|ref|YP_001799936.1| 50S ribosomal protein L28 [Corynebacterium urealyticum DSM 7109]
 gi|226738059|sp|B1VFG3|RL28_CORU7 RecName: Full=50S ribosomal protein L28
 gi|171851526|emb|CAQ04502.1| 50S ribosomal protein L28 [Corynebacterium urealyticum DSM 7109]
          Length = 78

 Score = 80.9 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 19/75 (25%), Positives = 38/75 (50%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS  C++T +    G +VSH++  T RR+ PN+ R         +   L +S   L++++
Sbjct: 1  MSAYCQVTGRKPGFGKQVSHSHRHTSRRWNPNVQRRKFYLPSEGRTITLTVSPKGLKTID 60

Query: 61 RQGGLDRFLSNSKKE 75
          R G ++  ++  +  
Sbjct: 61 RDG-IESVVAKIRAR 74


>gi|238021654|ref|ZP_04602080.1| hypothetical protein GCWU000324_01557 [Kingella oralis ATCC
          51147]
 gi|237866268|gb|EEP67310.1| hypothetical protein GCWU000324_01557 [Kingella oralis ATCC
          51147]
          Length = 66

 Score = 80.9 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 26/63 (41%), Positives = 41/63 (65%), Gaps = 1/63 (1%)

Query: 13 MSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFLSNS 72
          MSGN VSHANNKT+RRFLPNL       +   +  ++R++  ALR++++ G +D  L++ 
Sbjct: 1  MSGNNVSHANNKTKRRFLPNLQSRRFWVESENRWIRIRVTNAALRTIDKNG-IDAVLADL 59

Query: 73 KKE 75
          +  
Sbjct: 60 RAR 62


>gi|254419542|ref|ZP_05033266.1| hypothetical protein BBAL3_1852 [Brevundimonas sp. BAL3]
 gi|196185719|gb|EDX80695.1| hypothetical protein BBAL3_1852 [Brevundimonas sp. BAL3]
          Length = 82

 Score = 80.9 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 30/70 (42%), Positives = 48/70 (68%)

Query: 19 SHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFLSNSKKENLS 78
          SH+N KT+RRFLP+L  + + SD + Q + LRIS  ALR+++ +GGLD F+  ++ E LS
Sbjct: 2  SHSNIKTKRRFLPSLKTVKVTSDSLGQTFSLRISNAALRTLDYKGGLDAFIVKARDEQLS 61

Query: 79 ARMRTLRSQI 88
             + ++ Q+
Sbjct: 62 IAAQRIKRQV 71


>gi|40062599|gb|AAR37528.1| ribosomal protein L28 [uncultured marine bacterium 311]
          Length = 78

 Score = 80.9 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 27/75 (36%), Positives = 46/75 (61%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M++VC++T K  + GNKVSHA N+TRR F PNL +     +  ++   L +S   +R ++
Sbjct: 1  MAKVCQVTGKKPLKGNKVSHAKNRTRRTFEPNLHKHKFWIESEKRHVSLTVSAKGMRIID 60

Query: 61 RQGGLDRFLSNSKKE 75
          ++G +D+ LS  +  
Sbjct: 61 KKG-IDKVLSEIRSR 74


>gi|319902100|ref|YP_004161828.1| LSU ribosomal protein L28P [Bacteroides helcogenes P 36-108]
 gi|319417131|gb|ADV44242.1| LSU ribosomal protein L28P [Bacteroides helcogenes P 36-108]
          Length = 86

 Score = 80.9 bits (199), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 24/72 (33%), Positives = 37/72 (51%), Gaps = 1/72 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS++C++T K  M GN VSH+  +T+R F  NL          +    L I    LR + 
Sbjct: 1  MSKICQITGKKAMIGNNVSHSKRRTKRTFDLNLFNKKFYYVEQDCWISLSICANGLRIIN 60

Query: 61 RQGGLDRFLSNS 72
          ++G LD  L ++
Sbjct: 61 KKG-LDAALKDA 71


>gi|332671614|ref|YP_004454622.1| 50S ribosomal protein L28 [Cellulomonas fimi ATCC 484]
 gi|332340652|gb|AEE47235.1| ribosomal protein L28 [Cellulomonas fimi ATCC 484]
          Length = 79

 Score = 80.9 bits (199), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 17/63 (26%), Positives = 34/63 (53%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS  C++       G+ VSH++ +T+RR+ PN+ R T     + ++    +S   + +++
Sbjct: 1  MSARCQVLGTVPGFGHAVSHSHRRTKRRWNPNVQRRTFFVPSLRRRVTFTVSARGITTID 60

Query: 61 RQG 63
          R G
Sbjct: 61 RLG 63


>gi|329120724|ref|ZP_08249386.1| 50S ribosomal protein L28 [Neisseria bacilliformis ATCC BAA-1200]
 gi|327460521|gb|EGF06857.1| 50S ribosomal protein L28 [Neisseria bacilliformis ATCC BAA-1200]
          Length = 65

 Score = 80.9 bits (199), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 27/63 (42%), Positives = 40/63 (63%), Gaps = 1/63 (1%)

Query: 13 MSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFLSNS 72
          MSGN VSHANNKT+RRFLPNL       +   +  +LR+S   LR++++ G +D  L++ 
Sbjct: 1  MSGNNVSHANNKTKRRFLPNLQTRRFWVESENRWVRLRVSNAGLRTIDKLG-IDAVLADL 59

Query: 73 KKE 75
          +  
Sbjct: 60 RAR 62


>gi|254430435|ref|ZP_05044138.1| ribosomal protein L28 [Cyanobium sp. PCC 7001]
 gi|197624888|gb|EDY37447.1| ribosomal protein L28 [Cyanobium sp. PCC 7001]
          Length = 78

 Score = 80.9 bits (199), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 25/84 (29%), Positives = 43/84 (51%), Gaps = 6/84 (7%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC+LT K   +G  VSH++ +T++    NL    L      +  +LR+S  ALR+++
Sbjct: 1  MSRVCQLTGKRANNGMAVSHSHVRTKKLQQVNLQERRLWWAEGNRFVRLRVSTRALRTIQ 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTL 84
          ++G        +  + L   +  L
Sbjct: 61 KKG------LGAYAKELGVNLAKL 78


>gi|305681979|ref|ZP_07404783.1| 50S ribosomal protein L28 [Corynebacterium matruchotii ATCC 14266]
 gi|305658452|gb|EFM47955.1| 50S ribosomal protein L28 [Corynebacterium matruchotii ATCC 14266]
          Length = 111

 Score = 80.9 bits (199), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 19/75 (25%), Positives = 38/75 (50%), Gaps = 1/75 (1%)

Query: 1   MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
           MS +C++T +    G  VSH++ +T RR+ PN+ R         +   L +S   L+ ++
Sbjct: 34  MSAICQVTGRKPGYGKSVSHSHRRTSRRWNPNVQRRKFYLPSEGRTITLTVSTKGLKVID 93

Query: 61  RQGGLDRFLSNSKKE 75
           R G ++  ++  +  
Sbjct: 94  RDG-IESVVAKIRAR 107


>gi|159038467|ref|YP_001537720.1| ribosomal protein L28 [Salinispora arenicola CNS-205]
 gi|157917302|gb|ABV98729.1| ribosomal protein L28 [Salinispora arenicola CNS-205]
          Length = 78

 Score = 80.9 bits (199), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 23/63 (36%), Positives = 37/63 (58%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR C++T      GN VSH++ +TRRR+ PNL           +  +L ++  AL++V+
Sbjct: 1  MSRRCDVTGAKPSFGNAVSHSHRRTRRRWNPNLQNHRYWLPSERRFVRLTLTAKALKTVD 60

Query: 61 RQG 63
          R+G
Sbjct: 61 RKG 63


>gi|227832650|ref|YP_002834357.1| 50S ribosomal protein L28 [Corynebacterium aurimucosum ATCC
          700975]
 gi|262182865|ref|ZP_06042286.1| 50S ribosomal protein L28 [Corynebacterium aurimucosum ATCC
          700975]
 gi|254801353|sp|C3PF15|RL28_CORA7 RecName: Full=50S ribosomal protein L28
 gi|227453666|gb|ACP32419.1| 50S ribosomal protein L28 [Corynebacterium aurimucosum ATCC
          700975]
          Length = 78

 Score = 80.9 bits (199), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 18/75 (24%), Positives = 39/75 (52%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS +C++T +    G +VSH++ +T RR+ PN+ R         +   L +S   ++ ++
Sbjct: 1  MSAICQVTGRKPEFGKQVSHSHRRTSRRWNPNVQRRRYYLPSEGRTITLTVSTKGMKIID 60

Query: 61 RQGGLDRFLSNSKKE 75
          R G ++  ++  +  
Sbjct: 61 RDG-IESVVAKIRAR 74


>gi|302553139|ref|ZP_07305481.1| ribosomal protein L28 [Streptomyces viridochromogenes DSM 40736]
 gi|302470757|gb|EFL33850.1| ribosomal protein L28 [Streptomyces viridochromogenes DSM 40736]
          Length = 78

 Score = 80.5 bits (198), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 22/63 (34%), Positives = 33/63 (52%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS  C LT      GN+VSH++ +T RRF PN+           +  +LR+S   +R+V+
Sbjct: 1  MSAHCMLTGARPGFGNRVSHSHRRTSRRFDPNIQSKRYWLPSEGRCVRLRLSVRGIRTVD 60

Query: 61 RQG 63
            G
Sbjct: 61 AIG 63


>gi|226822870|gb|ACO83102.1| mitochondrial ribosomal protein L28 (predicted) [Dasypus
           novemcinctus]
          Length = 256

 Score = 80.5 bits (198), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 15/93 (16%), Positives = 46/93 (49%), Gaps = 4/93 (4%)

Query: 7   LTKKTVMSGNKV---SHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQG 63
              +  + G++       + + ++ + P L +  L S+I+++K+ + ++   L  ++   
Sbjct: 80  WGGEGWILGHRYVNNDKFSKRVKKIWRPQLFQRELYSEILDRKFTVTVTMRTLDLIDEAF 139

Query: 64  GLDRFLSNSKKENL-SARMRTLRSQILKKMSEK 95
           G D ++  + +E+L S     L+  +L +++ +
Sbjct: 140 GFDFYILKTPQEDLCSKFGMDLKRGMLLRLARQ 172


>gi|225012676|ref|ZP_03703111.1| ribosomal protein L28 [Flavobacteria bacterium MS024-2A]
 gi|225003209|gb|EEG41184.1| ribosomal protein L28 [Flavobacteria bacterium MS024-2A]
          Length = 79

 Score = 80.5 bits (198), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 25/75 (33%), Positives = 43/75 (57%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS++CEL+ K VM GN VS A N+T+RRF  N+          ++   L IS   L+++ 
Sbjct: 1  MSKICELSGKRVMFGNNVSKALNRTKRRFDANIINKRFYIPEEDKWVTLTISTATLKTIN 60

Query: 61 RQGGLDRFLSNSKKE 75
          ++G +   L  ++++
Sbjct: 61 KKG-ISAVLKQAREK 74


>gi|153806281|ref|ZP_01958949.1| hypothetical protein BACCAC_00537 [Bacteroides caccae ATCC 43185]
 gi|160882780|ref|ZP_02063783.1| hypothetical protein BACOVA_00741 [Bacteroides ovatus ATCC 8483]
 gi|255693891|ref|ZP_05417566.1| ribosomal protein L28 [Bacteroides finegoldii DSM 17565]
 gi|260170249|ref|ZP_05756661.1| 50S ribosomal protein L28 [Bacteroides sp. D2]
 gi|293373980|ref|ZP_06620321.1| ribosomal protein L28 [Bacteroides ovatus SD CMC 3f]
 gi|299145598|ref|ZP_07038666.1| ribosomal protein L28 [Bacteroides sp. 3_1_23]
 gi|315918612|ref|ZP_07914852.1| conserved hypothetical protein [Bacteroides sp. D2]
 gi|149130958|gb|EDM22164.1| hypothetical protein BACCAC_00537 [Bacteroides caccae ATCC 43185]
 gi|156111804|gb|EDO13549.1| hypothetical protein BACOVA_00741 [Bacteroides ovatus ATCC 8483]
 gi|260620296|gb|EEX43167.1| ribosomal protein L28 [Bacteroides finegoldii DSM 17565]
 gi|292631056|gb|EFF49693.1| ribosomal protein L28 [Bacteroides ovatus SD CMC 3f]
 gi|298516089|gb|EFI39970.1| ribosomal protein L28 [Bacteroides sp. 3_1_23]
 gi|313692487|gb|EFS29322.1| conserved hypothetical protein [Bacteroides sp. D2]
          Length = 86

 Score = 80.5 bits (198), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 24/75 (32%), Positives = 38/75 (50%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS++C++T K  M GN VSH+  +T+R F  NL          +    L I    LR + 
Sbjct: 1  MSKICQITGKKAMIGNNVSHSKRRTKRTFDLNLFNKKFYYVEQDCWISLSICANGLRIIN 60

Query: 61 RQGGLDRFLSNSKKE 75
          ++G LD  L+ +  +
Sbjct: 61 KKG-LDAALTEAVAK 74


>gi|34541560|ref|NP_906039.1| 50S ribosomal protein L28 [Porphyromonas gingivalis W83]
 gi|188995755|ref|YP_001930007.1| 50S ribosomal protein L28 [Porphyromonas gingivalis ATCC 33277]
 gi|67461488|sp|Q7MTJ4|RL28_PORGI RecName: Full=50S ribosomal protein L28
 gi|226699145|sp|B2RM15|RL28_PORG3 RecName: Full=50S ribosomal protein L28
 gi|34397877|gb|AAQ66938.1| ribosomal protein L28 [Porphyromonas gingivalis W83]
 gi|188595435|dbj|BAG34410.1| 50S ribosomal protein L28 [Porphyromonas gingivalis ATCC 33277]
          Length = 79

 Score = 80.5 bits (198), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 26/75 (34%), Positives = 40/75 (53%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS++C++T K  M GN VSH+  +T+R F  NL R        +    LRIS   LR + 
Sbjct: 1  MSKICQITGKKAMVGNNVSHSKRRTKRVFDVNLFRKKFYWVEQDCWVVLRISAAGLRLIN 60

Query: 61 RQGGLDRFLSNSKKE 75
          + G LD  +  + ++
Sbjct: 61 KIG-LDAAIKRAAEK 74


>gi|189461327|ref|ZP_03010112.1| hypothetical protein BACCOP_01977 [Bacteroides coprocola DSM
          17136]
 gi|189431856|gb|EDV00841.1| hypothetical protein BACCOP_01977 [Bacteroides coprocola DSM
          17136]
          Length = 86

 Score = 80.5 bits (198), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 24/75 (32%), Positives = 38/75 (50%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS++C++T K  M GN VSH+  +T+R F  NL          +    L I    LR + 
Sbjct: 1  MSKICQITGKKAMIGNNVSHSKRRTKRTFDVNLFTKKFYYVEQDCWISLNICANGLRVIN 60

Query: 61 RQGGLDRFLSNSKKE 75
          ++G LD  L+ +  +
Sbjct: 61 KKG-LDAALNEAVAK 74


>gi|325297728|ref|YP_004257645.1| 50S ribosomal protein L28 [Bacteroides salanitronis DSM 18170]
 gi|324317281|gb|ADY35172.1| 50S ribosomal protein L28 [Bacteroides salanitronis DSM 18170]
          Length = 86

 Score = 80.5 bits (198), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 24/75 (32%), Positives = 39/75 (52%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS++C++T K  M GN VSH+  +T+R F  NL          +    L+I    LR + 
Sbjct: 1  MSKICQITGKKAMIGNNVSHSKRRTKRTFDVNLFTKKFYYVEQDCWISLKICANGLRVIN 60

Query: 61 RQGGLDRFLSNSKKE 75
          ++G LD  L+ +  +
Sbjct: 61 KKG-LDAALTEAVAK 74


>gi|38233448|ref|NP_939215.1| 50S ribosomal protein L28 [Corynebacterium diphtheriae NCTC
          13129]
 gi|67461437|sp|Q6NIC6|RL28_CORDI RecName: Full=50S ribosomal protein L28
 gi|38199708|emb|CAE49368.1| 50S ribosomal protein L28-2 [Corynebacterium diphtheriae]
          Length = 78

 Score = 80.5 bits (198), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 19/75 (25%), Positives = 38/75 (50%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS +C++T +    G  VSH++ +T RR+ PN+ R         +   L +S   L+ ++
Sbjct: 1  MSAICQVTGRQPGYGKSVSHSHRRTSRRWNPNVQRRKFYLPSEGRTITLNVSTKGLKVID 60

Query: 61 RQGGLDRFLSNSKKE 75
          R G ++  ++  +  
Sbjct: 61 RDG-IESVVAKIRAR 74


>gi|146163214|ref|XP_001011035.2| ribosomal protein L28 containing protein [Tetrahymena thermophila]
 gi|146146077|gb|EAR90790.2| ribosomal protein L28 containing protein [Tetrahymena thermophila
           SB210]
          Length = 289

 Score = 80.5 bits (198), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 24/96 (25%), Positives = 51/96 (53%), Gaps = 1/96 (1%)

Query: 2   SRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVER 61
           S+      K   +G +   +  K+ R +  N+    L SDI+++K ++++S   LR++++
Sbjct: 60  SQKGLFHGKQPKTGLQTCFSEKKSIRWWKVNVHEKYLWSDILQKKIRIQMSSKTLRTIDK 119

Query: 62  QGGLDRFLSNSKKENL-SARMRTLRSQILKKMSEKS 96
            GG D ++  +K +N+ S     LR  ++ K+ + S
Sbjct: 120 YGGFDNYVLLTKPKNMDSLYGEYLRKLMMFKLKDPS 155


>gi|86142312|ref|ZP_01060822.1| ribosomal protein L28 [Leeuwenhoekiella blandensis MED217]
 gi|85831064|gb|EAQ49521.1| ribosomal protein L28 [Leeuwenhoekiella blandensis MED217]
          Length = 79

 Score = 80.5 bits (198), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 30/75 (40%), Positives = 45/75 (60%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVCELT K  M GN VSHA NKT+R+F  NL +        ++   L+IS  AL+++ 
Sbjct: 1  MSRVCELTGKKAMVGNNVSHAMNKTKRKFDANLIKKRFYIPEEDKWITLKISTAALKNIN 60

Query: 61 RQGGLDRFLSNSKKE 75
          ++G +   L  ++ +
Sbjct: 61 KKG-ITAVLKEARAK 74


>gi|297201373|ref|ZP_06918770.1| ribosomal protein L28 [Streptomyces sviceus ATCC 29083]
 gi|297147873|gb|EDY57815.2| ribosomal protein L28 [Streptomyces sviceus ATCC 29083]
          Length = 78

 Score = 80.5 bits (198), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 19/63 (30%), Positives = 31/63 (49%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS  C LT      GN +S ++ +T RRF PN+           +  +LR+S   +++V+
Sbjct: 1  MSAHCMLTGARPGFGNHISFSHRRTSRRFDPNIQSKRYWLPSEGRYVRLRLSTKGIKTVD 60

Query: 61 RQG 63
            G
Sbjct: 61 SIG 63


>gi|325269748|ref|ZP_08136359.1| 50S ribosomal protein L28 [Prevotella multiformis DSM 16608]
 gi|324987949|gb|EGC19921.1| 50S ribosomal protein L28 [Prevotella multiformis DSM 16608]
          Length = 87

 Score = 80.5 bits (198), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 22/75 (29%), Positives = 37/75 (49%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS++C++T K    G  VSH+ ++T+R F  NL              +L++S   LR + 
Sbjct: 1  MSKICQITGKKAQIGCNVSHSKHRTKRSFDVNLFSKKFYYVEEGCWIELKVSAAGLRLIN 60

Query: 61 RQGGLDRFLSNSKKE 75
          + G LD  L  +  +
Sbjct: 61 KVG-LDAALKQAVSK 74


>gi|325955095|ref|YP_004238755.1| 50S ribosomal protein L28 [Weeksella virosa DSM 16922]
 gi|323437713|gb|ADX68177.1| 50S ribosomal protein L28 [Weeksella virosa DSM 16922]
          Length = 78

 Score = 80.5 bits (198), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 29/77 (37%), Positives = 47/77 (61%), Gaps = 1/77 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS++C++T K  + GNKVSHANNKT+R F  NL +        ++   LR+S   L+++ 
Sbjct: 1  MSKICQITGKRRLVGNKVSHANNKTKRTFEVNLFKKRFYLPEADEWITLRVSANGLKTIN 60

Query: 61 RQGGLDRFLSNSKKENL 77
          + G +D  +  ++KE L
Sbjct: 61 KLG-VDEAVKRARKEGL 76


>gi|283456725|ref|YP_003361289.1| 50S ribosomal protein L28 [Bifidobacterium dentium Bd1]
 gi|283103359|gb|ADB10465.1| 50S ribosomal protein L28,50S ribosomal protein L28
          [Bifidobacterium dentium Bd1]
          Length = 81

 Score = 80.5 bits (198), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 21/63 (33%), Positives = 35/63 (55%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS+ C++       GN VSH++ KTRR F PNL R       + +   L ++   +++++
Sbjct: 1  MSKHCQVLGTRAHVGNAVSHSHRKTRRTFSPNLQRKRYYVPSLGRTVTLTLTPKGMKTID 60

Query: 61 RQG 63
          RQG
Sbjct: 61 RQG 63


>gi|114050843|ref|NP_001039461.1| 39S ribosomal protein L28, mitochondrial precursor [Bos taurus]
 gi|122135757|sp|Q2HJJ1|RM28_BOVIN RecName: Full=39S ribosomal protein L28, mitochondrial;
           Short=L28mt; Short=MRP-L28; Flags: Precursor
 gi|88682857|gb|AAI05312.1| Mitochondrial ribosomal protein L28 [Bos taurus]
 gi|296473443|gb|DAA15558.1| 39S ribosomal protein L28, mitochondrial precursor [Bos taurus]
          Length = 256

 Score = 80.5 bits (198), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 15/93 (16%), Positives = 45/93 (48%), Gaps = 4/93 (4%)

Query: 7   LTKKTVMSGNKV---SHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQG 63
              +  + G++       + + ++ + P L +  L S+I++ ++ + ++   L  ++   
Sbjct: 80  WGGEGWLKGHRYVNNDKFSKRVKKVWKPQLFQRELYSEILDTRFTVTVTMRTLDLIDEAY 139

Query: 64  GLDRFLSNSKKENL-SARMRTLRSQILKKMSEK 95
           G D ++  + KE+L S     L+  +L +++ +
Sbjct: 140 GFDFYILKTPKEDLCSKFGMDLKRGMLLRLARQ 172


>gi|241951236|ref|XP_002418340.1| ribosomal protein, large subunit, mitochondrial precursor, putative
           [Candida dubliniensis CD36]
 gi|223641679|emb|CAX43640.1| ribosomal protein, large subunit, mitochondrial precursor, putative
           [Candida dubliniensis CD36]
          Length = 270

 Score = 80.5 bits (198), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 21/75 (28%), Positives = 43/75 (57%), Gaps = 3/75 (4%)

Query: 19  SHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFLSN---SKKE 75
           S   NKT R   PN+    L S+ + ++ +LR++   L+++ ++GGLD++L     ++ +
Sbjct: 109 SEYLNKTLRVHRPNVQWTKLWSETLNKRLRLRVATRVLKTISKEGGLDQYLLKSTPARVK 168

Query: 76  NLSARMRTLRSQILK 90
            +  +   LR +IL+
Sbjct: 169 TMGLKAWQLRYRILQ 183


>gi|71892377|ref|YP_278111.1| 50S ribosomal protein L28 [Candidatus Blochmannia pennsylvanicus
          str. BPEN]
 gi|123640780|sp|Q491X0|RL28_BLOPB RecName: Full=50S ribosomal protein L28
 gi|71796483|gb|AAZ41234.1| 50S ribosomal subunit protein L28 [Candidatus Blochmannia
          pennsylvanicus str. BPEN]
          Length = 75

 Score = 80.5 bits (198), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 26/76 (34%), Positives = 42/76 (55%), Gaps = 1/76 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVC++T K  MSGNK SHA N T+R F PN+          ++   LR+S   +R ++
Sbjct: 1  MARVCQVTGKRPMSGNKRSHAMNATKRWFAPNIHSHRFWVASKKRFVALRLSTKGIRLID 60

Query: 61 RQGGLDRFLSNSKKEN 76
          + G ++ F +    + 
Sbjct: 61 KFG-IEYFFTKIYPKK 75


>gi|301166341|emb|CBW25917.1| 50S ribosomal protein L28 [Bacteriovorax marinus SJ]
          Length = 76

 Score = 80.1 bits (197), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 44/73 (60%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVC+LT K  + GNKVSHA N+T+    PNL    +      Q  +LR+S  A+R+++
Sbjct: 1  MARVCDLTGKRRLVGNKVSHAKNRTKMTQKPNLQTKRVFDPESGQTIKLRLSTSAIRTLD 60

Query: 61 RQGGLDRFLSNSK 73
          + G L +FL   K
Sbjct: 61 KVGSLSKFLKKYK 73


>gi|87302721|ref|ZP_01085532.1| 50S ribosomal protein L28 [Synechococcus sp. WH 5701]
 gi|87282604|gb|EAQ74562.1| 50S ribosomal protein L28 [Synechococcus sp. WH 5701]
          Length = 78

 Score = 80.1 bits (197), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 25/84 (29%), Positives = 43/84 (51%), Gaps = 6/84 (7%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC+LT K   +G  VSH++ +T++    NL    L      +  +LR++   LR+++
Sbjct: 1  MSRVCQLTGKRANNGMAVSHSHVRTKKLQQVNLQERRLWWAEGNRWVKLRVATRTLRTIQ 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTL 84
          ++G LD +        L   +  L
Sbjct: 61 KKG-LDAY-----ARELGVNLAKL 78


>gi|160889553|ref|ZP_02070556.1| hypothetical protein BACUNI_01977 [Bacteroides uniformis ATCC
          8492]
 gi|167763127|ref|ZP_02435254.1| hypothetical protein BACSTE_01496 [Bacteroides stercoris ATCC
          43183]
 gi|218131137|ref|ZP_03459941.1| hypothetical protein BACEGG_02742 [Bacteroides eggerthii DSM
          20697]
 gi|270296677|ref|ZP_06202876.1| conserved hypothetical protein [Bacteroides sp. D20]
 gi|317476986|ref|ZP_07936228.1| ribosomal protein L28 [Bacteroides eggerthii 1_2_48FAA]
 gi|329954828|ref|ZP_08295845.1| ribosomal protein L28 [Bacteroides clarus YIT 12056]
 gi|329963570|ref|ZP_08301049.1| ribosomal protein L28 [Bacteroides fluxus YIT 12057]
 gi|156861070|gb|EDO54501.1| hypothetical protein BACUNI_01977 [Bacteroides uniformis ATCC
          8492]
 gi|167699467|gb|EDS16046.1| hypothetical protein BACSTE_01496 [Bacteroides stercoris ATCC
          43183]
 gi|217986657|gb|EEC52991.1| hypothetical protein BACEGG_02742 [Bacteroides eggerthii DSM
          20697]
 gi|270272664|gb|EFA18527.1| conserved hypothetical protein [Bacteroides sp. D20]
 gi|316906779|gb|EFV28491.1| ribosomal protein L28 [Bacteroides eggerthii 1_2_48FAA]
 gi|328526932|gb|EGF53943.1| ribosomal protein L28 [Bacteroides clarus YIT 12056]
 gi|328528559|gb|EGF55530.1| ribosomal protein L28 [Bacteroides fluxus YIT 12057]
          Length = 86

 Score = 80.1 bits (197), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 24/75 (32%), Positives = 38/75 (50%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS++C++T K  M GN VSH+  +T+R F  NL          +    L I    LR + 
Sbjct: 1  MSKICQITGKKAMIGNNVSHSKRRTKRTFDLNLFNKKFYYVEQDCWISLSICANGLRIIN 60

Query: 61 RQGGLDRFLSNSKKE 75
          ++G LD  L ++  +
Sbjct: 61 KKG-LDAALKDAVAK 74


>gi|238898969|ref|YP_002924651.1| 50S ribosomal subunit protein L28 [Candidatus Hamiltonella
          defensa 5AT (Acyrthosiphon pisum)]
 gi|259646741|sp|C4K7G0|RL28_HAMD5 RecName: Full=50S ribosomal protein L28
 gi|229466729|gb|ACQ68503.1| 50S ribosomal subunit protein L28 [Candidatus Hamiltonella
          defensa 5AT (Acyrthosiphon pisum)]
          Length = 78

 Score = 80.1 bits (197), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 30/75 (40%), Positives = 47/75 (62%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC++TKK  ++GN+ SHA N T+RRFLPNL R     +  ++   LR+S   +R ++
Sbjct: 1  MSRVCQVTKKRPVTGNRRSHAMNATKRRFLPNLHRHRFWIESEKRFITLRLSAKGIRIID 60

Query: 61 RQGGLDRFLSNSKKE 75
          ++G ++  L   K  
Sbjct: 61 KKG-IEAVLEEIKAR 74


>gi|86133834|ref|ZP_01052416.1| 50S ribosomal protein L28 [Polaribacter sp. MED152]
 gi|85820697|gb|EAQ41844.1| 50S ribosomal protein L28 [Polaribacter sp. MED152]
          Length = 79

 Score = 80.1 bits (197), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 26/75 (34%), Positives = 41/75 (54%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVCELT K  M GN VS A N+T+R F  NL          ++   L++S  AL+++ 
Sbjct: 1  MSRVCELTGKKAMVGNNVSKALNRTKRTFDANLMTKRFYIPEEDKWVTLKVSASALKNIN 60

Query: 61 RQGGLDRFLSNSKKE 75
          ++G +   +  ++  
Sbjct: 61 KKG-ISAVIKEARAN 74


>gi|269215114|ref|ZP_05987771.2| ribosomal protein L28 [Neisseria lactamica ATCC 23970]
 gi|288576203|ref|ZP_05978387.2| ribosomal protein L28 [Neisseria mucosa ATCC 25996]
 gi|304386501|ref|ZP_07368789.1| 50S ribosomal protein L28 [Neisseria meningitidis ATCC 13091]
 gi|269208287|gb|EEZ74742.1| ribosomal protein L28 [Neisseria lactamica ATCC 23970]
 gi|288566043|gb|EFC87603.1| ribosomal protein L28 [Neisseria mucosa ATCC 25996]
 gi|304339330|gb|EFM05402.1| 50S ribosomal protein L28 [Neisseria meningitidis ATCC 13091]
          Length = 65

 Score = 80.1 bits (197), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 28/63 (44%), Positives = 41/63 (65%), Gaps = 1/63 (1%)

Query: 13 MSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFLSNS 72
          MSGN VSHANNKT+RRFLPNL       +   +  +LR+S  ALR++++ G +D  L++ 
Sbjct: 1  MSGNNVSHANNKTKRRFLPNLQSRRFWVESENRWVRLRVSNAALRTIDKVG-IDVVLADL 59

Query: 73 KKE 75
          +  
Sbjct: 60 RAR 62


>gi|323345510|ref|ZP_08085733.1| 50S ribosomal protein L28 [Prevotella oralis ATCC 33269]
 gi|323093624|gb|EFZ36202.1| 50S ribosomal protein L28 [Prevotella oralis ATCC 33269]
          Length = 87

 Score = 80.1 bits (197), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 23/75 (30%), Positives = 36/75 (48%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS++C++T K    G  VSH+ ++T+R F  NL               L+IS   LR + 
Sbjct: 1  MSKICQITGKKAQIGCNVSHSKHRTKRSFDVNLFNKKFYYVEEGCWISLKISAAGLRLIN 60

Query: 61 RQGGLDRFLSNSKKE 75
          + G LD  L  +  +
Sbjct: 61 KVG-LDAALKQAVSK 74


>gi|47225028|emb|CAF97443.1| unnamed protein product [Tetraodon nigroviridis]
          Length = 251

 Score = 80.1 bits (197), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 18/95 (18%), Positives = 49/95 (51%), Gaps = 4/95 (4%)

Query: 7   LTKKTVMSGNKVSHANN---KTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQG 63
              +  +SG + ++ +    + ++ + P L +  L S+I++ K+ + ++   L  ++   
Sbjct: 79  WGGEGWISGYRYANNDKMSTRLKKTWKPQLFKRELYSEILDHKFTITVTARTLDLIDAAY 138

Query: 64  GLDRFLSNSKKENL-SARMRTLRSQILKKMSEKSS 97
           G D ++  + KE+L S     L+  +L +++ +S+
Sbjct: 139 GFDFYILKTPKEDLNSKLGMDLKRAMLLRLARRST 173


>gi|304384257|ref|ZP_07366668.1| 50S ribosomal protein L28 [Prevotella marshii DSM 16973]
 gi|304334573|gb|EFM00855.1| 50S ribosomal protein L28 [Prevotella marshii DSM 16973]
          Length = 87

 Score = 80.1 bits (197), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 23/75 (30%), Positives = 36/75 (48%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS++C++T K    G  VSH+ ++T+R F  NL               L+IS   LR + 
Sbjct: 1  MSKICQITGKKAQIGCNVSHSKHRTKRSFDVNLFNKKFYYVEEGCWISLKISAAGLRLIN 60

Query: 61 RQGGLDRFLSNSKKE 75
          + G LD  L  +  +
Sbjct: 61 KVG-LDAALKQAVSK 74


>gi|303235498|ref|ZP_07322110.1| ribosomal protein L28 [Prevotella disiens FB035-09AN]
 gi|302484297|gb|EFL47280.1| ribosomal protein L28 [Prevotella disiens FB035-09AN]
          Length = 87

 Score = 80.1 bits (197), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 23/75 (30%), Positives = 36/75 (48%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS++C++T K    G  VSH+ ++T+R F  NL               L+IS   LR + 
Sbjct: 1  MSKICQITGKKAQIGCNVSHSKHRTKRSFDVNLFSKKFYYVEEGCWISLKISTAGLRLIN 60

Query: 61 RQGGLDRFLSNSKKE 75
          + G LD  L  +  +
Sbjct: 61 KVG-LDAALKQAVSK 74


>gi|150005786|ref|YP_001300530.1| 50S ribosomal protein L28 [Bacteroides vulgatus ATCC 8482]
 gi|212693208|ref|ZP_03301336.1| hypothetical protein BACDOR_02718 [Bacteroides dorei DSM 17855]
 gi|237709951|ref|ZP_04540432.1| 50S ribosomal protein L28 [Bacteroides sp. 9_1_42FAA]
 gi|237725384|ref|ZP_04555865.1| 50S ribosomal protein L28 [Bacteroides sp. D4]
 gi|254882033|ref|ZP_05254743.1| 50S ribosomal protein L28 [Bacteroides sp. 4_3_47FAA]
 gi|265753602|ref|ZP_06088957.1| 50S ribosomal protein L28 [Bacteroides sp. 3_1_33FAA]
 gi|294776164|ref|ZP_06741653.1| ribosomal protein L28 [Bacteroides vulgatus PC510]
 gi|319640959|ref|ZP_07995667.1| 50S ribosomal protein L28 [Bacteroides sp. 3_1_40A]
 gi|166226543|sp|A6L5E4|RL28_BACV8 RecName: Full=50S ribosomal protein L28
 gi|149934210|gb|ABR40908.1| 50S ribosomal protein L28 [Bacteroides vulgatus ATCC 8482]
 gi|212664313|gb|EEB24885.1| hypothetical protein BACDOR_02718 [Bacteroides dorei DSM 17855]
 gi|229436071|gb|EEO46148.1| 50S ribosomal protein L28 [Bacteroides dorei 5_1_36/D4]
 gi|229456044|gb|EEO61765.1| 50S ribosomal protein L28 [Bacteroides sp. 9_1_42FAA]
 gi|254834826|gb|EET15135.1| 50S ribosomal protein L28 [Bacteroides sp. 4_3_47FAA]
 gi|263235316|gb|EEZ20840.1| 50S ribosomal protein L28 [Bacteroides sp. 3_1_33FAA]
 gi|294449987|gb|EFG18498.1| ribosomal protein L28 [Bacteroides vulgatus PC510]
 gi|317387404|gb|EFV68275.1| 50S ribosomal protein L28 [Bacteroides sp. 3_1_40A]
          Length = 86

 Score = 80.1 bits (197), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 24/72 (33%), Positives = 37/72 (51%), Gaps = 1/72 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS++C++T K  M GN VSH+  +T+R F  NL          +    L I    LR + 
Sbjct: 1  MSKICQITGKKAMIGNNVSHSKRRTKRTFDVNLFTKKFYYVEQDCWISLNICANGLRVIN 60

Query: 61 RQGGLDRFLSNS 72
          ++G LD  L+ +
Sbjct: 61 KKG-LDAALNEA 71


>gi|326383108|ref|ZP_08204797.1| ribosomal protein L28 [Gordonia neofelifaecis NRRL B-59395]
 gi|326198244|gb|EGD55429.1| ribosomal protein L28 [Gordonia neofelifaecis NRRL B-59395]
          Length = 78

 Score = 80.1 bits (197), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 19/63 (30%), Positives = 36/63 (57%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+  C++T +    G +VSH++ +T R++ PNL R T     + +   LR+S   ++ ++
Sbjct: 1  MAARCQVTGRVPGFGRQVSHSHRRTSRQWRPNLFRKTYWVPSLSRNVTLRVSAKGIKVID 60

Query: 61 RQG 63
          R G
Sbjct: 61 RDG 63


>gi|260942223|ref|XP_002615410.1| hypothetical protein CLUG_04292 [Clavispora lusitaniae ATCC 42720]
 gi|238850700|gb|EEQ40164.1| hypothetical protein CLUG_04292 [Clavispora lusitaniae ATCC 42720]
          Length = 263

 Score = 80.1 bits (197), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 24/82 (29%), Positives = 45/82 (54%), Gaps = 3/82 (3%)

Query: 19  SHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFLSN---SKKE 75
           S + NK  R  LPN+ R  L S+ + ++   R+S   LR+V ++GGLD +L     ++ +
Sbjct: 108 SESGNKNNRVHLPNIVRAKLWSETLNKRISARVSTTLLRTVTKEGGLDNYLLKDKPARVK 167

Query: 76  NLSARMRTLRSQILKKMSEKSS 97
            +  +   L+  I+KK   +++
Sbjct: 168 TMGLKAWRLKYDIMKKKEIEAN 189


>gi|291515234|emb|CBK64444.1| LSU ribosomal protein L28P [Alistipes shahii WAL 8301]
          Length = 77

 Score = 80.1 bits (197), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 20/61 (32%), Positives = 39/61 (63%)

Query: 3  RVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQ 62
          +VCE+T K  + GN VSH++++T+R+F PNL      S+   +   L++S   ++++ ++
Sbjct: 2  KVCEITGKVAIVGNNVSHSHHRTKRKFSPNLKTKRFWSEQEGRWITLKVSAAGMKTINKK 61

Query: 63 G 63
          G
Sbjct: 62 G 62


>gi|297192961|ref|ZP_06910359.1| 50S ribosomal protein L28 [Streptomyces pristinaespiralis ATCC
          25486]
 gi|297151573|gb|EDY66542.2| 50S ribosomal protein L28 [Streptomyces pristinaespiralis ATCC
          25486]
          Length = 78

 Score = 79.7 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 21/63 (33%), Positives = 34/63 (53%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS  C LT      GN++SH++ +T RRF PN+ R         +  +L +S  A+++V+
Sbjct: 1  MSAHCMLTGAQPGFGNRISHSHRRTSRRFDPNIQRKRYWLPGEGRHVRLTLSARAVKTVD 60

Query: 61 RQG 63
            G
Sbjct: 61 VIG 63


>gi|282859677|ref|ZP_06268779.1| ribosomal protein L28 [Prevotella bivia JCVIHMP010]
 gi|282587595|gb|EFB92798.1| ribosomal protein L28 [Prevotella bivia JCVIHMP010]
          Length = 87

 Score = 79.7 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 25/75 (33%), Positives = 38/75 (50%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS++C++T K    GN VSH+ ++T+R F  NL          E    L+IS   LR + 
Sbjct: 1  MSKICQITGKKAQLGNNVSHSKHRTKRSFDVNLFSKKFYYVEEECWISLKISAAGLRLIN 60

Query: 61 RQGGLDRFLSNSKKE 75
          + G LD  L  +  +
Sbjct: 61 KVG-LDAALKKAVAK 74


>gi|300858075|ref|YP_003783058.1| 50S ribosomal protein L28 [Corynebacterium pseudotuberculosis
          FRC41]
 gi|300685529|gb|ADK28451.1| 50S ribosomal protein L28 [Corynebacterium pseudotuberculosis
          FRC41]
 gi|302205797|gb|ADL10139.1| 50S ribosomal protein L28 [Corynebacterium pseudotuberculosis
          C231]
 gi|302330356|gb|ADL20550.1| 50S ribosomal protein L28 [Corynebacterium pseudotuberculosis
          1002]
 gi|308276032|gb|ADO25931.1| 50S ribosomal protein L28 [Corynebacterium pseudotuberculosis
          I19]
          Length = 78

 Score = 79.7 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 19/75 (25%), Positives = 38/75 (50%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS +C++T +    G  VSH++ +T RR+ PN+ R         +   L +S   L+ ++
Sbjct: 1  MSAICQVTGRKPGYGKSVSHSHRRTSRRWNPNVQRRKFYLPSEGRTITLNVSTKGLKVID 60

Query: 61 RQGGLDRFLSNSKKE 75
          R G ++  ++  +  
Sbjct: 61 RDG-IESVVAKIRAR 74


>gi|198274632|ref|ZP_03207164.1| hypothetical protein BACPLE_00784 [Bacteroides plebeius DSM
          17135]
 gi|198272079|gb|EDY96348.1| hypothetical protein BACPLE_00784 [Bacteroides plebeius DSM
          17135]
          Length = 86

 Score = 79.7 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 23/75 (30%), Positives = 38/75 (50%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS++C++T K  + GN VSH+  +T+R F  NL          +    L I    LR + 
Sbjct: 1  MSKICQITGKKALIGNNVSHSKRRTKRTFDVNLFTKKFYYVEQDCWISLNICANGLRVIN 60

Query: 61 RQGGLDRFLSNSKKE 75
          ++G LD  L+ +  +
Sbjct: 61 KKG-LDAALNEAVAK 74


>gi|189465613|ref|ZP_03014398.1| hypothetical protein BACINT_01971 [Bacteroides intestinalis DSM
          17393]
 gi|224540010|ref|ZP_03680549.1| hypothetical protein BACCELL_04922 [Bacteroides cellulosilyticus
          DSM 14838]
 gi|189437887|gb|EDV06872.1| hypothetical protein BACINT_01971 [Bacteroides intestinalis DSM
          17393]
 gi|224518377|gb|EEF87482.1| hypothetical protein BACCELL_04922 [Bacteroides cellulosilyticus
          DSM 14838]
          Length = 86

 Score = 79.7 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 24/75 (32%), Positives = 39/75 (52%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS++C++T K  M GN VSH+  +T+R F  NL          +    L I    LR + 
Sbjct: 1  MSKICQITGKKAMIGNNVSHSKRRTKRTFDLNLFNKKFYYVEQDCWISLSICANGLRIIN 60

Query: 61 RQGGLDRFLSNSKKE 75
          ++G LD  L+++  +
Sbjct: 61 KKG-LDAALNDAVAK 74


>gi|261880532|ref|ZP_06006959.1| 50S ribosomal protein L28 [Prevotella bergensis DSM 17361]
 gi|270332755|gb|EFA43541.1| 50S ribosomal protein L28 [Prevotella bergensis DSM 17361]
          Length = 87

 Score = 79.7 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 23/75 (30%), Positives = 34/75 (45%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS++C++T K    G  VSH+   T+R F  NL               L+IS   LR + 
Sbjct: 1  MSKICQITGKRAQIGCNVSHSKRHTKRSFDVNLFSKKFYYVEEGCWISLKISAAGLRLIN 60

Query: 61 RQGGLDRFLSNSKKE 75
          + G LD  L  +  +
Sbjct: 61 KVG-LDAALKQAVAK 74


>gi|297283120|ref|XP_001084527.2| PREDICTED: 39S ribosomal protein L28, mitochondrial isoform 2
           [Macaca mulatta]
          Length = 284

 Score = 79.7 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 17/98 (17%), Positives = 48/98 (48%), Gaps = 4/98 (4%)

Query: 2   SRVCELTKKTVMSGNKVSHANN---KTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS 58
           S+      +  + G + ++ +    + ++ + P L    L S+I+++K+ + ++   L  
Sbjct: 103 SQRGLWGGEGWILGQRYANDDKLSKRLKKVWKPQLFERELYSEILDKKFTVTVTMRTLDL 162

Query: 59  VERQGGLDRFLSNSKKENL-SARMRTLRSQILKKMSEK 95
           ++   G D ++  + KE+L S     L+  +L +++ +
Sbjct: 163 IDEAYGFDFYILKTPKEDLCSKFGMDLKRGMLLRLARQ 200


>gi|110637068|ref|YP_677275.1| 50S ribosomal protein L28P [Cytophaga hutchinsonii ATCC 33406]
 gi|123354785|sp|Q11XD1|RL28_CYTH3 RecName: Full=50S ribosomal protein L28
 gi|110279749|gb|ABG57935.1| LSU ribosomal protein L28P [Cytophaga hutchinsonii ATCC 33406]
          Length = 80

 Score = 79.7 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 26/72 (36%), Positives = 42/72 (58%), Gaps = 1/72 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVC++T K   +GN VSHANNKT+R F PN+ +         +   L++S  A++++ 
Sbjct: 1  MARVCQITGKKTRTGNNVSHANNKTKRTFAPNIQKKRFFLSEENRWVTLKLSTKAIKTIS 60

Query: 61 RQGGLDRFLSNS 72
           +G L   L  +
Sbjct: 61 SKG-LSAVLEKA 71


>gi|237716495|ref|ZP_04546976.1| conserved hypothetical protein [Bacteroides sp. D1]
 gi|237720686|ref|ZP_04551167.1| conserved hypothetical protein [Bacteroides sp. 2_2_4]
 gi|262408093|ref|ZP_06084641.1| ribosomal protein L28 [Bacteroides sp. 2_1_22]
 gi|294645087|ref|ZP_06722813.1| ribosomal protein L28 [Bacteroides ovatus SD CC 2a]
 gi|294809487|ref|ZP_06768190.1| ribosomal protein L28 [Bacteroides xylanisolvens SD CC 1b]
 gi|298484169|ref|ZP_07002335.1| ribosomal protein L28 [Bacteroides sp. D22]
 gi|229444142|gb|EEO49933.1| conserved hypothetical protein [Bacteroides sp. D1]
 gi|229449521|gb|EEO55312.1| conserved hypothetical protein [Bacteroides sp. 2_2_4]
 gi|262354901|gb|EEZ03993.1| ribosomal protein L28 [Bacteroides sp. 2_1_22]
 gi|292639593|gb|EFF57885.1| ribosomal protein L28 [Bacteroides ovatus SD CC 2a]
 gi|294443305|gb|EFG12069.1| ribosomal protein L28 [Bacteroides xylanisolvens SD CC 1b]
 gi|295084180|emb|CBK65703.1| LSU ribosomal protein L28P [Bacteroides xylanisolvens XB1A]
 gi|298269673|gb|EFI11268.1| ribosomal protein L28 [Bacteroides sp. D22]
          Length = 86

 Score = 79.7 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 23/75 (30%), Positives = 38/75 (50%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS++C++T K  M GN VSH+  +T+R F  NL          +    L +    LR + 
Sbjct: 1  MSKICQITGKKAMIGNNVSHSKRRTKRTFDLNLFNKKFYYVEQDCWISLSLCANGLRIIN 60

Query: 61 RQGGLDRFLSNSKKE 75
          ++G LD  L+ +  +
Sbjct: 61 KKG-LDAALTEAVAK 74


>gi|289428038|ref|ZP_06429742.1| ribosomal protein L28 [Propionibacterium acnes J165]
 gi|289158921|gb|EFD07121.1| ribosomal protein L28 [Propionibacterium acnes J165]
 gi|313808366|gb|EFS46833.1| ribosomal protein L28 [Propionibacterium acnes HL087PA2]
 gi|313818213|gb|EFS55927.1| ribosomal protein L28 [Propionibacterium acnes HL046PA2]
 gi|313821128|gb|EFS58842.1| ribosomal protein L28 [Propionibacterium acnes HL036PA1]
 gi|313824051|gb|EFS61765.1| ribosomal protein L28 [Propionibacterium acnes HL036PA2]
 gi|313827203|gb|EFS64917.1| ribosomal protein L28 [Propionibacterium acnes HL063PA1]
 gi|314926906|gb|EFS90737.1| ribosomal protein L28 [Propionibacterium acnes HL036PA3]
 gi|314961918|gb|EFT06019.1| ribosomal protein L28 [Propionibacterium acnes HL002PA2]
 gi|314979538|gb|EFT23632.1| ribosomal protein L28 [Propionibacterium acnes HL072PA2]
 gi|314988381|gb|EFT32472.1| ribosomal protein L28 [Propionibacterium acnes HL005PA2]
 gi|314990277|gb|EFT34368.1| ribosomal protein L28 [Propionibacterium acnes HL005PA3]
 gi|315083856|gb|EFT55832.1| ribosomal protein L28 [Propionibacterium acnes HL027PA2]
 gi|315087265|gb|EFT59241.1| ribosomal protein L28 [Propionibacterium acnes HL002PA3]
 gi|315089683|gb|EFT61659.1| ribosomal protein L28 [Propionibacterium acnes HL072PA1]
 gi|327326655|gb|EGE68443.1| ribosomal protein L28 [Propionibacterium acnes HL096PA3]
 gi|327449527|gb|EGE96181.1| ribosomal protein L28 [Propionibacterium acnes HL013PA2]
 gi|328757436|gb|EGF71052.1| ribosomal protein L28 [Propionibacterium acnes HL020PA1]
 gi|332676542|gb|AEE73358.1| 50S ribosomal protein L28 [Propionibacterium acnes 266]
          Length = 78

 Score = 79.7 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 18/63 (28%), Positives = 34/63 (53%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR C++       GN VSH+    +RR+ PN+ +       + +K  L ++  A++ ++
Sbjct: 1  MSRRCQVRGTKPEFGNNVSHSQRHIKRRWNPNIQKKRYWVPSLGRKVTLTLTPKAIKEID 60

Query: 61 RQG 63
          R+G
Sbjct: 61 RRG 63


>gi|225023630|ref|ZP_03712822.1| hypothetical protein EIKCOROL_00490 [Eikenella corrodens ATCC
          23834]
 gi|224943512|gb|EEG24721.1| hypothetical protein EIKCOROL_00490 [Eikenella corrodens ATCC
          23834]
          Length = 65

 Score = 79.7 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 28/63 (44%), Positives = 40/63 (63%), Gaps = 1/63 (1%)

Query: 13 MSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFLSNS 72
          MSGN VSHANNKT+RRFLPNL       +   +  +LR+S  ALR +++ G +D  L++ 
Sbjct: 1  MSGNNVSHANNKTKRRFLPNLQSRRFWVESENRWVRLRVSNAALRLIDKVG-IDAVLADL 59

Query: 73 KKE 75
          +  
Sbjct: 60 RAR 62


>gi|53713720|ref|YP_099712.1| 50S ribosomal protein L28 [Bacteroides fragilis YCH46]
 gi|60681990|ref|YP_212134.1| 50S ribosomal protein L28 [Bacteroides fragilis NCTC 9343]
 gi|253565668|ref|ZP_04843123.1| 50S ribosomal protein L28 [Bacteroides sp. 3_2_5]
 gi|265764044|ref|ZP_06092612.1| ribosomal protein L28 [Bacteroides sp. 2_1_16]
 gi|67461366|sp|Q64TK1|RL28_BACFR RecName: Full=50S ribosomal protein L28
 gi|81314946|sp|Q5LCF5|RL28_BACFN RecName: Full=50S ribosomal protein L28
 gi|52216585|dbj|BAD49178.1| 50S ribosomal protein L28 [Bacteroides fragilis YCH46]
 gi|60493424|emb|CAH08210.1| 50S ribosomal protein L28 [Bacteroides fragilis NCTC 9343]
 gi|251945947|gb|EES86354.1| 50S ribosomal protein L28 [Bacteroides sp. 3_2_5]
 gi|263256652|gb|EEZ27998.1| ribosomal protein L28 [Bacteroides sp. 2_1_16]
 gi|301163428|emb|CBW22979.1| 50S ribosomal protein L28 [Bacteroides fragilis 638R]
          Length = 86

 Score = 79.7 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 23/75 (30%), Positives = 39/75 (52%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS++C++T K  M GN VSH+  +T+R F  NL          +    L +    LR + 
Sbjct: 1  MSKICQITGKKAMIGNNVSHSKRRTKRTFDLNLFNKKFYYVEQDCWISLSLCAAGLRIIN 60

Query: 61 RQGGLDRFLSNSKKE 75
          ++G LD  L+++  +
Sbjct: 61 KKG-LDAALNDAVAK 74


>gi|123243688|emb|CAM26403.1| mitochondrial ribosomal protein L28 [Homo sapiens]
          Length = 240

 Score = 79.3 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 17/98 (17%), Positives = 47/98 (47%), Gaps = 4/98 (4%)

Query: 2   SRVCELTKKTVMSGNKVSHANN---KTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS 58
           S+      +  + G   ++ +    + ++ + P L      S+I+++K+ + ++   L  
Sbjct: 75  SQRGLWGGEGWILGQIYANNDKLSKRLKKVWKPQLFEREFYSEILDKKFTVTVTMRTLDL 134

Query: 59  VERQGGLDRFLSNSKKENL-SARMRTLRSQILKKMSEK 95
           ++   GLD ++  + KE+L S     L+  +L +++ +
Sbjct: 135 IDEAYGLDFYILKTPKEDLCSKFGMDLKRGMLLRLARQ 172


>gi|46138459|ref|XP_390920.1| hypothetical protein FG10744.1 [Gibberella zeae PH-1]
          Length = 256

 Score = 79.3 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 20/86 (23%), Positives = 40/86 (46%), Gaps = 4/86 (4%)

Query: 11  TVMSGNKVS-HANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFL 69
            +  GN V+   NNK RR + PN+         ++   + R++   L+++ R+GGL  +L
Sbjct: 70  RIRFGNTVAEKYNNKARRFWRPNVHVKVFKLPALDANVKTRLTLRVLKTIRREGGLQEYL 129

Query: 70  SN---SKKENLSARMRTLRSQILKKM 92
                ++ + L      LR  +++  
Sbjct: 130 LKSKPARIKELGPGGWNLRWLLMQSK 155


>gi|255009417|ref|ZP_05281543.1| 50S ribosomal protein L28 [Bacteroides fragilis 3_1_12]
 gi|313147176|ref|ZP_07809369.1| 50S ribosomal protein L28 [Bacteroides fragilis 3_1_12]
 gi|313135943|gb|EFR53303.1| 50S ribosomal protein L28 [Bacteroides fragilis 3_1_12]
          Length = 86

 Score = 79.3 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 23/75 (30%), Positives = 39/75 (52%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS++C++T K  M GN VSH+  +T+R F  NL          +    L +    LR + 
Sbjct: 1  MSKICQITGKKAMIGNNVSHSKRRTKRTFDLNLFNKKFYYVEQDCWISLSLCAAGLRIIN 60

Query: 61 RQGGLDRFLSNSKKE 75
          ++G LD  L+++  +
Sbjct: 61 KKG-LDAALNDAVAK 74


>gi|300727625|ref|ZP_07061014.1| ribosomal protein L28-related protein [Prevotella bryantii B14]
 gi|299775145|gb|EFI71748.1| ribosomal protein L28-related protein [Prevotella bryantii B14]
          Length = 87

 Score = 79.3 bits (195), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 24/75 (32%), Positives = 37/75 (49%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS++C++T K    G  VSH+ ++T+R F  NL               L+IS   LR + 
Sbjct: 1  MSKICQITGKKAQLGCNVSHSKHRTKRSFDVNLFSKKFYYVEEGCWISLKISAAGLRLIN 60

Query: 61 RQGGLDRFLSNSKKE 75
          + G LD  L N+  +
Sbjct: 61 KVG-LDAALQNAVAK 74


>gi|167535430|ref|XP_001749389.1| hypothetical protein [Monosiga brevicollis MX1]
 gi|163772255|gb|EDQ85910.1| predicted protein [Monosiga brevicollis MX1]
          Length = 140

 Score = 79.3 bits (195), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 23/92 (25%), Positives = 52/92 (56%), Gaps = 4/92 (4%)

Query: 9   KKTVMSGNKVS---HANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGL 65
            K V+ G K +    +  K+ + + PN+      SDI+++  +++++  A+R +++ GG 
Sbjct: 28  GKKVLFGVKSAEDKKSPIKSLKIWKPNVFEKRYYSDILKRYTKVKVTTKAIRCIDKAGGF 87

Query: 66  DRFLSNSKKENL-SARMRTLRSQILKKMSEKS 96
           D ++  ++ E L S     LR ++L+KM+ ++
Sbjct: 88  DNYILMTQPEKLDSELGMKLRVEMLQKMARRA 119


>gi|88854442|ref|ZP_01129109.1| 50S ribosomal protein L28 [marine actinobacterium PHSC20C1]
 gi|88816250|gb|EAR26105.1| 50S ribosomal protein L28 [marine actinobacterium PHSC20C1]
          Length = 78

 Score = 79.3 bits (195), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 20/84 (23%), Positives = 43/84 (51%), Gaps = 6/84 (7%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+  C++T      G+ +SH++ +T+RRF PN+ + T     + +   L++S   ++ ++
Sbjct: 1  MAATCQVTGAIPGFGHSISHSHRRTKRRFDPNIQKKTYFVPSLRRNVTLQLSAKGIKVID 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTL 84
           +G        S  ++L AR   +
Sbjct: 61 ARG------IESVVKDLLARGEKI 78


>gi|281425621|ref|ZP_06256534.1| 50S ribosomal protein L28 [Prevotella oris F0302]
 gi|299140817|ref|ZP_07033955.1| 50S ribosomal protein L28 [Prevotella oris C735]
 gi|281400208|gb|EFB31039.1| 50S ribosomal protein L28 [Prevotella oris F0302]
 gi|298577783|gb|EFI49651.1| 50S ribosomal protein L28 [Prevotella oris C735]
          Length = 87

 Score = 79.3 bits (195), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 23/75 (30%), Positives = 36/75 (48%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS++C++T K    G  VSH+ ++T+R F  NL               L+IS   LR + 
Sbjct: 1  MSKICQITGKKAQIGCNVSHSKHRTKRSFDVNLFSKKFYYVEEGCWISLKISAAGLRLIN 60

Query: 61 RQGGLDRFLSNSKKE 75
          + G LD  L  +  +
Sbjct: 61 KVG-LDAALKQAVSK 74


>gi|119606236|gb|EAW85830.1| mitochondrial ribosomal protein L28, isoform CRA_c [Homo sapiens]
          Length = 287

 Score = 79.3 bits (195), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 17/98 (17%), Positives = 47/98 (47%), Gaps = 4/98 (4%)

Query: 2   SRVCELTKKTVMSGNKVSHANN---KTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS 58
           S+      +  + G   ++ +    + ++ + P L      S+I+++K+ + ++   L  
Sbjct: 106 SQRGLWGGEGWILGQIYANNDKLSKRLKKVWKPQLFEREFYSEILDKKFTVTVTMRTLDL 165

Query: 59  VERQGGLDRFLSNSKKENL-SARMRTLRSQILKKMSEK 95
           ++   GLD ++  + KE+L S     L+  +L +++ +
Sbjct: 166 IDEAYGLDFYILKTPKEDLCSKFGMDLKRGMLLRLARQ 203


>gi|297571125|ref|YP_003696899.1| ribosomal protein L28 [Arcanobacterium haemolyticum DSM 20595]
 gi|296931472|gb|ADH92280.1| ribosomal protein L28 [Arcanobacterium haemolyticum DSM 20595]
          Length = 77

 Score = 79.3 bits (195), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 17/63 (26%), Positives = 34/63 (53%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+  C++T +    G  VSH++ +T RRF PNL         +++   L +S   +++++
Sbjct: 1  MATYCQVTGRKPQFGKTVSHSHKRTSRRFNPNLQTKKYYVPSLKRTISLTVSAKGIKTID 60

Query: 61 RQG 63
           +G
Sbjct: 61 SKG 63


>gi|148274121|ref|YP_001223682.1| 50S ribosomal protein L28 [Clavibacter michiganensis subsp.
          michiganensis NCPPB 382]
 gi|170783360|ref|YP_001711694.1| 50S ribosomal protein L28 [Clavibacter michiganensis subsp.
          sepedonicus]
 gi|166226562|sp|A5CV85|RL28_CLAM3 RecName: Full=50S ribosomal protein L28
 gi|189042428|sp|B0RDL1|RL28_CLAMS RecName: Full=50S ribosomal protein L28
 gi|147832051|emb|CAN03024.1| 50S ribosomal protein L28 [Clavibacter michiganensis subsp.
          michiganensis NCPPB 382]
 gi|169157930|emb|CAQ03140.1| 50S ribosomal protein L28 [Clavibacter michiganensis subsp.
          sepedonicus]
          Length = 78

 Score = 79.3 bits (195), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 16/63 (25%), Positives = 36/63 (57%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+  C++T      G+ +SH++ +T+RRF PN+ + T     + +  +L +S   ++ ++
Sbjct: 1  MAATCQVTGAVPGFGHNISHSHRRTKRRFDPNVQKKTYYVPSLRRNVKLTLSAKGIKVID 60

Query: 61 RQG 63
           +G
Sbjct: 61 ARG 63


>gi|37514850|gb|AAH00990.2| Mitochondrial ribosomal protein L28 [Homo sapiens]
 gi|189054796|dbj|BAG37621.1| unnamed protein product [Homo sapiens]
 gi|312150214|gb|ADQ31619.1| mitochondrial ribosomal protein L28 [synthetic construct]
          Length = 256

 Score = 79.3 bits (195), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 17/98 (17%), Positives = 47/98 (47%), Gaps = 4/98 (4%)

Query: 2   SRVCELTKKTVMSGNKVSHANN---KTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS 58
           S+      +  + G   ++ +    + ++ + P L      S+I+++K+ + ++   L  
Sbjct: 75  SQRGLWGGEGWILGQIYANNDKLSKRLKKVWKPQLFEREFYSEILDKKFTVTVTMRTLDL 134

Query: 59  VERQGGLDRFLSNSKKENL-SARMRTLRSQILKKMSEK 95
           ++   GLD ++  + KE+L S     L+  +L +++ +
Sbjct: 135 IDEAYGLDFYILKTPKEDLCSKFGMDLKRGMLLRLARQ 172


>gi|320354592|ref|YP_004195931.1| 50S ribosomal protein L28P [Desulfobulbus propionicus DSM 2032]
 gi|320123094|gb|ADW18640.1| LSU ribosomal protein L28P [Desulfobulbus propionicus DSM 2032]
          Length = 64

 Score = 79.3 bits (195), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 22/58 (37%), Positives = 32/58 (55%), Gaps = 1/58 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS 58
          M+R C +  K   +GN VSHA+NKTRRR++PNL R+ +            +    +RS
Sbjct: 1  MARNCAICGKGPSTGNNVSHAHNKTRRRWMPNLQRVRM-VTANGGTVHANVCTRCIRS 57


>gi|327291037|ref|XP_003230228.1| PREDICTED: 39S ribosomal protein L28, mitochondrial-like [Anolis
           carolinensis]
          Length = 262

 Score = 79.3 bits (195), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 21/98 (21%), Positives = 47/98 (47%), Gaps = 4/98 (4%)

Query: 2   SRVCELTKKTVMSGNKVSHAN---NKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS 58
           S+      +  +SG + +  +   N+ ++ + P L    L S+I+++K  + ++   L  
Sbjct: 85  SQQGLWGGEGWVSGFRYAKNDKLSNRVKKIWKPQLFTRELYSEILDRKLIITVTARTLDL 144

Query: 59  VERQGGLDRFLSNSKKENL-SARMRTLRSQILKKMSEK 95
           ++   GLD +L  + K  L S     L+  +L +++ K
Sbjct: 145 IDAAFGLDFYLLKTPKAELCSKLGMDLKRTLLLRLARK 182


>gi|294673491|ref|YP_003574107.1| 50S ribosomal protein L28 [Prevotella ruminicola 23]
 gi|294471764|gb|ADE81153.1| ribosomal protein L28 [Prevotella ruminicola 23]
          Length = 87

 Score = 79.3 bits (195), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 24/75 (32%), Positives = 37/75 (49%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS++C++T K    G  VSH+ ++T+R F  NL              QL+IS   LR + 
Sbjct: 1  MSKICQITGKKAQIGCNVSHSKHRTKRSFDVNLFSKKFYYVEEGCWIQLKISAAGLRMIN 60

Query: 61 RQGGLDRFLSNSKKE 75
          + G LD  L  +  +
Sbjct: 61 KVG-LDAALKQAVAK 74


>gi|26051229|ref|NP_006419.2| 39S ribosomal protein L28, mitochondrial precursor [Homo sapiens]
 gi|85695426|sp|Q13084|RM28_HUMAN RecName: Full=39S ribosomal protein L28, mitochondrial;
           Short=L28mt; Short=MRP-L28; AltName: Full=Melanoma
           antigen p15; AltName: Full=Melanoma-associated antigen
           recognized by T lymphocytes; Flags: Precursor
 gi|38197174|gb|AAH00507.2| Mitochondrial ribosomal protein L28 [Homo sapiens]
 gi|66350943|emb|CAI95594.1| mitochondrial ribosomal protein L28 [Homo sapiens]
 gi|119606233|gb|EAW85827.1| mitochondrial ribosomal protein L28, isoform CRA_a [Homo sapiens]
 gi|119606235|gb|EAW85829.1| mitochondrial ribosomal protein L28, isoform CRA_a [Homo sapiens]
 gi|119606238|gb|EAW85832.1| mitochondrial ribosomal protein L28, isoform CRA_a [Homo sapiens]
 gi|119606240|gb|EAW85834.1| mitochondrial ribosomal protein L28, isoform CRA_a [Homo sapiens]
          Length = 256

 Score = 79.3 bits (195), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 17/98 (17%), Positives = 47/98 (47%), Gaps = 4/98 (4%)

Query: 2   SRVCELTKKTVMSGNKVSHANN---KTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS 58
           S+      +  + G   ++ +    + ++ + P L      S+I+++K+ + ++   L  
Sbjct: 75  SQRGLWGGEGWILGQIYANNDKLSKRLKKVWKPQLFEREFYSEILDKKFTVTVTMRTLDL 134

Query: 59  VERQGGLDRFLSNSKKENL-SARMRTLRSQILKKMSEK 95
           ++   GLD ++  + KE+L S     L+  +L +++ +
Sbjct: 135 IDEAYGLDFYILKTPKEDLCSKFGMDLKRGMLLRLARQ 172


>gi|189499571|ref|YP_001959041.1| 50S ribosomal protein L28 [Chlorobium phaeobacteroides BS1]
 gi|226738050|sp|B3EMT2|RL28_CHLPB RecName: Full=50S ribosomal protein L28
 gi|189495012|gb|ACE03560.1| ribosomal protein L28 [Chlorobium phaeobacteroides BS1]
          Length = 72

 Score = 79.3 bits (195), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 26/63 (41%), Positives = 40/63 (63%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS+VC LT K    GN VSHANN+TR+RF PNL    +  +  ++  ++R+S  A++ + 
Sbjct: 1  MSKVCILTGKRPTYGNNVSHANNRTRKRFEPNLHTKRIWVEEEKRWVKVRVSAKAMKIMS 60

Query: 61 RQG 63
          + G
Sbjct: 61 KTG 63


>gi|294633336|ref|ZP_06711895.1| ribosomal protein L28 [Streptomyces sp. e14]
 gi|292831117|gb|EFF89467.1| ribosomal protein L28 [Streptomyces sp. e14]
          Length = 78

 Score = 78.9 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 18/63 (28%), Positives = 35/63 (55%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS  C+LT ++   G+++S ++ +T+RRF PN+           +  +L +S   L++V+
Sbjct: 1  MSAHCQLTGRSPGFGHRISRSHRRTKRRFDPNIQHKRYWLPSEGRHVRLTLSAKGLKTVD 60

Query: 61 RQG 63
            G
Sbjct: 61 AIG 63


>gi|134281303|ref|ZP_01768012.1| 50S ribosomal protein L28 [Burkholderia pseudomallei 305]
 gi|226194518|ref|ZP_03790116.1| 50S ribosomal protein L28 [Burkholderia pseudomallei Pakistan 9]
 gi|134247609|gb|EBA47694.1| 50S ribosomal protein L28 [Burkholderia pseudomallei 305]
 gi|225933603|gb|EEH29592.1| 50S ribosomal protein L28 [Burkholderia pseudomallei Pakistan 9]
          Length = 65

 Score = 78.9 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 27/63 (42%), Positives = 39/63 (61%), Gaps = 1/63 (1%)

Query: 13 MSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFLSNS 72
          MSGN VSHANNKT+RRFLPNL       +   +  +LR+S   LR +++ G +D  L++ 
Sbjct: 1  MSGNNVSHANNKTKRRFLPNLQNRRFWVESENRWVRLRVSNAGLRLIDKNG-IDSVLADL 59

Query: 73 KKE 75
          +  
Sbjct: 60 RAR 62


>gi|323699071|ref|ZP_08110983.1| ribosomal protein L28 [Desulfovibrio sp. ND132]
 gi|323459003|gb|EGB14868.1| ribosomal protein L28 [Desulfovibrio desulfuricans ND132]
          Length = 71

 Score = 78.9 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 34/57 (59%), Gaps = 1/57 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALR 57
          MS+VC++  K   +GN VSH++ KT+RRF+PNL ++    +   Q   ++     +R
Sbjct: 1  MSQVCDICGKGPQTGNNVSHSHIKTKRRFMPNLQKVRHQLES-GQVVSIKACTRCIR 56


>gi|325856873|ref|ZP_08172371.1| ribosomal protein L28 [Prevotella denticola CRIS 18C-A]
 gi|327314533|ref|YP_004329970.1| 50S ribosomal protein L28 [Prevotella denticola F0289]
 gi|325483246|gb|EGC86223.1| ribosomal protein L28 [Prevotella denticola CRIS 18C-A]
 gi|326945968|gb|AEA21853.1| ribosomal protein L28 [Prevotella denticola F0289]
          Length = 87

 Score = 78.9 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 23/75 (30%), Positives = 37/75 (49%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS++C++T K    G  VSH+ ++T+R F  NL              +L+IS   LR + 
Sbjct: 1  MSKICQITGKKAQIGCNVSHSKHRTKRSFDVNLFSKKFYYVEEGCWIELKISAAGLRLIN 60

Query: 61 RQGGLDRFLSNSKKE 75
          + G LD  L  +  +
Sbjct: 61 KMG-LDAALKQAVSK 74


>gi|291000967|ref|XP_002683050.1| predicted protein [Naegleria gruberi]
 gi|284096679|gb|EFC50306.1| predicted protein [Naegleria gruberi]
          Length = 87

 Score = 78.9 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 23/69 (33%), Positives = 45/69 (65%)

Query: 12 VMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFLSN 71
          + +GN+ S +  KT+R+++PN   + L S+ ++ + QLR +  ALR +++ GGLD +L  
Sbjct: 13 IQTGNQRSFSERKTKRKWMPNSHWVKLYSEALDTRVQLRATSKALRCIDKSGGLDNYLIE 72

Query: 72 SKKENLSAR 80
          ++ E + +R
Sbjct: 73 TRPELVGSR 81


>gi|24214862|ref|NP_712343.1| 50S ribosomal protein L28 [Leptospira interrogans serovar Lai
          str. 56601]
 gi|45657626|ref|YP_001712.1| 50S ribosomal protein L28 [Leptospira interrogans serovar
          Copenhageni str. Fiocruz L1-130]
 gi|67461465|sp|Q72RI5|RL28_LEPIC RecName: Full=50S ribosomal protein L28
 gi|67461531|sp|Q8F483|RL28_LEPIN RecName: Full=50S ribosomal protein L28
 gi|24195881|gb|AAN49361.1| 50S ribosomal protein L28 [Leptospira interrogans serovar Lai
          str. 56601]
 gi|45600866|gb|AAS70349.1| 50S ribosomal protein L28 [Leptospira interrogans serovar
          Copenhageni str. Fiocruz L1-130]
          Length = 94

 Score = 78.9 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 23/63 (36%), Positives = 40/63 (63%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+R CE+T +  +SGN VSH++ KTRR +  NL +  +  +   +   +R+S  ALR++ 
Sbjct: 1  MARRCEVTGRGTVSGNNVSHSHIKTRRTWKVNLIKKRIFLEDENRWVTIRLSTRALRTLR 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|303326851|ref|ZP_07357293.1| ribosomal protein L28 [Desulfovibrio sp. 3_1_syn3]
 gi|302862839|gb|EFL85771.1| ribosomal protein L28 [Desulfovibrio sp. 3_1_syn3]
          Length = 78

 Score = 78.9 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 23/58 (39%), Positives = 29/58 (50%), Gaps = 1/58 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS 58
          MS+ C+   K    GN VSH+N KT+RRF PNL R+            L +    LRS
Sbjct: 10 MSKECDFCGKKPQVGNLVSHSNIKTKRRFNPNLQRVRHQFPD-GSVRTLTVCTRCLRS 66


>gi|207721440|ref|YP_002251881.1| 50s ribosomal protein l28 [Ralstonia solanacearum MolK2]
 gi|207742579|ref|YP_002258971.1| 50s ribosomal protein l28 [Ralstonia solanacearum IPO1609]
 gi|206586600|emb|CAQ17187.1| 50s ribosomal protein l28 [Ralstonia solanacearum MolK2]
 gi|206593973|emb|CAQ60900.1| 50s ribosomal protein l28 [Ralstonia solanacearum IPO1609]
          Length = 65

 Score = 78.9 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 26/63 (41%), Positives = 38/63 (60%), Gaps = 1/63 (1%)

Query: 13 MSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFLSNS 72
          M GN VSHANNKT+RRFLPNL       +   +   LR+S   LR ++++G +D  L++ 
Sbjct: 1  MVGNNVSHANNKTKRRFLPNLQNRRFWVESENRWVSLRVSNAGLRLIDKKG-IDEVLADL 59

Query: 73 KKE 75
          +  
Sbjct: 60 RAR 62


>gi|29346326|ref|NP_809829.1| 50S ribosomal protein L28 [Bacteroides thetaiotaomicron VPI-5482]
 gi|253568251|ref|ZP_04845662.1| 50S ribosomal protein L28 [Bacteroides sp. 1_1_6]
 gi|67461521|sp|Q8A999|RL28_BACTN RecName: Full=50S ribosomal protein L28
 gi|29338221|gb|AAO76023.1| 50S ribosomal protein L28 [Bacteroides thetaiotaomicron VPI-5482]
 gi|251842324|gb|EES70404.1| 50S ribosomal protein L28 [Bacteroides sp. 1_1_6]
          Length = 86

 Score = 78.9 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 23/75 (30%), Positives = 39/75 (52%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS++C++T K  M GN VSH+  +T+R F  NL          +    L +    LR + 
Sbjct: 1  MSKICQITGKKAMIGNNVSHSKRRTKRTFDLNLFNKKFYYVEQDCWISLSLCANGLRIIN 60

Query: 61 RQGGLDRFLSNSKKE 75
          ++G LD  L+++  +
Sbjct: 61 KKG-LDAALNDAVAK 74


>gi|52632406|gb|AAH02293.2| Mitochondrial ribosomal protein L28 [Mus musculus]
          Length = 267

 Score = 78.9 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 17/98 (17%), Positives = 49/98 (50%), Gaps = 4/98 (4%)

Query: 2   SRVCELTKKTVMSGNKVSHANN---KTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS 58
           S+      + ++ G + ++ +    + ++ + P L    L S+I+++K+ + ++   L  
Sbjct: 85  SQQGLWGGEGLILGYRYANNDKLSKRVKKVWKPQLFTRELYSEILDKKFTVTVTMRTLDL 144

Query: 59  VERQGGLDRFLSNSKKENL-SARMRTLRSQILKKMSEK 95
           ++   G D ++  + KE+L S     L+  +L +++ +
Sbjct: 145 IDEAYGFDFYILKTPKEDLGSKFGMDLKRGMLLRLARQ 182


>gi|302546717|ref|ZP_07299059.1| ribosomal protein L28 [Streptomyces hygroscopicus ATCC 53653]
 gi|302464335|gb|EFL27428.1| ribosomal protein L28 [Streptomyces himastatinicus ATCC 53653]
          Length = 78

 Score = 78.9 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 20/63 (31%), Positives = 35/63 (55%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS  C+LT +    G K+SH++ +T+RRF PN+ R         +  +L +S   +++V+
Sbjct: 1  MSAHCQLTGRQPGFGQKISHSHRRTKRRFDPNIQRKRYWLPSEGRHVRLTLSTKGIKTVD 60

Query: 61 RQG 63
            G
Sbjct: 61 VIG 63


>gi|330467292|ref|YP_004405035.1| ribosomal protein L28 [Verrucosispora maris AB-18-032]
 gi|328810263|gb|AEB44435.1| ribosomal protein L28 [Verrucosispora maris AB-18-032]
          Length = 78

 Score = 78.9 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 23/63 (36%), Positives = 36/63 (57%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR C++T      GN VSH++ +TRRR+ PNL           +   L ++  AL++V+
Sbjct: 1  MSRRCDVTGAKPSFGNAVSHSHRRTRRRWNPNLQNHRYWLPSERRWVSLTLTAKALKTVD 60

Query: 61 RQG 63
          R+G
Sbjct: 61 RKG 63


>gi|111022583|ref|YP_705555.1| 50S ribosomal protein L28 [Rhodococcus jostii RHA1]
 gi|110822113|gb|ABG97397.1| 50S ribosomal protein L28 [Rhodococcus jostii RHA1]
          Length = 78

 Score = 78.9 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 18/75 (24%), Positives = 40/75 (53%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS  C++T +    G  VSH++ +T RR+ PN+ + T       ++  L +S   +++++
Sbjct: 1  MSAHCQVTGRQPGFGKSVSHSHKRTNRRWDPNIQKKTYFLPSEGRRVTLTLSAKGIKTID 60

Query: 61 RQGGLDRFLSNSKKE 75
          R G ++  ++  +  
Sbjct: 61 RDG-IEAVVARIRAR 74


>gi|308178360|ref|YP_003917766.1| 50S ribosomal protein L28 [Arthrobacter arilaitensis Re117]
 gi|307745823|emb|CBT76795.1| 50S ribosomal protein L28 [Arthrobacter arilaitensis Re117]
          Length = 78

 Score = 78.5 bits (193), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 22/84 (26%), Positives = 46/84 (54%), Gaps = 6/84 (7%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+ VC++T  T   G+ +SH++ + +RRF PN+ + T     + +K  L +S   ++ ++
Sbjct: 1  MAAVCQVTGTTPAFGHSISHSHRRNKRRFDPNIQKKTYYVPSLRRKVTLTLSVKGIKVID 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTL 84
           +G +D  ++     +L A+   L
Sbjct: 61 ARG-IDAVIA-----DLIAKGVKL 78


>gi|73959215|ref|XP_537023.2| PREDICTED: similar to mitochondrial ribosomal protein L28 isoform 1
           [Canis familiaris]
          Length = 257

 Score = 78.5 bits (193), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 16/93 (17%), Positives = 44/93 (47%), Gaps = 4/93 (4%)

Query: 7   LTKKTVMSGNKV--SHAN-NKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQG 63
              +  + G +    H    + ++ + P L +  L S+I++ K+ + ++   L  ++   
Sbjct: 81  WGGEGWVVGYRYVGDHQLSKRVKKVWKPQLLQRELYSEILDTKFAVTVTARTLDLIDAAY 140

Query: 64  GLDRFLSNSKKENL-SARMRTLRSQILKKMSEK 95
           G D ++  + +E+L S     L+  +L +++ +
Sbjct: 141 GFDFYILKTPEEDLCSKFGMDLKRGMLLRLARQ 173


>gi|51873998|gb|AAH80753.1| Mrpl28 protein [Mus musculus]
          Length = 258

 Score = 78.5 bits (193), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 17/98 (17%), Positives = 49/98 (50%), Gaps = 4/98 (4%)

Query: 2   SRVCELTKKTVMSGNKVSHANN---KTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS 58
           S+      + ++ G + ++ +    + ++ + P L    L S+I+++K+ + ++   L  
Sbjct: 76  SQQGLWGGEGLILGYRYANNDKLSKRVKKVWKPQLFTRELYSEILDKKFTVTVTMRTLDL 135

Query: 59  VERQGGLDRFLSNSKKENL-SARMRTLRSQILKKMSEK 95
           ++   G D ++  + KE+L S     L+  +L +++ +
Sbjct: 136 IDEAYGFDFYILKTPKEDLGSKFGMDLKRGMLLRLARQ 173


>gi|26787989|ref|NP_077189.2| 39S ribosomal protein L28, mitochondrial precursor [Mus musculus]
 gi|85695427|sp|Q9D1B9|RM28_MOUSE RecName: Full=39S ribosomal protein L28, mitochondrial;
           Short=L28mt; Short=MRP-L28; Flags: Precursor
 gi|74190253|dbj|BAE37227.1| unnamed protein product [Mus musculus]
 gi|148690541|gb|EDL22488.1| mitochondrial ribosomal protein L28 [Mus musculus]
 gi|148877513|gb|AAI45681.1| Mitochondrial ribosomal protein L28 [Mus musculus]
 gi|148877515|gb|AAI45683.1| Mitochondrial ribosomal protein L28 [Mus musculus]
          Length = 257

 Score = 78.5 bits (193), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 17/98 (17%), Positives = 49/98 (50%), Gaps = 4/98 (4%)

Query: 2   SRVCELTKKTVMSGNKVSHANN---KTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS 58
           S+      + ++ G + ++ +    + ++ + P L    L S+I+++K+ + ++   L  
Sbjct: 75  SQQGLWGGEGLILGYRYANNDKLSKRVKKVWKPQLFTRELYSEILDKKFTVTVTMRTLDL 134

Query: 59  VERQGGLDRFLSNSKKENL-SARMRTLRSQILKKMSEK 95
           ++   G D ++  + KE+L S     L+  +L +++ +
Sbjct: 135 IDEAYGFDFYILKTPKEDLGSKFGMDLKRGMLLRLARQ 172


>gi|302689635|ref|XP_003034497.1| hypothetical protein SCHCODRAFT_37408 [Schizophyllum commune
          H4-8]
 gi|300108192|gb|EFI99594.1| hypothetical protein SCHCODRAFT_37408 [Schizophyllum commune
          H4-8]
          Length = 96

 Score = 78.5 bits (193), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 27/77 (35%), Positives = 43/77 (55%), Gaps = 1/77 (1%)

Query: 9  KKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRF 68
           KT   GN V H+  KTRR +LPN+   T+ S+ +    +L+I+  A+R+V++ GGLD +
Sbjct: 21 GKTKRYGNNVPHSMQKTRRTWLPNIRSKTMHSESLG-LMKLKITTTAMRAVKKMGGLDDY 79

Query: 69 LSNSKKENLSARMRTLR 85
          +  +    L      LR
Sbjct: 80 VLRTPTRKLGQLGIGLR 96


>gi|52790424|gb|AAH05797.2| Mrpl28 protein [Mus musculus]
 gi|72679514|gb|AAI00323.1| Mrpl28 protein [Mus musculus]
          Length = 267

 Score = 78.5 bits (193), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 17/98 (17%), Positives = 49/98 (50%), Gaps = 4/98 (4%)

Query: 2   SRVCELTKKTVMSGNKVSHANN---KTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS 58
           S+      + ++ G + ++ +    + ++ + P L    L S+I+++K+ + ++   L  
Sbjct: 85  SQQGLWGGEGLILGYRYANNDKLSKRVKKVWKPQLFTRELYSEILDKKFTVTVTMRTLDL 144

Query: 59  VERQGGLDRFLSNSKKENL-SARMRTLRSQILKKMSEK 95
           ++   G D ++  + KE+L S     L+  +L +++ +
Sbjct: 145 IDEAYGFDFYILKTPKEDLGSKFGMDLKRGMLLRLARQ 182


>gi|66350944|emb|CAI95596.1| mitochondrial ribosomal protein L28 [Homo sapiens]
          Length = 218

 Score = 78.5 bits (193), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 17/98 (17%), Positives = 47/98 (47%), Gaps = 4/98 (4%)

Query: 2   SRVCELTKKTVMSGNKVSHANN---KTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS 58
           S+      +  + G   ++ +    + ++ + P L      S+I+++K+ + ++   L  
Sbjct: 75  SQRGLWGGEGWILGQIYANNDKLSKRLKKVWKPQLFEREFYSEILDKKFTVTVTMRTLDL 134

Query: 59  VERQGGLDRFLSNSKKENL-SARMRTLRSQILKKMSEK 95
           ++   GLD ++  + KE+L S     L+  +L +++ +
Sbjct: 135 IDEAYGLDFYILKTPKEDLCSKFGMDLKRGMLLRLARQ 172


>gi|148242482|ref|YP_001227639.1| 50S ribosomal protein L28 [Synechococcus sp. RCC307]
 gi|166228168|sp|A5GTS7|RL28_SYNR3 RecName: Full=50S ribosomal protein L28
 gi|147850792|emb|CAK28286.1| 50S ribosomal protein L28 [Synechococcus sp. RCC307]
          Length = 78

 Score = 78.5 bits (193), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 23/84 (27%), Positives = 44/84 (52%), Gaps = 6/84 (7%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC+L+ K   +G  VSH++ +T++    NL +  L      +  +LR+S  ALR+++
Sbjct: 1  MSRVCQLSGKRANNGMAVSHSHVRTKKLQQVNLQQRRLWWAEGNRWVKLRVSTSALRTIQ 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTL 84
          ++G        +  + L   +  +
Sbjct: 61 KKG------LGAYAKELGINLAKI 78


>gi|238063057|ref|ZP_04607766.1| 50S ribosomal protein L28 [Micromonospora sp. ATCC 39149]
 gi|237884868|gb|EEP73696.1| 50S ribosomal protein L28 [Micromonospora sp. ATCC 39149]
          Length = 78

 Score = 78.5 bits (193), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 23/63 (36%), Positives = 36/63 (57%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR C++T      GN VSH++ +TRRR+ PNL           +   L ++  AL++V+
Sbjct: 1  MSRRCDVTGAKPSFGNAVSHSHRRTRRRWNPNLQNHRFWLPSQRRWVSLTLTAKALKTVD 60

Query: 61 RQG 63
          R+G
Sbjct: 61 RKG 63


>gi|212702573|ref|ZP_03310701.1| hypothetical protein DESPIG_00597 [Desulfovibrio piger ATCC
          29098]
 gi|212674014|gb|EEB34497.1| hypothetical protein DESPIG_00597 [Desulfovibrio piger ATCC
          29098]
          Length = 104

 Score = 78.5 bits (193), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 23/58 (39%), Positives = 29/58 (50%), Gaps = 1/58 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS 58
          MS+ C+   K    GN VSH+N KT+RRF PNL R+            L +    LRS
Sbjct: 35 MSKECDFCGKKPQVGNLVSHSNIKTKRRFNPNLQRVRHQF-ADGTVRTLTVCTRCLRS 91


>gi|26324321|dbj|BAB22962.2| unnamed protein product [Mus musculus]
          Length = 270

 Score = 78.2 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 17/98 (17%), Positives = 49/98 (50%), Gaps = 4/98 (4%)

Query: 2   SRVCELTKKTVMSGNKVSHANN---KTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS 58
           S+      + ++ G + ++ +    + ++ + P L    L S+I+++K+ + ++   L  
Sbjct: 88  SQQGLWGGEGLILGYRYANNDKLSKRVKKVWKPQLFTRELYSEILDKKFTVTVTMRTLDL 147

Query: 59  VERQGGLDRFLSNSKKENL-SARMRTLRSQILKKMSEK 95
           ++   G D ++  + KE+L S     L+  +L +++ +
Sbjct: 148 IDEAYGFDFYILKTPKEDLGSKFGMDLKRGMLLRLARQ 185


>gi|332239948|ref|XP_003269153.1| PREDICTED: 39S ribosomal protein L28, mitochondrial-like [Nomascus
           leucogenys]
          Length = 256

 Score = 78.2 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 18/98 (18%), Positives = 48/98 (48%), Gaps = 4/98 (4%)

Query: 2   SRVCELTKKTVMSGNKVSHANN---KTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS 58
           S+      +  + G   ++ +    + ++ + P L    L S+I+++K+ + ++   L  
Sbjct: 75  SQRGLWGGEGWILGQIYANNDKLSKRLKKVWKPQLFERELYSEILDKKFTVTVTMRTLDL 134

Query: 59  VERQGGLDRFLSNSKKENL-SARMRTLRSQILKKMSEK 95
           ++   GLD ++  + KE+L S     L+  +L +++ +
Sbjct: 135 IDEAYGLDFYILKTPKEDLCSKFGMDLKRGMLLRLARQ 172


>gi|88802661|ref|ZP_01118188.1| ribosomal protein L28 [Polaribacter irgensii 23-P]
 gi|88781519|gb|EAR12697.1| ribosomal protein L28 [Polaribacter irgensii 23-P]
          Length = 79

 Score = 78.2 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 26/63 (41%), Positives = 38/63 (60%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVCELT K  M GN VS A N+T+R+F  NL          ++   L++S  AL+++ 
Sbjct: 1  MSRVCELTGKKAMVGNNVSKALNRTKRKFDANLMTKRFFIPEEDKWITLKVSASALKNIN 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|116328129|ref|YP_797849.1| 50S ribosomal protein L28 [Leptospira borgpetersenii serovar
          Hardjo-bovis L550]
 gi|116331418|ref|YP_801136.1| 50S ribosomal protein L28 [Leptospira borgpetersenii serovar
          Hardjo-bovis JB197]
 gi|122280837|sp|Q04RU2|RL28_LEPBJ RecName: Full=50S ribosomal protein L28
 gi|122284079|sp|Q051S9|RL28_LEPBL RecName: Full=50S ribosomal protein L28
 gi|116120873|gb|ABJ78916.1| 50S Ribosomal protein L28 [Leptospira borgpetersenii serovar
          Hardjo-bovis L550]
 gi|116125107|gb|ABJ76378.1| 50S Ribosomal protein L28 [Leptospira borgpetersenii serovar
          Hardjo-bovis JB197]
          Length = 94

 Score = 78.2 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 23/63 (36%), Positives = 40/63 (63%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+R CE+T +  +SGN VSH++ KTRR +  NL +  +  +   +   +R+S  ALR++ 
Sbjct: 1  MARRCEVTGRGTVSGNNVSHSHIKTRRTWKVNLIKKRIFLEDENRWVTIRLSTRALRTLR 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|317154495|ref|YP_004122543.1| 50S ribosomal protein L28 [Desulfovibrio aespoeensis Aspo-2]
 gi|316944746|gb|ADU63797.1| ribosomal protein L28 [Desulfovibrio aespoeensis Aspo-2]
          Length = 70

 Score = 78.2 bits (192), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 34/57 (59%), Gaps = 1/57 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALR 57
          MS+VC++  K   SGN VSH++ KT+RRF+PNL ++    +   Q   ++     +R
Sbjct: 1  MSQVCDICGKGPQSGNNVSHSHIKTKRRFMPNLQKVRHQLES-GQVVSVKACTRCIR 56


>gi|326428826|gb|EGD74396.1| hypothetical protein PTSG_06407 [Salpingoeca sp. ATCC 50818]
          Length = 149

 Score = 78.2 bits (192), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 20/94 (21%), Positives = 47/94 (50%), Gaps = 1/94 (1%)

Query: 2   SRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVER 61
           S+      K ++ G K S       +R+ PN+    + S I+E+K +++++   LR +++
Sbjct: 16  SQRQLWGGKKIIFGVKSSDDKKSPIKRWEPNVISKNVYSHILEKKIKVKMTTRVLRCIDK 75

Query: 62  QGGLDRFLSNSKKENLSARMRTLRSQILKKMSEK 95
            G  D ++  +K    S     +++Q++  + +K
Sbjct: 76  AGSFDNYILKAKNLE-SQLGEDIKAQMVAALEKK 108


>gi|145595377|ref|YP_001159674.1| ribosomal protein L28 [Salinispora tropica CNB-440]
 gi|145304714|gb|ABP55296.1| LSU ribosomal protein L28P [Salinispora tropica CNB-440]
          Length = 78

 Score = 78.2 bits (192), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 23/63 (36%), Positives = 36/63 (57%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR C++T      GN VSH++ +TRRR+ PNL           +   L ++  AL++V+
Sbjct: 1  MSRRCDVTGAKPSFGNAVSHSHRRTRRRWNPNLQNHRYWLPSERRWVSLTLTAKALKTVD 60

Query: 61 RQG 63
          R+G
Sbjct: 61 RKG 63


>gi|317503232|ref|ZP_07961290.1| 50S ribosomal protein L28 [Prevotella salivae DSM 15606]
 gi|315665645|gb|EFV05254.1| 50S ribosomal protein L28 [Prevotella salivae DSM 15606]
          Length = 87

 Score = 77.8 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 22/75 (29%), Positives = 36/75 (48%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS++C++T K    G  VSH+ ++T+R F  NL               L++S   LR + 
Sbjct: 1  MSKICQITGKKAQIGCNVSHSKHRTKRSFDVNLFSKKFYYVEESCWISLKVSAAGLRLIN 60

Query: 61 RQGGLDRFLSNSKKE 75
          + G LD  L  +  +
Sbjct: 61 KVG-LDAALKQAVSK 74


>gi|318041480|ref|ZP_07973436.1| 50S ribosomal protein L28 [Synechococcus sp. CB0101]
          Length = 78

 Score = 77.8 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 23/84 (27%), Positives = 43/84 (51%), Gaps = 6/84 (7%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC+LT K   +G  VSH++ +T++    NL    L      +  +LR+S  AL++++
Sbjct: 1  MSRVCQLTGKRANNGMAVSHSHVRTKKLQQVNLQERRLWWAEGNRFVKLRVSTRALKTIQ 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTL 84
          ++G        +  + L   +  +
Sbjct: 61 KKG------LGAYAKELGINLAKI 78


>gi|317969928|ref|ZP_07971318.1| 50S ribosomal protein L28 [Synechococcus sp. CB0205]
          Length = 78

 Score = 77.8 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 23/84 (27%), Positives = 43/84 (51%), Gaps = 6/84 (7%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC+LT K   +G  VSH++ +T++    NL    L      +  +LR+S  AL++++
Sbjct: 1  MSRVCQLTGKRANNGMAVSHSHIRTKKLQQVNLQERRLWWAEGNRYVKLRVSTRALKTIQ 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTL 84
          ++G        +  + L   +  +
Sbjct: 61 KKG------LGAYAKQLGINLAKI 78


>gi|298385681|ref|ZP_06995239.1| ribosomal protein L28 [Bacteroides sp. 1_1_14]
 gi|298261822|gb|EFI04688.1| ribosomal protein L28 [Bacteroides sp. 1_1_14]
          Length = 86

 Score = 77.8 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 23/75 (30%), Positives = 39/75 (52%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS++C++T K  M GN VSH+  +T+R F  NL          +    L +    LR + 
Sbjct: 1  MSKICQITGKKAMIGNNVSHSKRRTKRNFDLNLFNKKFYYVEQDCWISLSLCANGLRIIN 60

Query: 61 RQGGLDRFLSNSKKE 75
          ++G LD  L+++  +
Sbjct: 61 KKG-LDAALNDAVAK 74


>gi|255724426|ref|XP_002547142.1| conserved hypothetical protein [Candida tropicalis MYA-3404]
 gi|240135033|gb|EER34587.1| conserved hypothetical protein [Candida tropicalis MYA-3404]
          Length = 266

 Score = 77.8 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 22/80 (27%), Positives = 43/80 (53%), Gaps = 3/80 (3%)

Query: 19  SHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFLSNS---KKE 75
           S   NKT R   PN     L S+ + +K +L+++   L+++ ++GGLD +L  S   + +
Sbjct: 106 SEFLNKTLRSHKPNAVWTKLWSETLNKKLRLKVAVKVLKTISKEGGLDAYLLKSTPGRIK 165

Query: 76  NLSARMRTLRSQILKKMSEK 95
            +  +   LR ++L+   +K
Sbjct: 166 TMGLKAWQLRYELLQAQEQK 185


>gi|333022771|ref|ZP_08450835.1| putative ribosomal protein L28 [Streptomyces sp. Tu6071]
 gi|332742623|gb|EGJ73064.1| putative ribosomal protein L28 [Streptomyces sp. Tu6071]
          Length = 78

 Score = 77.8 bits (191), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 20/63 (31%), Positives = 34/63 (53%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS  C+LT      GN+VS+++ +T RRF PN+ R         +  +L +S   +++V+
Sbjct: 1  MSAHCQLTGSKPAFGNRVSNSHRRTSRRFDPNIQRKRYWLPSEGRYVRLVLSAKGIKTVD 60

Query: 61 RQG 63
            G
Sbjct: 61 AIG 63


>gi|312130145|ref|YP_003997485.1| lsu ribosomal protein l28p [Leadbetterella byssophila DSM 17132]
 gi|311906691|gb|ADQ17132.1| LSU ribosomal protein L28P [Leadbetterella byssophila DSM 17132]
          Length = 79

 Score = 77.8 bits (191), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 26/78 (33%), Positives = 44/78 (56%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS+VC+++ K   +GN VSHANNK +R+F PNL       +      +L+++   +R++ 
Sbjct: 1  MSKVCQISGKRTRTGNHVSHANNKVKRKFYPNLKTKKFFLESEGVWVELKVATSVIRTIN 60

Query: 61 RQGGLDRFLSNSKKENLS 78
          + G     L  ++K  LS
Sbjct: 61 KNGLEKTILKAARKGTLS 78


>gi|254523115|ref|ZP_05135170.1| ribosomal protein L28 [Stenotrophomonas sp. SKA14]
 gi|219720706|gb|EED39231.1| ribosomal protein L28 [Stenotrophomonas sp. SKA14]
          Length = 67

 Score = 77.8 bits (191), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 27/63 (42%), Positives = 38/63 (60%), Gaps = 1/63 (1%)

Query: 13 MSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFLSNS 72
           +GN VSHANNKTRRRFLPNL           +  +LR+S  ALR++++ G +D  L+  
Sbjct: 2  QTGNNVSHANNKTRRRFLPNLHERRFWVASENRWVKLRVSAHALRTIDKNG-IDSVLAEL 60

Query: 73 KKE 75
          +  
Sbjct: 61 RAR 63


>gi|294656483|ref|XP_458758.2| DEHA2D06842p [Debaryomyces hansenii CBS767]
 gi|199431508|emb|CAG86902.2| DEHA2D06842p [Debaryomyces hansenii]
          Length = 269

 Score = 77.8 bits (191), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 22/78 (28%), Positives = 41/78 (52%), Gaps = 3/78 (3%)

Query: 19  SHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFLSN---SKKE 75
           S + NK+ R   PN+ +  L S+ + +    R+S   LR++ R+GGLD +L     ++ +
Sbjct: 110 SESKNKSLRAHKPNIVKAKLWSETLNKTIATRVSTTVLRTITREGGLDNYLLKDKPARVK 169

Query: 76  NLSARMRTLRSQILKKMS 93
            +  +   L+  I+KK  
Sbjct: 170 TMGLKGWNLKYDIMKKQE 187


>gi|194219444|ref|XP_001915458.1| PREDICTED: similar to mitochondrial ribosomal protein L28 [Equus
           caballus]
          Length = 258

 Score = 77.8 bits (191), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 17/93 (18%), Positives = 46/93 (49%), Gaps = 4/93 (4%)

Query: 7   LTKKTVMSGNKVSHANNKTRRR---FLPNLCRITLISDIMEQKYQLRISKCALRSVERQG 63
              +  + G++  + +  ++R    + P L +  L S+I++ K+ + ++   L  ++   
Sbjct: 80  WGGEGWILGHRYVNNDKLSKRVKNVWKPQLFQRELYSEILDTKFTVTVTMRTLDLIDEAY 139

Query: 64  GLDRFLSNSKKENL-SARMRTLRSQILKKMSEK 95
           G D ++  + KE+L S     L+  +L +++ +
Sbjct: 140 GFDFYILKTPKEDLCSKFGMDLKRGMLLRLARR 172


>gi|183220423|ref|YP_001838419.1| 50S ribosomal protein L28 [Leptospira biflexa serovar Patoc
          strain 'Patoc 1 (Paris)']
 gi|189910536|ref|YP_001962091.1| 50S ribosomal protein L28 [Leptospira biflexa serovar Patoc
          strain 'Patoc 1 (Ames)']
 gi|226732831|sp|B0SEH0|RL28_LEPBA RecName: Full=50S ribosomal protein L28
 gi|226732832|sp|B0SMJ9|RL28_LEPBP RecName: Full=50S ribosomal protein L28
 gi|167775212|gb|ABZ93513.1| 50S Ribosomal protein L28 [Leptospira biflexa serovar Patoc
          strain 'Patoc 1 (Ames)']
 gi|167778845|gb|ABZ97143.1| 50S ribosomal protein L28 [Leptospira biflexa serovar Patoc
          strain 'Patoc 1 (Paris)']
          Length = 96

 Score = 77.8 bits (191), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 20/63 (31%), Positives = 37/63 (58%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+R C +T K   +GN VSH++ K RR +  N+    +  +   +  +++IS  ALR++ 
Sbjct: 1  MARTCVVTGKGTTAGNNVSHSHKKNRRIWKVNVITKKIFLEDENRWVRVKISTRALRTLR 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|295698711|ref|YP_003603366.1| ribosomal protein L28 [Candidatus Riesia pediculicola USDA]
 gi|291157260|gb|ADD79705.1| ribosomal protein L28 [Candidatus Riesia pediculicola USDA]
          Length = 81

 Score = 77.8 bits (191), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 27/63 (42%), Positives = 39/63 (61%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR+CE+T K    GN  SH+ N T+RRFLPNL       +  ++  +LRIS   +R +E
Sbjct: 1  MSRICEITGKKSTKGNHRSHSMNATKRRFLPNLHYHKFWIEKEKRFVRLRISAKGVRIIE 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|288802432|ref|ZP_06407871.1| 50S ribosomal protein L28 [Prevotella melaninogenica D18]
 gi|302346522|ref|YP_003814820.1| ribosomal protein L28 [Prevotella melaninogenica ATCC 25845]
 gi|288334960|gb|EFC73396.1| 50S ribosomal protein L28 [Prevotella melaninogenica D18]
 gi|302151106|gb|ADK97367.1| ribosomal protein L28 [Prevotella melaninogenica ATCC 25845]
          Length = 87

 Score = 77.4 bits (190), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 24/75 (32%), Positives = 37/75 (49%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS++C++T K    G  VSH+ ++T+R F  NL              QL+IS   LR + 
Sbjct: 1  MSKICQITGKKAQIGCNVSHSKHRTKRSFDVNLFSKKFYYVEEACWIQLKISAAGLRLIN 60

Query: 61 RQGGLDRFLSNSKKE 75
          + G LD  L  +  +
Sbjct: 61 KVG-LDAALKQAVSK 74


>gi|66350942|emb|CAI95595.1| mitochondrial ribosomal protein L28 [Homo sapiens]
          Length = 256

 Score = 77.4 bits (190), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 16/98 (16%), Positives = 46/98 (46%), Gaps = 4/98 (4%)

Query: 2   SRVCELTKKTVMSGNKVSHANN---KTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS 58
           S+      +  + G   ++ +    + ++ + P L      S+I+++K+ + ++   L  
Sbjct: 75  SQRGLWGGEGWILGQIYANNDKLSKRLKKVWKPQLFEREFYSEILDKKFTVTVTMRTLDL 134

Query: 59  VERQGGLDRFLSNSKKENL-SARMRTLRSQILKKMSEK 95
           ++   GLD ++  +  E+L S     L+  +L +++ +
Sbjct: 135 IDEAYGLDFYILKASGEDLCSKFGMDLKRGMLLRLARQ 172


>gi|294791346|ref|ZP_06756503.1| ribosomal protein L28 [Scardovia inopinata F0304]
 gi|294457817|gb|EFG26171.1| ribosomal protein L28 [Scardovia inopinata F0304]
          Length = 64

 Score = 77.4 bits (190), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 18/57 (31%), Positives = 30/57 (52%), Gaps = 2/57 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALR 57
          M+  C++  K    G  VSH++ + +RRFLPNL  +    D   +  +LR+    L+
Sbjct: 1  MAARCDVCGKGPQVGYSVSHSHIRNKRRFLPNLQAVHTTVD--GRNVRLRVCTSCLK 55


>gi|91215245|ref|ZP_01252217.1| 50S ribosomal protein L28 [Psychroflexus torquis ATCC 700755]
 gi|91186850|gb|EAS73221.1| 50S ribosomal protein L28 [Psychroflexus torquis ATCC 700755]
          Length = 79

 Score = 77.4 bits (190), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 28/75 (37%), Positives = 45/75 (60%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVCELT K  MSGN VS A N+TRR+F  NL +        ++   L++S   L+++ 
Sbjct: 1  MSRVCELTGKRAMSGNNVSKALNRTRRKFSVNLVKKRFYIPGEDKWITLKVSTSILKTIN 60

Query: 61 RQGGLDRFLSNSKKE 75
          ++G +   L +++ +
Sbjct: 61 KKG-IHAVLKDARAK 74


>gi|324522525|gb|ADY48074.1| 39S ribosomal protein L28 [Ascaris suum]
          Length = 305

 Score = 77.4 bits (190), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 20/89 (22%), Positives = 49/89 (55%), Gaps = 8/89 (8%)

Query: 8   TKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDR 67
           TKK V+  + V H        + P L ++ L S+I+++  ++ +++ A R +++  G+D 
Sbjct: 118 TKKKVLPRHWVPH-------LWFPYLKQVVLYSEILDRYMKITVTERACRLIDKHFGIDF 170

Query: 68  FLSNSKKENL-SARMRTLRSQILKKMSEK 95
           +L  + + ++ S     L+ +IL  ++++
Sbjct: 171 YLLETPEIDIASKLGNKLKREILIALAKE 199


>gi|123243689|emb|CAM26404.1| mitochondrial ribosomal protein L28 [Homo sapiens]
          Length = 194

 Score = 77.4 bits (190), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 17/98 (17%), Positives = 47/98 (47%), Gaps = 4/98 (4%)

Query: 2   SRVCELTKKTVMSGNKVSHANN---KTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS 58
           S+      +  + G   ++ +    + ++ + P L      S+I+++K+ + ++   L  
Sbjct: 75  SQRGLWGGEGWILGQIYANNDKLSKRLKKVWKPQLFEREFYSEILDKKFTVTVTMRTLDL 134

Query: 59  VERQGGLDRFLSNSKKENL-SARMRTLRSQILKKMSEK 95
           ++   GLD ++  + KE+L S     L+  +L +++ +
Sbjct: 135 IDEAYGLDFYILKTPKEDLCSKFGMDLKRGMLLRLARQ 172


>gi|254281533|ref|ZP_04956501.1| ribosomal protein L28 [gamma proteobacterium NOR51-B]
 gi|219677736|gb|EED34085.1| ribosomal protein L28 [gamma proteobacterium NOR51-B]
          Length = 72

 Score = 77.4 bits (190), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 26/76 (34%), Positives = 38/76 (50%), Gaps = 6/76 (7%)

Query: 8  TKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDR 67
          T K  ++GN VSHA N+TRRRFLPNL       +   +   LR+S   +R ++++G    
Sbjct: 2  TGKRPITGNNVSHAKNRTRRRFLPNLHNHRFWVESENRFVTLRVSSKGMRVIDKRG---- 57

Query: 68 FLSNSKKENLSARMRT 83
              +    L AR   
Sbjct: 58 --IETVLAELRARGEK 71


>gi|67461390|sp|Q6AML3|RL28_DESPS RecName: Full=50S ribosomal protein L28
          Length = 64

 Score = 77.4 bits (190), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 23/58 (39%), Positives = 37/58 (63%), Gaps = 1/58 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS 58
          M++VCE+  K  ++GN VSHA+NKTRRR+LPNL ++ +         + ++    +RS
Sbjct: 1  MAKVCEICGKGPITGNNVSHAHNKTRRRWLPNLKKVRM-VTASGATVRGKVCTRCIRS 57


>gi|85859469|ref|YP_461671.1| 50S ribosomal protein L28 [Syntrophus aciditrophicus SB]
 gi|123516639|sp|Q2LTU0|RL28_SYNAS RecName: Full=50S ribosomal protein L28
 gi|85722560|gb|ABC77503.1| ribosomal protein L28 [Syntrophus aciditrophicus SB]
          Length = 65

 Score = 77.4 bits (190), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 21/58 (36%), Positives = 34/58 (58%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS 58
          MSR+C++  K  + GN VSHANNKT++ + PNL  +  +        ++++    LRS
Sbjct: 1  MSRICDVCGKGPVVGNNVSHANNKTKKVWYPNLQSLRCLDGKTGAVKRMKVCTRCLRS 58


>gi|220906054|ref|YP_002481365.1| 50S ribosomal protein L28 [Cyanothece sp. PCC 7425]
 gi|254801354|sp|B8HUV7|RL28_CYAP4 RecName: Full=50S ribosomal protein L28
 gi|219862665|gb|ACL43004.1| ribosomal protein L28 [Cyanothece sp. PCC 7425]
          Length = 78

 Score = 77.4 bits (190), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 24/68 (35%), Positives = 40/68 (58%), Gaps = 1/68 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC+LT K   +   VSH++ +T++    NL    +     ++  +LR+S  AL+++E
Sbjct: 1  MSRVCQLTGKRANNAYAVSHSHRRTKKLQEVNLQWKRIWWPQGKRWVRLRLSTKALKTLE 60

Query: 61 RQGGLDRF 68
           +G LD F
Sbjct: 61 HKG-LDSF 67


>gi|260904561|ref|ZP_05912883.1| 50S ribosomal protein L28 [Brevibacterium linens BL2]
          Length = 78

 Score = 77.4 bits (190), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 20/84 (23%), Positives = 39/84 (46%), Gaps = 6/84 (7%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+  C++T      G+ VSH+   T+RRF PN+ +       + +   L +S   ++ ++
Sbjct: 1  MAANCQVTGAVPGFGHNVSHSKRTTKRRFNPNIQKKRYFVPSLRRSVTLNLSAKGIKVID 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTL 84
           +G +D  +       L A+   L
Sbjct: 61 VRG-IDAVV-----GELIAKGVKL 78


>gi|281422460|ref|ZP_06253459.1| 50S ribosomal protein L28 [Prevotella copri DSM 18205]
 gi|281403523|gb|EFB34203.1| 50S ribosomal protein L28 [Prevotella copri DSM 18205]
          Length = 87

 Score = 77.4 bits (190), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 24/75 (32%), Positives = 38/75 (50%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS++C++T K    G  VSH+ ++T+R F  NL               L+IS   LR + 
Sbjct: 1  MSKICQITGKKAQLGCNVSHSKHRTKRSFDVNLFSKKFYYVEEGCWISLKISAAGLRLIN 60

Query: 61 RQGGLDRFLSNSKKE 75
          + G LD  L+ + K+
Sbjct: 61 KVG-LDAALNQAVKK 74


>gi|282896999|ref|ZP_06305001.1| Ribosomal protein L28 [Raphidiopsis brookii D9]
 gi|282900464|ref|ZP_06308413.1| Ribosomal protein L28 [Cylindrospermopsis raciborskii CS-505]
 gi|281194657|gb|EFA69605.1| Ribosomal protein L28 [Cylindrospermopsis raciborskii CS-505]
 gi|281197651|gb|EFA72545.1| Ribosomal protein L28 [Raphidiopsis brookii D9]
          Length = 78

 Score = 77.0 bits (189), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 21/63 (33%), Positives = 36/63 (57%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT K   +   VSH++ +TRR   PNL    +      +  +L++S  A+++++
Sbjct: 1  MSRRCELTGKKANNAMSVSHSHRRTRRLQQPNLQTKRVWWPAGNRWVKLKLSTKAIKTLD 60

Query: 61 RQG 63
           +G
Sbjct: 61 TKG 63


>gi|32423706|gb|AAP81249.1| ribosomal protein L28 [Candidatus Portiera aleyrodidarum]
          Length = 71

 Score = 77.0 bits (189), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 23/72 (31%), Positives = 44/72 (61%), Gaps = 1/72 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M++ C++T K  M GN VSH++ KTRRRF+PNL +        ++  ++ I+   +R ++
Sbjct: 1  MTKRCQITYKKPMQGNNVSHSHRKTRRRFMPNLQKHRFWIKKEKRYIKMHITTKGMRIID 60

Query: 61 RQGGLDRFLSNS 72
          + G +++ L  +
Sbjct: 61 KYG-IEKVLIKT 71


>gi|311251699|ref|XP_003124744.1| PREDICTED: 39S ribosomal protein L28, mitochondrial-like [Sus
           scrofa]
          Length = 256

 Score = 77.0 bits (189), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 16/93 (17%), Positives = 48/93 (51%), Gaps = 4/93 (4%)

Query: 7   LTKKTVMSGNKVSHANN---KTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQG 63
              +  + G++  + +    + R+ + P L +  L S+I+++++ + ++   L  +++  
Sbjct: 80  WGGEGWVLGHRYVNNDKLSKRVRKVWKPQLFQRELYSEILDKRFTVTVTMRTLDLIDQAC 139

Query: 64  GLDRFLSNSKKENL-SARMRTLRSQILKKMSEK 95
           G D ++  + KE+L S     L+  +L +++ +
Sbjct: 140 GFDFYILKTPKEDLCSKFGMDLKRGMLLRLARQ 172


>gi|326329684|ref|ZP_08196005.1| ribosomal protein L28 [Nocardioidaceae bacterium Broad-1]
 gi|325952449|gb|EGD44468.1| ribosomal protein L28 [Nocardioidaceae bacterium Broad-1]
          Length = 78

 Score = 77.0 bits (189), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 21/71 (29%), Positives = 37/71 (52%), Gaps = 1/71 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR C++T      GN    +   TRRR+  NL + T     + +K  LR+S  A++ ++
Sbjct: 1  MSRTCQVTGARPGFGNNRPWSKKATRRRWEVNLQKKTYYVPSLGRKVTLRLSTNAIKQID 60

Query: 61 RQGGLDRFLSN 71
           +G +D  ++ 
Sbjct: 61 VRG-IDAVVAE 70


>gi|256827890|ref|YP_003156618.1| 50S riboosomal protein L28 [Desulfomicrobium baculatum DSM 4028]
 gi|256577066|gb|ACU88202.1| ribosomal protein L28 [Desulfomicrobium baculatum DSM 4028]
          Length = 66

 Score = 77.0 bits (189), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 23/58 (39%), Positives = 35/58 (60%), Gaps = 1/58 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS 58
          MS+VC++  K    GN VSHANNKT+RRF+PNL  +        +  ++++    +RS
Sbjct: 1  MSKVCDICGKGPQVGNNVSHANNKTKRRFMPNLQSVRAQLKS-GEVKRMKVCTQCIRS 57


>gi|302899398|ref|XP_003048042.1| predicted protein [Nectria haematococca mpVI 77-13-4]
 gi|256728974|gb|EEU42329.1| predicted protein [Nectria haematococca mpVI 77-13-4]
          Length = 262

 Score = 77.0 bits (189), Expect = 9e-13,   Method: Composition-based stats.
 Identities = 22/85 (25%), Positives = 41/85 (48%), Gaps = 4/85 (4%)

Query: 11  TVMSGNKVS-HANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFL 69
            +  GN V+   NNK RR + PN+   +     ++   + R++   L+++ R+GGL  +L
Sbjct: 73  RIRFGNTVAEKYNNKARRFWRPNVHVKSFHLPAVDANVKTRLTLRVLKTIRREGGLQEYL 132

Query: 70  SNSKK---ENLSARMRTLRSQILKK 91
             SK    + L      LR  +++ 
Sbjct: 133 LKSKPARLKELGPGGWNLRWLLMQS 157


>gi|19112705|ref|NP_595913.1| mitochondrial ribosomal protein subunit L28 [Schizosaccharomyces
           pombe 972h-]
 gi|74626794|sp|O60091|RM24_SCHPO RecName: Full=60S ribosomal protein L24, mitochondrial; Flags:
           Precursor
 gi|3006168|emb|CAA18428.1| mitochondrial ribosomal protein subunit L28 [Schizosaccharomyces
           pombe]
          Length = 176

 Score = 77.0 bits (189), Expect = 9e-13,   Method: Composition-based stats.
 Identities = 28/92 (30%), Positives = 53/92 (57%), Gaps = 4/92 (4%)

Query: 9   KKTVMSGNK-VSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDR 67
                +GN  +    +KTRR ++PN     L S+++E+K+ L ++   LR+++++GGLD 
Sbjct: 34  GSKTEAGNNKIPKFGHKTRRVWIPNGHSKWLYSNVLEEKFHLYVTSRVLRTIDKEGGLDE 93

Query: 68  FLSN---SKKENLSARMRTLRSQILKKMSEKS 96
           +L     S+ ++L  R   LR+ +L K+  K+
Sbjct: 94  YLVKSTPSRLKSLGLRGVELRALVLHKLGAKN 125


>gi|302416479|ref|XP_003006071.1| 54S ribosomal protein L24 [Verticillium albo-atrum VaMs.102]
 gi|261355487|gb|EEY17915.1| 54S ribosomal protein L24 [Verticillium albo-atrum VaMs.102]
          Length = 259

 Score = 77.0 bits (189), Expect = 9e-13,   Method: Composition-based stats.
 Identities = 19/66 (28%), Positives = 33/66 (50%), Gaps = 1/66 (1%)

Query: 11  TVMSGNKVSHANN-KTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFL 69
            +  GN +S  +  KT R + PN+ R  L S  +    + R+S   LR++ ++GGLD ++
Sbjct: 77  RIRRGNNISSDHKVKTPRAWRPNIHRKRLWSAALGVWVRARLSLRVLRTIRKEGGLDAYV 136

Query: 70  SNSKKE 75
                 
Sbjct: 137 LKRPPC 142


>gi|126335267|ref|XP_001365154.1| PREDICTED: similar to SWI/SNF-related matrix-associated
           actin-dependent regulator of chromatin a5 [Monodelphis
           domestica]
          Length = 253

 Score = 76.6 bits (188), Expect = 9e-13,   Method: Composition-based stats.
 Identities = 18/98 (18%), Positives = 49/98 (50%), Gaps = 4/98 (4%)

Query: 2   SRVCELTKKTVMSGNKVSHANN---KTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS 58
           S+      +  + G + ++ +    + R+ + P+L    L S+I+++K++  ++   L  
Sbjct: 75  SQRGLWGGEGWIRGYRYTNNDKLSKRVRKTWKPHLYERELYSEILDKKFKTMVTMRTLDL 134

Query: 59  VERQGGLDRFLSNSKKENL-SARMRTLRSQILKKMSEK 95
           ++   G D ++  + KE+L S     L+  +L +++ +
Sbjct: 135 IDEAYGFDFYILKTPKEDLCSKFGMDLKRGMLLRLARR 172


>gi|116074818|ref|ZP_01472079.1| 50S ribosomal protein L28 [Synechococcus sp. RS9916]
 gi|116068040|gb|EAU73793.1| 50S ribosomal protein L28 [Synechococcus sp. RS9916]
          Length = 78

 Score = 76.6 bits (188), Expect = 9e-13,   Method: Composition-based stats.
 Identities = 20/63 (31%), Positives = 38/63 (60%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC+LT     +G  VSH++ +T++    NL +  L      +  +LR++  AL++++
Sbjct: 1  MSRVCQLTGTRANNGMAVSHSHIRTKKLQQANLQQRRLWWAEGNRWVKLRVTTRALKTIQ 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|21672371|ref|NP_660438.1| 50S ribosomal protein L28 [Buchnera aphidicola str. Sg
          (Schizaphis graminum)]
 gi|25009086|sp|Q8KA33|RL28_BUCAP RecName: Full=50S ribosomal protein L28
 gi|21622976|gb|AAM67649.1| 50S ribosomal protein L28 [Buchnera aphidicola str. Sg
          (Schizaphis graminum)]
          Length = 78

 Score = 76.6 bits (188), Expect = 9e-13,   Method: Composition-based stats.
 Identities = 24/63 (38%), Positives = 39/63 (61%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR+C++T+K  M GN  SHA N  +R+FLPN+          ++  +LRIS   +R ++
Sbjct: 1  MSRICQVTRKKRMIGNNRSHAMNAKKRQFLPNIQYHRFWIPEEKRFIKLRISAHGMRCID 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|226365090|ref|YP_002782873.1| 50S ribosomal protein L28 [Rhodococcus opacus B4]
 gi|226243580|dbj|BAH53928.1| 50S ribosomal protein L28 [Rhodococcus opacus B4]
          Length = 78

 Score = 76.6 bits (188), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 19/75 (25%), Positives = 41/75 (54%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS  C++T +    G  VSH++ +T RR+ PN+ + T +     ++  L +S   +++V+
Sbjct: 1  MSAHCQVTGRKPGFGKSVSHSHKRTNRRWDPNIQKKTYLLPSEGRRITLTLSAKGIKTVD 60

Query: 61 RQGGLDRFLSNSKKE 75
          R G ++  ++  +  
Sbjct: 61 RDG-IEAVVARIRAR 74


>gi|56758908|gb|AAW27594.1| SJCHGC01033 protein [Schistosoma japonicum]
 gi|226482518|emb|CAX73858.1| 39S ribosomal protein L28, mitochondrial precursor [Schistosoma
           japonicum]
 gi|226482520|emb|CAX73859.1| 39S ribosomal protein L28, mitochondrial precursor [Schistosoma
           japonicum]
          Length = 260

 Score = 76.6 bits (188), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 19/95 (20%), Positives = 44/95 (46%), Gaps = 2/95 (2%)

Query: 2   SRVCELTKKTVMSGNKVSHANN-KTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
           S+ C    + ++ G         K  + + P L      S+I+++   + +S  AL+ +E
Sbjct: 69  SQKCLWGGEGIIQGYWEKKNQRPKFPKAWRPVLMENLFYSEILDRWMVIIVSDSALKQIE 128

Query: 61  RQGGLDRFLSNSKKENLSAR-MRTLRSQILKKMSE 94
             GG D ++ ++ +  L +R    L+  +L  +++
Sbjct: 129 NAGGFDFYILSTPQSKLKSRLGMHLKRDMLVTLAK 163


>gi|83814500|ref|YP_444179.1| ribosomal protein L28 [Salinibacter ruber DSM 13855]
 gi|123529898|sp|Q2S6K2|RL28_SALRD RecName: Full=50S ribosomal protein L28
 gi|83755894|gb|ABC44007.1| ribosomal protein L28 [Salinibacter ruber DSM 13855]
          Length = 78

 Score = 76.6 bits (188), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 21/75 (28%), Positives = 42/75 (56%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+R  ++T +  ++GN VS +N KT RRF  NL          ++  +L++S   L+++ 
Sbjct: 1  MARKDDVTGEGPVTGNSVSDSNQKTNRRFKRNLHEKRFYIPSEDRHVKLKVSSKTLKTIN 60

Query: 61 RQGGLDRFLSNSKKE 75
          ++G +   L  ++K+
Sbjct: 61 KKG-IQAVLEEARKQ 74


>gi|78212935|ref|YP_381714.1| 50S ribosomal protein L28 [Synechococcus sp. CC9605]
 gi|260434887|ref|ZP_05788857.1| ribosomal protein L28 [Synechococcus sp. WH 8109]
 gi|123578150|sp|Q3AJS3|RL28_SYNSC RecName: Full=50S ribosomal protein L28
 gi|78197394|gb|ABB35159.1| ribosomal protein L28 [Synechococcus sp. CC9605]
 gi|260412761|gb|EEX06057.1| ribosomal protein L28 [Synechococcus sp. WH 8109]
          Length = 78

 Score = 76.6 bits (188), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 21/84 (25%), Positives = 44/84 (52%), Gaps = 6/84 (7%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC+LT     +G  VSH++ +T++    NL +  L      +  +LR++  AL++++
Sbjct: 1  MSRVCQLTGTRANNGMAVSHSHIRTKKLQQANLQQRRLWWAEGNRWVKLRVTTRALKTIQ 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTL 84
          ++G        +  ++L   +  +
Sbjct: 61 KKG------LGAYAKSLGINLAKI 78


>gi|296083696|emb|CBI23685.3| unnamed protein product [Vitis vinifera]
          Length = 118

 Score = 76.6 bits (188), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 23/70 (32%), Positives = 38/70 (54%), Gaps = 1/70 (1%)

Query: 3   RVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQ 62
           RVC  T K     NKVS +N+KT++    NL    +  +  ++  +LR+S  AL+++E+ 
Sbjct: 43  RVCPFTGKKANKANKVSFSNHKTKKLQFVNLQYKKIWWEAGKRYVKLRLSTKALKTIEKN 102

Query: 63  GGLDRFLSNS 72
           G LD     +
Sbjct: 103 G-LDAVAKKA 111


>gi|116793346|gb|ABK26715.1| unknown [Picea sitchensis]
          Length = 148

 Score = 76.2 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 26/71 (36%), Positives = 42/71 (59%), Gaps = 1/71 (1%)

Query: 2   SRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVER 61
           SRVC LT K   + NKVS +N+KT++    NL    +  +  ++  +LRIS  AL+++E+
Sbjct: 72  SRVCPLTGKRANNANKVSFSNHKTKKLQGVNLQYKRIWWEAGKRFVKLRISTKALKTIEK 131

Query: 62  QGGLDRFLSNS 72
           +G LD     +
Sbjct: 132 KG-LDAMAKKA 141


>gi|194476650|ref|YP_002048829.1| 50S ribosomal protein L28 [Paulinella chromatophora]
 gi|171191657|gb|ACB42619.1| 50S ribosomal protein L28 [Paulinella chromatophora]
          Length = 78

 Score = 76.2 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 24/63 (38%), Positives = 38/63 (60%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC+LT K   +G  VSH++ +T++    NL    L      +  +LRIS  ALR+++
Sbjct: 1  MSRVCQLTGKRANNGMAVSHSHIRTKKLQQVNLQARRLWWTEGNRWIKLRISTRALRTIQ 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|332707891|ref|ZP_08427904.1| LSU ribosomal protein L28P [Lyngbya majuscula 3L]
 gi|332353331|gb|EGJ32858.1| LSU ribosomal protein L28P [Lyngbya majuscula 3L]
          Length = 78

 Score = 76.2 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 21/63 (33%), Positives = 39/63 (61%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR C+LT K   +G  VSH++ +T+R    NL    +  +  ++  +LRIS  A+++++
Sbjct: 1  MSRRCQLTGKKANNGYAVSHSHRRTKRLQNVNLQVKRVWWEEGKRWVKLRISTKAIKTLQ 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|126133881|ref|XP_001383465.1| hypothetical protein PICST_43496 [Scheffersomyces stipitis CBS
           6054]
 gi|126095614|gb|ABN65436.1| predicted protein [Scheffersomyces stipitis CBS 6054]
          Length = 266

 Score = 76.2 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 23/75 (30%), Positives = 45/75 (60%), Gaps = 3/75 (4%)

Query: 19  SHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFLSNSK---KE 75
           S + NK  R  LPN+ +  L S+ +++   +++S   L+++ ++GGLD +L+ +K   ++
Sbjct: 106 SESGNKGLRVHLPNIQKTKLWSETLQKSIPIKVSTKVLKTITKEGGLDNYLTKNKPSREK 165

Query: 76  NLSARMRTLRSQILK 90
            L  +   LR Q+LK
Sbjct: 166 TLGLKGWQLRYQVLK 180


>gi|108801694|ref|YP_641891.1| 50S ribosomal protein L28 [Mycobacterium sp. MCS]
 gi|119870845|ref|YP_940797.1| 50S ribosomal protein L28 [Mycobacterium sp. KMS]
 gi|126437680|ref|YP_001073371.1| 50S ribosomal protein L28 [Mycobacterium sp. JLS]
 gi|108772113|gb|ABG10835.1| LSU ribosomal protein L28P [Mycobacterium sp. MCS]
 gi|119696934|gb|ABL94007.1| LSU ribosomal protein L28P [Mycobacterium sp. KMS]
 gi|126237480|gb|ABO00881.1| LSU ribosomal protein L28P [Mycobacterium sp. JLS]
          Length = 78

 Score = 76.2 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 23/73 (31%), Positives = 43/73 (58%), Gaps = 1/73 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS  C++T ++   GN+VSH++ +TRRR+ PN+   T       ++  LR+S   ++ ++
Sbjct: 1  MSAHCQVTGRSPGFGNRVSHSHRRTRRRWRPNIQTKTYYVPSEGRRVTLRVSAKGIKVID 60

Query: 61 RQGGLDRFLSNSK 73
          R G +D  L+  +
Sbjct: 61 RDG-IDAVLARIR 72


>gi|288801234|ref|ZP_06406689.1| 50S ribosomal protein L28 [Prevotella sp. oral taxon 299 str.
          F0039]
 gi|288331845|gb|EFC70328.1| 50S ribosomal protein L28 [Prevotella sp. oral taxon 299 str.
          F0039]
          Length = 87

 Score = 76.2 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 23/75 (30%), Positives = 37/75 (49%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS++C++T K    G  VSH+ ++T+R F  NL +             L+IS   LR + 
Sbjct: 1  MSKICQITGKKAQIGCNVSHSKHRTKRSFDVNLFKKKFYYVEEACWISLKISAAGLRLIN 60

Query: 61 RQGGLDRFLSNSKKE 75
          + G LD  L  +  +
Sbjct: 61 KVG-LDAALRQAVSK 74


>gi|254491381|ref|ZP_05104560.1| ribosomal protein L28 [Methylophaga thiooxidans DMS010]
 gi|224462859|gb|EEF79129.1| ribosomal protein L28 [Methylophaga thiooxydans DMS010]
          Length = 66

 Score = 76.2 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 26/63 (41%), Positives = 41/63 (65%), Gaps = 1/63 (1%)

Query: 13 MSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFLSNS 72
          MSGN VSHA+NKT+RRFLPNL    +  +   +  +LR+S   LR ++++G +D  L++ 
Sbjct: 1  MSGNNVSHAHNKTKRRFLPNLHSHRIWVESENRWVKLRVSNHGLRIIDKKG-IDAVLTDM 59

Query: 73 KKE 75
          +  
Sbjct: 60 RAR 62


>gi|62858289|ref|NP_001016451.1| mitochondrial ribosomal protein L28 [Xenopus (Silurana) tropicalis]
 gi|213624104|gb|AAI70649.1| mitochondrial ribosomal protein L28 [Xenopus (Silurana) tropicalis]
 gi|213627055|gb|AAI70655.1| mitochondrial ribosomal protein L28 [Xenopus (Silurana) tropicalis]
          Length = 254

 Score = 76.2 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 15/93 (16%), Positives = 46/93 (49%), Gaps = 4/93 (4%)

Query: 7   LTKKTVMSGNKVSHANN---KTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQG 63
              +  ++G + ++ +    + ++ + P L    L S+I+++ + + ++   L  ++   
Sbjct: 80  WGGEGWVTGYRYANNDKLSARVKKVWKPQLFTRELHSEILDKTFSITVTMRTLDLIDAAY 139

Query: 64  GLDRFLSNSKKENL-SARMRTLRSQILKKMSEK 95
           G D ++  + KE+L S     L+  +L +++ +
Sbjct: 140 GFDFYILKTPKEDLNSKFGMDLKRAMLMRLASR 172


>gi|255642185|gb|ACU21357.1| unknown [Glycine max]
          Length = 136

 Score = 76.2 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 23/70 (32%), Positives = 38/70 (54%), Gaps = 1/70 (1%)

Query: 3   RVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQ 62
           RVC  T K     NKVS +N+KT++    NL    +  +  ++  +LR+S  AL+++E+ 
Sbjct: 61  RVCPFTGKKSNRANKVSFSNHKTKKLQFVNLQYKRIWWEAGKRYVKLRLSTKALKTIEKN 120

Query: 63  GGLDRFLSNS 72
           G LD     +
Sbjct: 121 G-LDAVAKKA 129


>gi|328774136|gb|EGF84173.1| hypothetical protein BATDEDRAFT_21979 [Batrachochytrium
           dendrobatidis JAM81]
          Length = 185

 Score = 76.2 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 24/89 (26%), Positives = 46/89 (51%), Gaps = 1/89 (1%)

Query: 10  KTVMSGNKVSHA-NNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRF 68
           K +  G +VS A  N++RR + PN+  I+L S  ++     RIS  ALR ++ +GG D +
Sbjct: 49  KKITFGEQVSEAGKNRSRRVWYPNVQYISLYSRALDMNIWTRISTAALREIDHKGGFDEY 108

Query: 69  LSNSKKENLSARMRTLRSQILKKMSEKSS 97
           + +   + L   +  +    + K  + ++
Sbjct: 109 IISVADKLLPCEIAKMYRDRILKQYDANT 137


>gi|94265179|ref|ZP_01288941.1| Ribosomal protein L28 [delta proteobacterium MLMS-1]
 gi|93454320|gb|EAT04627.1| Ribosomal protein L28 [delta proteobacterium MLMS-1]
          Length = 64

 Score = 76.2 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 23/58 (39%), Positives = 36/58 (62%), Gaps = 1/58 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS 58
          MS++CE+  K    GN +SHA+NKTRRR+LPNL ++ +         ++++    LRS
Sbjct: 1  MSKICEVCGKKPEVGNNISHAHNKTRRRWLPNLQQVRVA-GAGGNSRRVKVCTRCLRS 57


>gi|145221904|ref|YP_001132582.1| ribosomal protein L28 [Mycobacterium gilvum PYR-GCK]
 gi|315446360|ref|YP_004079239.1| 50S ribosomal protein L28P [Mycobacterium sp. Spyr1]
 gi|145214390|gb|ABP43794.1| LSU ribosomal protein L28P [Mycobacterium gilvum PYR-GCK]
 gi|315264663|gb|ADU01405.1| LSU ribosomal protein L28P [Mycobacterium sp. Spyr1]
          Length = 78

 Score = 76.2 bits (187), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 22/63 (34%), Positives = 37/63 (58%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS  C++T +    GN VSH++ +TRRR+ PN+ R T       ++  LR+S   ++ ++
Sbjct: 1  MSAHCQVTGRKPGFGNAVSHSHRRTRRRWDPNIQRKTYYLPSEGRRITLRVSTKGIKIID 60

Query: 61 RQG 63
          R G
Sbjct: 61 RDG 63


>gi|301769583|ref|XP_002920238.1| PREDICTED: 39S ribosomal protein L28, mitochondrial-like
           [Ailuropoda melanoleuca]
          Length = 256

 Score = 76.2 bits (187), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 16/93 (17%), Positives = 47/93 (50%), Gaps = 4/93 (4%)

Query: 7   LTKKTVMSGNKVSHANN---KTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQG 63
              +  + G++  + +    + ++ + P L +  L S+I++ K+ + +++  L  ++   
Sbjct: 80  WGGEGWILGHRYINNDKLSKRVKKVWKPQLFQRELYSEILDTKFTVTVTQRTLDLIDEAY 139

Query: 64  GLDRFLSNSKKENL-SARMRTLRSQILKKMSEK 95
           G D ++  + KE+L S     L+  +L +++ +
Sbjct: 140 GFDLYILKTPKEDLCSKFGMDLKRGMLLRLARQ 172


>gi|50546210|ref|XP_500626.1| YALI0B08074p [Yarrowia lipolytica]
 gi|49646492|emb|CAG82867.1| YALI0B08074p [Yarrowia lipolytica]
          Length = 299

 Score = 76.2 bits (187), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 23/86 (26%), Positives = 44/86 (51%), Gaps = 3/86 (3%)

Query: 9   KKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRF 68
            +T+ +G + S   NKT R++ PN  + TL S+ + +  ++      L ++ R+GGLD +
Sbjct: 92  GRTLGNGYRSSEFRNKTLRKWKPNAQKTTLPSEALGKNVRITTVPRVLSTIRREGGLDAY 151

Query: 69  LSNS---KKENLSARMRTLRSQILKK 91
           L+     + + +      LR +IL  
Sbjct: 152 LTKDTPLRIKEIGVFGWNLRHKILSA 177


>gi|225433211|ref|XP_002285387.1| PREDICTED: hypothetical protein [Vitis vinifera]
          Length = 146

 Score = 76.2 bits (187), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 23/70 (32%), Positives = 38/70 (54%), Gaps = 1/70 (1%)

Query: 3   RVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQ 62
           RVC  T K     NKVS +N+KT++    NL    +  +  ++  +LR+S  AL+++E+ 
Sbjct: 71  RVCPFTGKKANKANKVSFSNHKTKKLQFVNLQYKKIWWEAGKRYVKLRLSTKALKTIEKN 130

Query: 63  GGLDRFLSNS 72
           G LD     +
Sbjct: 131 G-LDAVAKKA 139


>gi|299139061|ref|ZP_07032237.1| ribosomal protein L28 [Acidobacterium sp. MP5ACTX8]
 gi|298598741|gb|EFI54903.1| ribosomal protein L28 [Acidobacterium sp. MP5ACTX8]
          Length = 62

 Score = 75.8 bits (186), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 19/58 (32%), Positives = 35/58 (60%), Gaps = 2/58 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS 58
          M++VCEL  K    GN +SHA+N TRRR+ PNL  +  +++      ++++    +++
Sbjct: 1  MAQVCELCGKGPQFGNNISHAHNVTRRRWNPNLQSVKALTN--GATKRVKVCTSCIKT 56


>gi|255575833|ref|XP_002528814.1| 50S ribosomal protein L28, chloroplast precursor, putative [Ricinus
           communis]
 gi|223531726|gb|EEF33548.1| 50S ribosomal protein L28, chloroplast precursor, putative [Ricinus
           communis]
          Length = 143

 Score = 75.8 bits (186), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 25/78 (32%), Positives = 42/78 (53%), Gaps = 2/78 (2%)

Query: 3   RVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQ 62
           RVC  T K     NKVS +N+KT++    NL    +  +  ++  +LR+S  AL+++E+ 
Sbjct: 68  RVCPFTGKKANRANKVSFSNHKTKKLQFVNLQYKKIWWEAGKRYVKLRLSTKALKTIEKN 127

Query: 63  GGLDRFLSNSKKENLSAR 80
           G LD     +   +LS +
Sbjct: 128 G-LDAVAKKAGI-DLSKK 143


>gi|148229105|ref|NP_001087550.1| 39S ribosomal protein L28, mitochondrial precursor [Xenopus laevis]
 gi|82181742|sp|Q68EV6|RM28_XENLA RecName: Full=39S ribosomal protein L28, mitochondrial;
           Short=L28mt; Short=MRP-L28; Flags: Precursor
 gi|51261504|gb|AAH80094.1| MGC84279 protein [Xenopus laevis]
          Length = 253

 Score = 75.8 bits (186), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 16/100 (16%), Positives = 50/100 (50%), Gaps = 4/100 (4%)

Query: 2   SRVCELTKKTVMSGNKVSHANN---KTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS 58
           +       +  ++G   ++ +    + ++ + P L +  L S+I+++K+ + ++   L  
Sbjct: 75  ANKGLWGGEGWVTGYHYANNDKLSARVKKVWKPQLFKRELYSEILDKKFSITVTMRTLDL 134

Query: 59  VERQGGLDRFLSNSKKENLSAR-MRTLRSQILKKMSEKSS 97
           ++   G D ++  + KE+L+++     +  +L +++ K S
Sbjct: 135 IDAAYGFDFYILKTPKEDLNSKVGMDFKRAMLMRLASKDS 174


>gi|118489930|gb|ABK96762.1| unknown [Populus trichocarpa x Populus deltoides]
          Length = 153

 Score = 75.8 bits (186), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 22/70 (31%), Positives = 38/70 (54%), Gaps = 1/70 (1%)

Query: 3   RVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQ 62
           R+C  T K     NKVS +N+KT++    NL    +  +  ++  +LR+S  AL+++E+ 
Sbjct: 78  RICPFTGKKANRANKVSFSNHKTKKLQFVNLQYKRVWWEAGKRYVKLRLSTKALKTIEKN 137

Query: 63  GGLDRFLSNS 72
           G LD     +
Sbjct: 138 G-LDAVAKKA 146


>gi|302538030|ref|ZP_07290372.1| ribosomal protein L28 [Streptomyces sp. C]
 gi|302446925|gb|EFL18741.1| ribosomal protein L28 [Streptomyces sp. C]
          Length = 78

 Score = 75.8 bits (186), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 18/63 (28%), Positives = 32/63 (50%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS  C+L       G  +SH++ +T RRF PN+           +  +L++S  A+++V+
Sbjct: 1  MSAHCQLIGAQPGFGKNISHSHRRTSRRFDPNIQSKRYWLPSEGRHVRLKLSAKAIKTVD 60

Query: 61 RQG 63
            G
Sbjct: 61 VIG 63


>gi|218195912|gb|EEC78339.1| hypothetical protein OsI_18082 [Oryza sativa Indica Group]
          Length = 213

 Score = 75.8 bits (186), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 23/70 (32%), Positives = 39/70 (55%), Gaps = 1/70 (1%)

Query: 3   RVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQ 62
           R+C  T K     NKVS +N+KT+++   NL    L  +  ++  +LR+S  AL+++E+ 
Sbjct: 138 RICPFTDKKTNRANKVSFSNHKTKKQQFVNLQYKKLWWEEGKRFVKLRLSTKALKTIEKH 197

Query: 63  GGLDRFLSNS 72
           G LD     +
Sbjct: 198 G-LDAVAKKA 206


>gi|193212242|ref|YP_001998195.1| 50S ribosomal protein L28 [Chlorobaculum parvum NCIB 8327]
 gi|226738049|sp|B3QM42|RL28_CHLP8 RecName: Full=50S ribosomal protein L28
 gi|193085719|gb|ACF10995.1| ribosomal protein L28 [Chlorobaculum parvum NCIB 8327]
          Length = 72

 Score = 75.8 bits (186), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 26/63 (41%), Positives = 38/63 (60%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS+VC LT K    GN VSHANN TR RF PNL    +  +  ++  ++R+S  A++ + 
Sbjct: 1  MSKVCVLTGKKPKYGNNVSHANNHTRTRFEPNLHTKRIWIEEEKRWVKVRVSAKAMKIMS 60

Query: 61 RQG 63
          + G
Sbjct: 61 KTG 63


>gi|226493229|ref|NP_001149595.1| 50S ribosomal protein L28 [Zea mays]
 gi|223948777|gb|ACN28472.1| unknown [Zea mays]
          Length = 141

 Score = 75.8 bits (186), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 24/70 (34%), Positives = 39/70 (55%), Gaps = 1/70 (1%)

Query: 3   RVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQ 62
           RVC  T K     NKVS +N+KT+++   NL    L  +  ++  +LR+S  AL+++E+ 
Sbjct: 66  RVCPFTGKKTNRANKVSFSNHKTKKQQFVNLQYKKLWWEAGKRFVKLRLSTKALKTIEKH 125

Query: 63  GGLDRFLSNS 72
           G LD     +
Sbjct: 126 G-LDAVARKA 134


>gi|258648345|ref|ZP_05735814.1| ribosomal protein L28 [Prevotella tannerae ATCC 51259]
 gi|260851510|gb|EEX71379.1| ribosomal protein L28 [Prevotella tannerae ATCC 51259]
          Length = 86

 Score = 75.8 bits (186), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 27/75 (36%), Positives = 40/75 (53%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS++C+LT K  M GN VS +  +T+R F  NL          E    LRIS   LR + 
Sbjct: 1  MSKICQLTGKKAMIGNNVSKSKRRTKRSFDVNLFTKKFYYVEQECWVSLRISAAGLRLIN 60

Query: 61 RQGGLDRFLSNSKKE 75
          + G LD  L+++ ++
Sbjct: 61 KVG-LDAALNSAVEK 74


>gi|78184654|ref|YP_377089.1| 50S ribosomal protein L28 [Synechococcus sp. CC9902]
 gi|116070521|ref|ZP_01467790.1| 50S ribosomal protein L28 [Synechococcus sp. BL107]
 gi|123581534|sp|Q3AXY2|RL28_SYNS9 RecName: Full=50S ribosomal protein L28
 gi|78168948|gb|ABB26045.1| LSU ribosomal protein L28P [Synechococcus sp. CC9902]
 gi|116065926|gb|EAU71683.1| 50S ribosomal protein L28 [Synechococcus sp. BL107]
          Length = 78

 Score = 75.8 bits (186), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 20/63 (31%), Positives = 38/63 (60%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC+LT     +G  VSH++ +T++    NL +  L      +  +LR++  AL++++
Sbjct: 1  MSRVCQLTGTRANNGMAVSHSHIRTKKLQQANLQQRRLWWAEGNRWIKLRVTTRALKTIQ 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|242278141|ref|YP_002990270.1| ribosomal protein L28 [Desulfovibrio salexigens DSM 2638]
 gi|259646732|sp|C6BYE0|RL28_DESAD RecName: Full=50S ribosomal protein L28
 gi|242121035|gb|ACS78731.1| ribosomal protein L28 [Desulfovibrio salexigens DSM 2638]
          Length = 70

 Score = 75.8 bits (186), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 22/58 (37%), Positives = 35/58 (60%), Gaps = 1/58 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS 58
          MS+VC++  K   +GN VSHA+NKT+RRF+PNL ++        +   ++     +RS
Sbjct: 1  MSQVCDICGKGPQTGNNVSHAHNKTKRRFMPNLQKVRTQLPS-GEVKSIKACTRCIRS 57


>gi|195628336|gb|ACG35998.1| 50S ribosomal protein L28 [Zea mays]
          Length = 141

 Score = 75.8 bits (186), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 24/70 (34%), Positives = 39/70 (55%), Gaps = 1/70 (1%)

Query: 3   RVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQ 62
           RVC  T K     NKVS +N+KT+++   NL    L  +  ++  +LR+S  AL+++E+ 
Sbjct: 66  RVCPFTGKKTNRANKVSFSNHKTKKQQFVNLQYKKLWWEAGKRFVKLRLSTKALKTIEKH 125

Query: 63  GGLDRFLSNS 72
           G LD     +
Sbjct: 126 G-LDAVARKA 134


>gi|72382145|ref|YP_291500.1| 50S ribosomal protein L28 [Prochlorococcus marinus str. NATL2A]
 gi|124025685|ref|YP_001014801.1| 50S ribosomal protein L28 [Prochlorococcus marinus str. NATL1A]
 gi|123621283|sp|Q46L31|RL28_PROMT RecName: Full=50S ribosomal protein L28
 gi|166226599|sp|A2C226|RL28_PROM1 RecName: Full=50S ribosomal protein L28
 gi|72001995|gb|AAZ57797.1| LSU ribosomal protein L28P [Prochlorococcus marinus str. NATL2A]
 gi|123960753|gb|ABM75536.1| 50S ribosomal protein L28 [Prochlorococcus marinus str. NATL1A]
          Length = 78

 Score = 75.8 bits (186), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 19/63 (30%), Positives = 38/63 (60%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC+LT     +G  VSH++ +T++    NL +  L  +   +   +R++  AL++++
Sbjct: 1  MSRVCQLTGTRANNGMSVSHSHIRTKKLQQANLQQRRLWWEEENKWINIRVTTRALKTIQ 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|400992|sp|P30956|RK28_TOBAC RecName: Full=50S ribosomal protein L28, chloroplastic; AltName:
           Full=CL28; Flags: Precursor
 gi|279656|pir||R5NT28 ribosomal protein L28 precursor, chloroplast - tobacco
 gi|189096147|pdb|3BBO|Y Chain Y, Homology Model For The Spinach Chloroplast 50s Subunit
           Fitted To 9.4a Cryo-Em Map Of The 70s Chlororibosome
 gi|20016|emb|CAA48211.1| ribosomal protein CL28 [Nicotiana tabacum]
          Length = 151

 Score = 75.5 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 24/78 (30%), Positives = 43/78 (55%), Gaps = 2/78 (2%)

Query: 3   RVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQ 62
           R+C  T K     NKVSH+N+KT++    NL    +  +  ++  +LR+S  A++++E+ 
Sbjct: 76  RICPFTGKKSNRANKVSHSNHKTKKLQFVNLQYKRIWWEAGKRYVKLRLSTKAIKTIEKN 135

Query: 63  GGLDRFLSNSKKENLSAR 80
           G LD     +   +LS +
Sbjct: 136 G-LDAVAKKAGI-DLSKK 151


>gi|256090758|ref|XP_002581348.1| hypothetical protein [Schistosoma mansoni]
 gi|238667217|emb|CAZ37587.1| conserved hypothetical protein [Schistosoma mansoni]
          Length = 248

 Score = 75.5 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 16/96 (16%), Positives = 44/96 (45%), Gaps = 2/96 (2%)

Query: 2   SRVCELTKKTVMSGNKVSHANN-KTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
           S+ C    + ++ G         +  + + P L      S+I+++   + ++  AL+ +E
Sbjct: 68  SQKCLWGGEGIIQGYWEKKNQKPRFPKTWSPVLMENLFHSEILDRWMIIIVTDSALKQIE 127

Query: 61  RQGGLDRFLSNSKKENLSAR-MRTLRSQILKKMSEK 95
           +  G D ++ ++ +  L +R    L+  +L  +++ 
Sbjct: 128 KASGFDFYILSTPESKLKSRLGMHLKRDMLVTLAKA 163


>gi|27904585|ref|NP_777711.1| 50S ribosomal protein L28 [Buchnera aphidicola str. Bp (Baizongia
          pistaciae)]
 gi|31076932|sp|Q89AY8|RL28_BUCBP RecName: Full=50S ribosomal protein L28
 gi|27903982|gb|AAO26816.1| 50S ribosomal protein L28 [Buchnera aphidicola str. Bp (Baizongia
          pistaciae)]
          Length = 74

 Score = 75.5 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 23/63 (36%), Positives = 39/63 (61%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS++C++T K  ++GN  SHA N T+RRF PNL      +   ++   LR+S   +R+++
Sbjct: 1  MSKICQITGKKPITGNNRSHAMNATKRRFFPNLHFHKFWNPKTKRFIILRVSAKGMRNID 60

Query: 61 RQG 63
          + G
Sbjct: 61 KLG 63


>gi|22296189|dbj|BAC10013.1| 50S ribosomal protein L28 [Thermosynechococcus elongatus BP-1]
          Length = 104

 Score = 75.5 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 20/63 (31%), Positives = 38/63 (60%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC+LT K   +   +SH++ +T++    NL    +     ++  +LR+S  A++++E
Sbjct: 27 MSRVCQLTGKKANNAYAISHSHRRTKKLQQVNLQWKRVWWPEGKRWVRLRLSTKAIKTLE 86

Query: 61 RQG 63
          R+G
Sbjct: 87 RKG 89


>gi|260592535|ref|ZP_05857993.1| 50S ribosomal protein L28 [Prevotella veroralis F0319]
 gi|260535581|gb|EEX18198.1| 50S ribosomal protein L28 [Prevotella veroralis F0319]
          Length = 87

 Score = 75.5 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 23/75 (30%), Positives = 37/75 (49%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS++C++T K    G  VSH+ ++T+R F  NL              +L+IS   LR + 
Sbjct: 1  MSKICQITGKKAQLGCNVSHSKHRTKRSFDVNLFSKKFYYVEESCWIELKISAAGLRLIN 60

Query: 61 RQGGLDRFLSNSKKE 75
          + G LD  L  +  +
Sbjct: 61 KVG-LDVALKQAVSK 74


>gi|221109905|ref|XP_002156837.1| PREDICTED: similar to predicted protein [Hydra magnipapillata]
          Length = 172

 Score = 75.5 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 18/87 (20%), Positives = 37/87 (42%), Gaps = 1/87 (1%)

Query: 7   LTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLD 66
                V SG   + +  KT+R + PN+      SD++ +      +  A+R+++  GG D
Sbjct: 36  WHGAGVKSGFIETFSKKKTKRFWKPNVFEREYHSDLLNETVCYTFTMKAVRAIDYAGGFD 95

Query: 67  RFLSNSKKENL-SARMRTLRSQILKKM 92
            ++  +    L S     L+ ++    
Sbjct: 96  NYILRTPDNVLVSNAAIALKRKMETVQ 122


>gi|226307890|ref|YP_002767850.1| 50S ribosomal protein L28 [Rhodococcus erythropolis PR4]
 gi|226187007|dbj|BAH35111.1| 50S ribosomal protein L28 [Rhodococcus erythropolis PR4]
          Length = 78

 Score = 75.5 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 18/63 (28%), Positives = 36/63 (57%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS  C++T +    G  VSH++ ++ RR+ PN+ R T +     ++  L +S   +++++
Sbjct: 1  MSAHCQVTGRVPGFGKSVSHSHKRSNRRWNPNIQRKTYVLPSEGRRITLTLSTKGIKTID 60

Query: 61 RQG 63
          R G
Sbjct: 61 RDG 63


>gi|145224793|ref|YP_001135471.1| 50S ribosomal protein L28 [Mycobacterium gilvum PYR-GCK]
 gi|315445123|ref|YP_004078002.1| 50S ribosomal protein L28P [Mycobacterium sp. Spyr1]
 gi|145217279|gb|ABP46683.1| LSU ribosomal protein L28P [Mycobacterium gilvum PYR-GCK]
 gi|315263426|gb|ADU00168.1| LSU ribosomal protein L28P [Mycobacterium sp. Spyr1]
          Length = 64

 Score = 75.5 bits (185), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 17/57 (29%), Positives = 30/57 (52%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALR 57
          M+ VCE+  K    G  VSH++ +T RR+ PN+  +  +S     K ++ +    L+
Sbjct: 1  MAAVCEICGKGPGFGKSVSHSHRRTSRRWNPNIQSVRAVSSPGGNKQRVNVCTSCLK 57


>gi|294787300|ref|ZP_06752553.1| ribosomal protein L28 [Parascardovia denticolens F0305]
 gi|294484656|gb|EFG32291.1| ribosomal protein L28 [Parascardovia denticolens F0305]
          Length = 64

 Score = 75.5 bits (185), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 18/57 (31%), Positives = 30/57 (52%), Gaps = 2/57 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALR 57
          M+  C++  K    G  VSH++ + +RRFLPNL  +    D   +  +LR+    L+
Sbjct: 1  MAARCDVCGKGPQVGYSVSHSHLRNKRRFLPNLQAVRATVD--GETVRLRVCTSCLK 55


>gi|56751466|ref|YP_172167.1| 50S ribosomal protein L28 [Synechococcus elongatus PCC 6301]
 gi|81298853|ref|YP_399061.1| 50S ribosomal protein L28 [Synechococcus elongatus PCC 7942]
 gi|67461292|sp|Q5N223|RL28_SYNP6 RecName: Full=50S ribosomal protein L28
 gi|123557676|sp|Q31S95|RL28_SYNE7 RecName: Full=50S ribosomal protein L28
 gi|56686425|dbj|BAD79647.1| 50S ribosomal protein L28 [Synechococcus elongatus PCC 6301]
 gi|81167734|gb|ABB56074.1| LSU ribosomal protein L28P [Synechococcus elongatus PCC 7942]
          Length = 78

 Score = 75.1 bits (184), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 21/84 (25%), Positives = 43/84 (51%), Gaps = 6/84 (7%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC+LT K   +   +SH++ +T+R    NL    +      +  +LR+S  A+++++
Sbjct: 1  MSRVCQLTGKKANNAYAISHSHRRTKRLQNVNLQEKRIWWPEGNRFVKLRLSTKAIKTLQ 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTL 84
          ++G       ++    L   ++ L
Sbjct: 61 KKG------LSAYARELGIDLKRL 78


>gi|229495046|ref|ZP_04388792.1| ribosomal protein L28 [Rhodococcus erythropolis SK121]
 gi|229317977|gb|EEN83852.1| ribosomal protein L28 [Rhodococcus erythropolis SK121]
          Length = 78

 Score = 75.1 bits (184), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 18/63 (28%), Positives = 36/63 (57%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS  C++T +    G  VSH++ ++ RR+ PN+ R T +     ++  L +S   +++++
Sbjct: 1  MSAHCQVTGRVPGFGKSVSHSHKRSNRRWNPNIQRKTYLLPSEGRRITLTLSTKGIKTID 60

Query: 61 RQG 63
          R G
Sbjct: 61 RDG 63


>gi|297848674|ref|XP_002892218.1| 50S ribosomal protein L28, chloroplast [Arabidopsis lyrata subsp.
           lyrata]
 gi|297338060|gb|EFH68477.1| 50S ribosomal protein L28, chloroplast [Arabidopsis lyrata subsp.
           lyrata]
          Length = 137

 Score = 75.1 bits (184), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 24/78 (30%), Positives = 42/78 (53%), Gaps = 2/78 (2%)

Query: 3   RVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQ 62
           R+C  T K     NKVS +N+KT++    NL    +  +  ++  +LR+S  AL+++E+ 
Sbjct: 62  RICPFTGKKANRANKVSFSNHKTKKLQFVNLQYKKVWWEAGKRFVKLRLSTKALKTIEKN 121

Query: 63  GGLDRFLSNSKKENLSAR 80
           G LD     +   +LS +
Sbjct: 122 G-LDAVAKKAGI-DLSKK 137


>gi|224110604|ref|XP_002315574.1| predicted protein [Populus trichocarpa]
 gi|222864614|gb|EEF01745.1| predicted protein [Populus trichocarpa]
          Length = 118

 Score = 75.1 bits (184), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 22/70 (31%), Positives = 38/70 (54%), Gaps = 1/70 (1%)

Query: 3   RVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQ 62
           R+C  T K     NKVS +N+KT++    NL    +  +  ++  +LR+S  AL+++E+ 
Sbjct: 43  RICPFTGKKANRANKVSFSNHKTKKLQFVNLQYKRVWWEAGKRYVKLRLSTKALKTIEKN 102

Query: 63  GGLDRFLSNS 72
           G LD     +
Sbjct: 103 G-LDAVAKKA 111


>gi|296171352|ref|ZP_06852708.1| 50S ribosomal protein L28 [Mycobacterium parascrofulaceum ATCC
          BAA-614]
 gi|295894183|gb|EFG73941.1| 50S ribosomal protein L28 [Mycobacterium parascrofulaceum ATCC
          BAA-614]
          Length = 64

 Score = 75.1 bits (184), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 14/57 (24%), Positives = 31/57 (54%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALR 57
          M+ VC++  K    G  VSH++ +T RR+ PN+  + +++     + +L +    ++
Sbjct: 1  MAAVCDICGKGPGFGKSVSHSHRRTSRRWDPNVQTVHVVTRPGGNRQRLNVCTSCIK 57


>gi|328953946|ref|YP_004371280.1| 50S ribosomal protein L28 [Desulfobacca acetoxidans DSM 11109]
 gi|328454270|gb|AEB10099.1| 50S ribosomal protein L28 [Desulfobacca acetoxidans DSM 11109]
          Length = 63

 Score = 75.1 bits (184), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 25/58 (43%), Positives = 35/58 (60%), Gaps = 2/58 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS 58
          M++ CE+  K    GN VSHANNKT+RR+LPNL R+  + +   +  Q  +    LRS
Sbjct: 1  MAKFCEICGKGPQVGNNVSHANNKTKRRWLPNLRRVRALQNGQVKYIQ--VCTRCLRS 56


>gi|198427866|ref|XP_002126303.1| PREDICTED: similar to mitochondrial ribosomal protein L28 [Ciona
           intestinalis]
          Length = 285

 Score = 75.1 bits (184), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 22/99 (22%), Positives = 47/99 (47%), Gaps = 3/99 (3%)

Query: 2   SRVCELTKKTVMSGNKVSHAN---NKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS 58
           SR      + ++ G K +       K  + + P L   TL S+I+++K++  ++   L  
Sbjct: 102 SREGLWGGEGIVWGFKYARGKKMSRKYYKVWKPQLFTRTLYSEILDKKFKTTVTGLTLDL 161

Query: 59  VERQGGLDRFLSNSKKENLSARMRTLRSQILKKMSEKSS 97
           ++   G D F+ N+    L      L+ +IL ++++K +
Sbjct: 162 IDEAYGFDFFILNTSSTVLQEFGSKLKREILLRLADKDN 200


>gi|284052089|ref|ZP_06382299.1| 50S ribosomal protein L28 [Arthrospira platensis str. Paraca]
 gi|291569882|dbj|BAI92154.1| 50S ribosomal protein L28 [Arthrospira platensis NIES-39]
          Length = 78

 Score = 75.1 bits (184), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 20/63 (31%), Positives = 38/63 (60%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC+LT K   +G  VSH++ ++ +    NL    +     ++  +LR+S  A++++E
Sbjct: 1  MSRVCQLTGKRANNGMAVSHSHRRSHKLQQANLQWKRIWWPQGKRWVRLRLSTKAIKTIE 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|319760721|ref|YP_004124659.1| 50S ribosomal protein L28 [Candidatus Blochmannia vafer str.
          BVAF]
 gi|318039435|gb|ADV33985.1| 50S ribosomal protein L28 [Candidatus Blochmannia vafer str.
          BVAF]
          Length = 82

 Score = 75.1 bits (184), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 29/83 (34%), Positives = 50/83 (60%), Gaps = 1/83 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR+C +T K  ++GNK SH+ N T+R F+PN+    +  D  ++   +RIS   LR ++
Sbjct: 1  MSRICRITGKRPINGNKRSHSMNATKRWFIPNIHYHRIWIDSKKKFCSIRISAKGLRFID 60

Query: 61 RQGGLDRFLSNSKKENLSARMRT 83
          + G +D++LSN   +N+    + 
Sbjct: 61 KLG-IDQYLSNLSSKNIKITKKK 82


>gi|51245535|ref|YP_065419.1| 50S ribosomal protein L28 [Desulfotalea psychrophila LSv54]
 gi|50876572|emb|CAG36412.1| probable 50S ribosomal protein L28 [Desulfotalea psychrophila
          LSv54]
          Length = 77

 Score = 74.7 bits (183), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 23/58 (39%), Positives = 37/58 (63%), Gaps = 1/58 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS 58
          M++VCE+  K  ++GN VSHA+NKTRRR+LPNL ++ +         + ++    +RS
Sbjct: 14 MAKVCEICGKGPITGNNVSHAHNKTRRRWLPNLKKVRM-VTASGATVRGKVCTRCIRS 70


>gi|297568236|ref|YP_003689580.1| ribosomal protein L28 [Desulfurivibrio alkaliphilus AHT2]
 gi|296924151|gb|ADH84961.1| ribosomal protein L28 [Desulfurivibrio alkaliphilus AHT2]
          Length = 62

 Score = 74.7 bits (183), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 24/58 (41%), Positives = 33/58 (56%), Gaps = 1/58 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS 58
          MS+VC +  K    GN VSHA+NK+RRR+LPNL  + +         + R+    LRS
Sbjct: 1  MSKVCSVCGKKPEVGNNVSHAHNKSRRRWLPNLQSVRVAVPG-GNTRRTRVCTRCLRS 57


>gi|225706482|gb|ACO09087.1| 39S ribosomal protein L28, mitochondrial precursor [Osmerus mordax]
          Length = 253

 Score = 74.7 bits (183), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 20/100 (20%), Positives = 47/100 (47%), Gaps = 4/100 (4%)

Query: 2   SRVCELTKKTVMSGNKVSHANN---KTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS 58
           S+      +  +SG K +  +    +  + + P L    L S+I++ K+ + ++   L  
Sbjct: 75  SQKGLWGGEGWISGFKYAKNDKLCPRLAKTWKPQLFNRELYSEILDHKFTITVTARVLDL 134

Query: 59  VERQGGLDRFLSNSKKENL-SARMRTLRSQILKKMSEKSS 97
           ++   G D ++  + KE+L S     LR  +L +++ + +
Sbjct: 135 IDAAYGFDFYILKTPKEDLNSKLGMDLRRAMLLRLARRET 174


>gi|320105672|ref|YP_004181262.1| 50S ribosomal protein L28 [Terriglobus saanensis SP1PR4]
 gi|319924193|gb|ADV81268.1| ribosomal protein L28 [Terriglobus saanensis SP1PR4]
          Length = 70

 Score = 74.7 bits (183), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 18/58 (31%), Positives = 34/58 (58%), Gaps = 2/58 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS 58
          M++VC+   K    GN +SHA+N T+RR+ PNL  +  + +   +  ++R+    ++S
Sbjct: 1  MAQVCQYCGKGPQFGNNISHAHNVTKRRWNPNLQAVKAVVNGANK--RVRVCTQCIKS 56


>gi|120406435|ref|YP_956264.1| 50S ribosomal protein L28 [Mycobacterium vanbaalenii PYR-1]
 gi|119959253|gb|ABM16258.1| LSU ribosomal protein L28P [Mycobacterium vanbaalenii PYR-1]
          Length = 78

 Score = 74.7 bits (183), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 21/63 (33%), Positives = 37/63 (58%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS  C++T +    GN VSH++ +TRRR+ PN+   T       ++ +LR+S   ++ ++
Sbjct: 1  MSAHCQVTGRAPGFGNAVSHSHRRTRRRWNPNIQTKTYYLPSEGRRVKLRVSAKGIKVID 60

Query: 61 RQG 63
          R G
Sbjct: 61 RDG 63


>gi|110597044|ref|ZP_01385333.1| ribosomal protein L28 [Chlorobium ferrooxidans DSM 13031]
 gi|110341235|gb|EAT59700.1| ribosomal protein L28 [Chlorobium ferrooxidans DSM 13031]
          Length = 71

 Score = 74.7 bits (183), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 24/63 (38%), Positives = 37/63 (58%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M +VC LT K  + GN VSHANN  R RF PNL    +  +  ++  ++++S  A+R + 
Sbjct: 1  MPKVCLLTGKKPIYGNTVSHANNHVRTRFEPNLHTKKVWIEEEKRFVKVKLSAKAMRIIA 60

Query: 61 RQG 63
          + G
Sbjct: 61 KTG 63


>gi|33862967|ref|NP_894527.1| 50S ribosomal protein L28 [Prochlorococcus marinus str. MIT 9313]
 gi|124023228|ref|YP_001017535.1| 50S ribosomal protein L28 [Prochlorococcus marinus str. MIT 9303]
 gi|67461502|sp|Q7V7P3|RL28_PROMM RecName: Full=50S ribosomal protein L28
 gi|166226600|sp|A2C9W0|RL28_PROM3 RecName: Full=50S ribosomal protein L28
 gi|33634884|emb|CAE20870.1| 50S ribosomal protein L28 [Prochlorococcus marinus str. MIT 9313]
 gi|123963514|gb|ABM78270.1| 50S ribosomal protein L28 [Prochlorococcus marinus str. MIT 9303]
          Length = 78

 Score = 74.7 bits (183), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 21/63 (33%), Positives = 38/63 (60%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC+LT     +G  VSH++ +T++    NL +  L      +  +LR+S  AL++++
Sbjct: 1  MSRVCQLTGTRANNGMAVSHSHIRTKKLQQANLQQRRLWWAEGNRWLKLRVSTRALKTIQ 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|212550483|ref|YP_002308800.1| 50S ribosomal protein L28 [Candidatus Azobacteroides
          pseudotrichonymphae genomovar. CFP2]
 gi|226738027|sp|B6YQB7|RL28_AZOPC RecName: Full=50S ribosomal protein L28
 gi|212548721|dbj|BAG83389.1| 50S ribosomal protein L28 [Candidatus Azobacteroides
          pseudotrichonymphae genomovar. CFP2]
          Length = 80

 Score = 74.3 bits (182), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 27/75 (36%), Positives = 43/75 (57%), Gaps = 1/75 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR+C++T+K  M GN V+H+N+KTRR+F  N           +   +L IS   LR++ 
Sbjct: 1  MSRICQITRKKSMKGNSVAHSNHKTRRKFNVNFFSKRFYWVEKDCWIKLNISANGLRTIN 60

Query: 61 RQGGLDRFLSNSKKE 75
          + G LD  +  + K+
Sbjct: 61 KIG-LDAAIKQASKK 74


>gi|283851281|ref|ZP_06368563.1| ribosomal protein L28 [Desulfovibrio sp. FW1012B]
 gi|283573231|gb|EFC21209.1| ribosomal protein L28 [Desulfovibrio sp. FW1012B]
          Length = 68

 Score = 74.3 bits (182), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 24/58 (41%), Positives = 32/58 (55%), Gaps = 1/58 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS 58
          M+++CE   K   SGN VSHANNKT+RRF PNL  +        +   + +    LRS
Sbjct: 1  MAKICEHCGKKPQSGNNVSHANNKTKRRFEPNLVNVRAQLPS-GEVKTVTVCTRCLRS 57


>gi|66773144|ref|NP_001019570.1| 39S ribosomal protein L28, mitochondrial [Danio rerio]
 gi|63102137|gb|AAH95131.1| Mitochondrial ribosomal protein L28 [Danio rerio]
          Length = 252

 Score = 74.3 bits (182), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 19/95 (20%), Positives = 47/95 (49%), Gaps = 4/95 (4%)

Query: 7   LTKKTVMSGNKVSHANN---KTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQG 63
              +  +SG + +  +    +  + + P L    L S+I++QK+ + ++  AL  ++   
Sbjct: 80  WGGEGWISGFRYAKDDKLSTRLPKTWKPQLFTRELYSEILDQKFSVTVTSRALDLIDAAF 139

Query: 64  GLDRFLSNSKKENL-SARMRTLRSQILKKMSEKSS 97
           G D ++  + K++L S     L+  +L +++ K +
Sbjct: 140 GFDFYILKTPKQDLNSKFGMNLKRAMLLRLARKDT 174


>gi|189346166|ref|YP_001942695.1| 50S ribosomal protein L28 [Chlorobium limicola DSM 245]
 gi|226738048|sp|B3EH36|RL28_CHLL2 RecName: Full=50S ribosomal protein L28
 gi|189340313|gb|ACD89716.1| ribosomal protein L28 [Chlorobium limicola DSM 245]
          Length = 72

 Score = 74.3 bits (182), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 25/63 (39%), Positives = 37/63 (58%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS+VC LT K    GN VSHANN TR RF PNL    +  +  +   ++++S  A++ + 
Sbjct: 1  MSKVCVLTGKRPKYGNNVSHANNHTRTRFEPNLHTKRIWIEEEKCWVKVKLSAKAMKIIS 60

Query: 61 RQG 63
          + G
Sbjct: 61 KTG 63


>gi|317486856|ref|ZP_07945668.1| ribosomal protein L28 [Bilophila wadsworthia 3_1_6]
 gi|316921895|gb|EFV43169.1| ribosomal protein L28 [Bilophila wadsworthia 3_1_6]
          Length = 73

 Score = 74.3 bits (182), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 21/58 (36%), Positives = 29/58 (50%), Gaps = 1/58 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS 58
          MS+ CE   K   +GN VSH+N KT+R F PNL  +        +   + +    LRS
Sbjct: 5  MSKQCEFCGKKPQTGNYVSHSNIKTKRVFNPNLQNVRHQF-ANGEVRTVSVCTRCLRS 61


>gi|304414060|ref|ZP_07395428.1| 50S ribosomal subunit protein L28 [Candidatus Regiella
          insecticola LSR1]
 gi|304283274|gb|EFL91670.1| 50S ribosomal subunit protein L28 [Candidatus Regiella
          insecticola LSR1]
          Length = 83

 Score = 74.3 bits (182), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 25/63 (39%), Positives = 36/63 (57%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR+C ++ K  M GNK SHA N T+R F  NL           +  +LRIS  A+R+++
Sbjct: 6  MSRICPVSGKRAMRGNKRSHAMNATKRSFNVNLQSHRFWDTEKGRFVKLRISTKAMRTID 65

Query: 61 RQG 63
          + G
Sbjct: 66 KHG 68


>gi|254456316|ref|ZP_05069745.1| 50S ribosomal protein L28 [Candidatus Pelagibacter sp. HTCC7211]
 gi|207083318|gb|EDZ60744.1| 50S ribosomal protein L28 [Candidatus Pelagibacter sp. HTCC7211]
          Length = 91

 Score = 74.3 bits (182), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 32/68 (47%), Positives = 48/68 (70%)

Query: 13 MSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFLSNS 72
          M G+ VSHANNKT+RRFLPNL ++   S++M++  +L +S   +RSV+++G  D +L   
Sbjct: 1  MKGHNVSHANNKTKRRFLPNLKKVKFTSELMKRSLKLTVSNAGVRSVDKKGSFDEYLKVV 60

Query: 73 KKENLSAR 80
          K +NLS R
Sbjct: 61 KNKNLSPR 68


>gi|21674429|ref|NP_662494.1| 50S ribosomal protein L28 [Chlorobium tepidum TLS]
 gi|25009090|sp|Q93SU8|RL28_CHLTE RecName: Full=50S ribosomal protein L28
 gi|13899154|gb|AAG12418.1| RL28 [Chlorobaculum tepidum]
 gi|21647613|gb|AAM72836.1| ribosomal protein L28 [Chlorobium tepidum TLS]
          Length = 72

 Score = 74.3 bits (182), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 25/63 (39%), Positives = 37/63 (58%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS+VC LT K    GN VSHANN TR RF PNL    +  +   +  ++R++  A++ + 
Sbjct: 1  MSKVCVLTGKRPKYGNNVSHANNHTRTRFEPNLHTKRIWIEEERRWVKVRLTAKAMKIMS 60

Query: 61 RQG 63
          + G
Sbjct: 61 KTG 63


>gi|302865851|ref|YP_003834488.1| 50S ribosomal protein L28 [Micromonospora aurantiaca ATCC 27029]
 gi|315502396|ref|YP_004081283.1| ribosomal protein l28 [Micromonospora sp. L5]
 gi|302568710|gb|ADL44912.1| ribosomal protein L28 [Micromonospora aurantiaca ATCC 27029]
 gi|315409015|gb|ADU07132.1| ribosomal protein L28 [Micromonospora sp. L5]
          Length = 63

 Score = 74.3 bits (182), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 14/57 (24%), Positives = 30/57 (52%), Gaps = 1/57 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALR 57
          M+ VC++  K    G+ VSH++ +T RR+ PN+  +   +       +L++    ++
Sbjct: 1  MASVCDVCGKGPGFGHNVSHSHRRTNRRWNPNIQSVRTPAGG-GTTKKLQVCTSCIK 56


>gi|238063273|ref|ZP_04607982.1| 50S ribosomal protein L28 [Micromonospora sp. ATCC 39149]
 gi|330466257|ref|YP_004404000.1| 50S ribosomal protein L28 [Verrucosispora maris AB-18-032]
 gi|237885084|gb|EEP73912.1| 50S ribosomal protein L28 [Micromonospora sp. ATCC 39149]
 gi|328809228|gb|AEB43400.1| 50S ribosomal protein L28 [Verrucosispora maris AB-18-032]
          Length = 63

 Score = 74.3 bits (182), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 14/57 (24%), Positives = 30/57 (52%), Gaps = 1/57 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALR 57
          M+ VC++  K    G+ VSH++ +T RR+ PN+  +   +       +L++    ++
Sbjct: 1  MASVCDVCGKGPGFGHNVSHSHRRTNRRWNPNIQSVRTPAGG-GTTKKLKVCTSCIK 56


>gi|209525260|ref|ZP_03273802.1| ribosomal protein L28 [Arthrospira maxima CS-328]
 gi|209494275|gb|EDZ94588.1| ribosomal protein L28 [Arthrospira maxima CS-328]
          Length = 78

 Score = 74.3 bits (182), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 19/63 (30%), Positives = 38/63 (60%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC+LT K   +G  VSH++ ++ +    NL    +     ++  +L++S  A++++E
Sbjct: 1  MSRVCQLTGKRANNGMAVSHSHRRSHKLQQANLQWKRIWWPQGKRWVRLKLSTKAIKTIE 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|118487864|gb|ABK95755.1| unknown [Populus trichocarpa]
          Length = 150

 Score = 74.3 bits (182), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 22/70 (31%), Positives = 38/70 (54%), Gaps = 1/70 (1%)

Query: 3   RVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQ 62
           R+C  T K     NKVS +N+KT++    NL    +  +  ++  +LR+S  AL+++E+ 
Sbjct: 75  RICPFTGKKANRANKVSFSNHKTKKLQFVNLQYKRVWWEAGKRYVKLRLSTKALKTIEKN 134

Query: 63  GGLDRFLSNS 72
           G LD     +
Sbjct: 135 G-LDAVAKKA 143


>gi|46579622|ref|YP_010430.1| 50S ribosomal protein L28 [Desulfovibrio vulgaris str.
          Hildenborough]
 gi|120602890|ref|YP_967290.1| 50S ribosomal protein L28 [Desulfovibrio vulgaris DP4]
 gi|67461458|sp|Q72CS2|RL28_DESVH RecName: Full=50S ribosomal protein L28
 gi|166226569|sp|A1VEJ7|RL28_DESVV RecName: Full=50S ribosomal protein L28
 gi|46449037|gb|AAS95689.1| ribosomal protein L28 [Desulfovibrio vulgaris str. Hildenborough]
 gi|120563119|gb|ABM28863.1| LSU ribosomal protein L28P [Desulfovibrio vulgaris DP4]
 gi|311233426|gb|ADP86280.1| ribosomal protein L28 [Desulfovibrio vulgaris RCH1]
          Length = 69

 Score = 74.3 bits (182), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 20/58 (34%), Positives = 29/58 (50%), Gaps = 1/58 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS 58
          M + CE+  K    G+ VSH+N KT+RRF PNL  +        +   + +    LRS
Sbjct: 1  MGKQCEVCGKKPQVGHHVSHSNIKTKRRFEPNLQSVRHQLPS-GEVKTVTVCTRCLRS 57


>gi|116782045|gb|ABK22346.1| unknown [Picea sitchensis]
          Length = 148

 Score = 74.3 bits (182), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 26/71 (36%), Positives = 42/71 (59%), Gaps = 1/71 (1%)

Query: 2   SRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVER 61
           SRVC LT K   + NKVS +N+KT++    NL    +  +  ++  +LRIS  AL+++E+
Sbjct: 72  SRVCPLTGKRANNANKVSFSNHKTKKLQGVNLQYKRIWWEAGKRFVKLRISTKALKTIEK 131

Query: 62  QGGLDRFLSNS 72
           +G LD     +
Sbjct: 132 KG-LDAMAKKA 141


>gi|302829418|ref|XP_002946276.1| plastid/chloroplast ribosomal protein L28 [Volvox carteri f.
          nagariensis]
 gi|300269091|gb|EFJ53271.1| plastid/chloroplast ribosomal protein L28 [Volvox carteri f.
          nagariensis]
          Length = 196

 Score = 74.3 bits (182), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 19/61 (31%), Positives = 35/61 (57%)

Query: 3  RVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQ 62
          +VC+LT K     N V  +N K+R+   PNL    +  +  ++  +LRI   A++++E++
Sbjct: 35 KVCDLTGKKRNKANSVCFSNKKSRKWQEPNLQNKKVFWEEGQRWVKLRICTKAIKTLEKK 94

Query: 63 G 63
          G
Sbjct: 95 G 95


>gi|295836318|ref|ZP_06823251.1| ribosomal protein L28 [Streptomyces sp. SPB74]
 gi|302522125|ref|ZP_07274467.1| ribosomal protein L28 [Streptomyces sp. SPB78]
 gi|318056538|ref|ZP_07975261.1| 50S ribosomal protein L28 [Streptomyces sp. SA3_actG]
 gi|318076099|ref|ZP_07983431.1| 50S ribosomal protein L28 [Streptomyces sp. SA3_actF]
 gi|295825960|gb|EFG64575.1| ribosomal protein L28 [Streptomyces sp. SPB74]
 gi|302431020|gb|EFL02836.1| ribosomal protein L28 [Streptomyces sp. SPB78]
          Length = 61

 Score = 74.3 bits (182), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 14/57 (24%), Positives = 30/57 (52%), Gaps = 2/57 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALR 57
          M+  C++  K    GN +SH++ +T RR+ PN+ R+  +     +  +L +    ++
Sbjct: 1  MAANCDVCGKGPGFGNNISHSHRRTPRRWNPNIQRVRAVVGGTPK--RLNVCTSCIK 55


>gi|118464463|ref|YP_882992.1| 50S ribosomal protein L28 [Mycobacterium avium 104]
 gi|254776245|ref|ZP_05217761.1| 50S ribosomal protein L28 [Mycobacterium avium subsp. avium ATCC
          25291]
 gi|118165750|gb|ABK66647.1| ribosomal protein L28 [Mycobacterium avium 104]
          Length = 64

 Score = 74.3 bits (182), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 15/57 (26%), Positives = 30/57 (52%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALR 57
          M+ VC++  K    G  VSH++ +T RR+ PN+  +  ++     K +L +    ++
Sbjct: 1  MAAVCDICGKGPGFGKSVSHSHRRTSRRWNPNVQTVHAVARPGGNKQRLNVCTSCIK 57


>gi|119606239|gb|EAW85833.1| mitochondrial ribosomal protein L28, isoform CRA_e [Homo sapiens]
          Length = 290

 Score = 73.9 bits (181), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 17/101 (16%), Positives = 47/101 (46%), Gaps = 7/101 (6%)

Query: 2   SRVCELTKKTVMSGNKVSHANN---KTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS 58
           S+      +  + G   ++ +    + ++ + P L      S+I+++K+ + ++   L  
Sbjct: 106 SQRGLWGGEGWILGQIYANNDKLSKRLKKVWKPQLFEREFYSEILDKKFTVTVTMRTLDL 165

Query: 59  VERQGGLDRFLSN---SKKENL-SARMRTLRSQILKKMSEK 95
           ++   GLD ++     + KE+L S     L+  +L +++ +
Sbjct: 166 IDEAYGLDFYILKASGTPKEDLCSKFGMDLKRGMLLRLARQ 206


>gi|183601827|ref|ZP_02963196.1| 50S ribosomal protein L28 [Bifidobacterium animalis subsp. lactis
          HN019]
 gi|219682742|ref|YP_002469125.1| 50S ribosomal protein L28 [Bifidobacterium animalis subsp. lactis
          AD011]
 gi|254801502|sp|B8DVP8|RL28_BIFA0 RecName: Full=50S ribosomal protein L28
 gi|183218712|gb|EDT89354.1| 50S ribosomal protein L28 [Bifidobacterium animalis subsp. lactis
          HN019]
 gi|219620392|gb|ACL28549.1| ribosomal protein L28 [Bifidobacterium animalis subsp. lactis
          AD011]
 gi|289178039|gb|ADC85285.1| LSU ribosomal protein L28P [Bifidobacterium animalis subsp.
          lactis BB-12]
          Length = 65

 Score = 73.9 bits (181), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 19/57 (33%), Positives = 30/57 (52%), Gaps = 2/57 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALR 57
          M+  C +  K   +G  VSH++ + +RRFLPNL  +    D   Q  +LR+    L+
Sbjct: 1  MAARCAVCGKGPQTGYTVSHSHIRNKRRFLPNLQPVRTTVD--GQNVRLRVCTKCLK 55


>gi|168050997|ref|XP_001777943.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162670703|gb|EDQ57267.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 76

 Score = 73.9 bits (181), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 23/61 (37%), Positives = 37/61 (60%)

Query: 3  RVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQ 62
          R C+LT K   +G KVS +N++T+    PNL    L  +  ++  +LRIS  AL+++E+ 
Sbjct: 1  RRCDLTGKKANNGYKVSFSNHRTKHLQQPNLQYKRLWWEEGKRFVKLRISTKALKTIEKN 60

Query: 63 G 63
          G
Sbjct: 61 G 61


>gi|33865813|ref|NP_897372.1| 50S ribosomal protein L28 [Synechococcus sp. WH 8102]
 gi|67461498|sp|Q7U6Q8|RL28_SYNPX RecName: Full=50S ribosomal protein L28
 gi|33632983|emb|CAE07794.1| 50S ribosomal protein L28 [Synechococcus sp. WH 8102]
          Length = 78

 Score = 73.9 bits (181), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 20/63 (31%), Positives = 37/63 (58%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC+LT     +G  VSH++ +T++    NL    L     ++   LR++  AL++++
Sbjct: 1  MSRVCQLTGTRANNGMAVSHSHIRTKKLQQANLQNRRLWWAEGKRWVNLRVTTRALKTIQ 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|33520048|ref|NP_878880.1| 50S ribosomal protein L28 [Candidatus Blochmannia floridanus]
 gi|67461506|sp|Q7VRK1|RL28_BLOFL RecName: Full=50S ribosomal protein L28
 gi|33504394|emb|CAD83287.1| 50S ribosomal subunit protein L28 [Candidatus Blochmannia
          floridanus]
          Length = 79

 Score = 73.9 bits (181), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 28/69 (40%), Positives = 45/69 (65%), Gaps = 1/69 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR C++T+K  M+GNK SHA N T+R F+PN+       +  ++  +LRIS   +R V+
Sbjct: 1  MSRTCQITRKKPMNGNKRSHAMNATKRWFIPNIHSHRFWIENKKKFIKLRISTKGIRLVD 60

Query: 61 RQGGLDRFL 69
          + G +++FL
Sbjct: 61 KLG-IEQFL 68


>gi|209735506|gb|ACI68622.1| 39S ribosomal protein L28, mitochondrial precursor [Salmo salar]
          Length = 252

 Score = 73.9 bits (181), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 21/95 (22%), Positives = 46/95 (48%), Gaps = 4/95 (4%)

Query: 7   LTKKTVMSGNKVSHANN---KTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQG 63
              +  +SG + ++ +    +  R + P L    L S+I+  K+ + ++  AL  ++   
Sbjct: 80  WGGEGWISGFRYANNDKLSTRLERVWKPQLFTRELYSEILNHKFTITVTARALDLIDAAY 139

Query: 64  GLDRFLSNSKKENL-SARMRTLRSQILKKMSEKSS 97
           G D ++  + KE+L S     LR  +L +++ K +
Sbjct: 140 GFDFYILRTPKEDLNSKLGMDLRRAMLLRLAFKDT 174


>gi|166365941|ref|YP_001658214.1| 50S ribosomal protein L28 [Microcystis aeruginosa NIES-843]
 gi|189029446|sp|B0JLJ8|RL28_MICAN RecName: Full=50S ribosomal protein L28
 gi|159029749|emb|CAO87827.1| rpmB [Microcystis aeruginosa PCC 7806]
 gi|166088314|dbj|BAG03022.1| 50S ribosomal protein L28 [Microcystis aeruginosa NIES-843]
          Length = 78

 Score = 73.9 bits (181), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 20/63 (31%), Positives = 36/63 (57%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC +T K   +   VSH++ +T++    NL    +      +  +LRIS  A++++E
Sbjct: 1  MSRVCTMTGKKANNAYAVSHSHRRTKKLQEANLQWKRVWWSEGNRWVKLRISTKAIKTIE 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|238927485|ref|ZP_04659245.1| ribosomal protein L28 [Selenomonas flueggei ATCC 43531]
 gi|238884767|gb|EEQ48405.1| ribosomal protein L28 [Selenomonas flueggei ATCC 43531]
          Length = 63

 Score = 73.9 bits (181), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 21/58 (36%), Positives = 37/58 (63%), Gaps = 2/58 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS 58
          M+ VCE+  K +MSGN VSH++ KT+R++ PN+ R+  + +   +  ++ +    LRS
Sbjct: 1  MASVCEVCGKGMMSGNNVSHSHVKTKRKWKPNIQRVRALVE--GEVKRVNVCTRCLRS 56


>gi|113953218|ref|YP_730605.1| 50S ribosomal protein L28 [Synechococcus sp. CC9311]
 gi|123327823|sp|Q0IAB7|RL28_SYNS3 RecName: Full=50S ribosomal protein L28
 gi|113880569|gb|ABI45527.1| ribosomal protein L28 [Synechococcus sp. CC9311]
          Length = 78

 Score = 73.9 bits (181), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 23/84 (27%), Positives = 43/84 (51%), Gaps = 6/84 (7%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC+LT     +G  VSH++ +T++    NL +  L     ++   LRI+  AL++++
Sbjct: 1  MSRVCQLTGTRANNGMAVSHSHIRTKKLQQANLQQRRLWWAEGKRWINLRITTRALKTIQ 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTL 84
          ++G        +   +L   +  L
Sbjct: 61 KKG------LGAYARSLGINLAKL 78


>gi|145593828|ref|YP_001158125.1| 50S ribosomal protein L28 [Salinispora tropica CNB-440]
 gi|159036813|ref|YP_001536066.1| 50S ribosomal protein L28 [Salinispora arenicola CNS-205]
 gi|145303165|gb|ABP53747.1| LSU ribosomal protein L28P [Salinispora tropica CNB-440]
 gi|157915648|gb|ABV97075.1| ribosomal protein L28 [Salinispora arenicola CNS-205]
          Length = 63

 Score = 73.9 bits (181), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 14/57 (24%), Positives = 30/57 (52%), Gaps = 1/57 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALR 57
          M+ VC++  K    G+ VSH++ +T RR+ PN+  +   +       +L++    ++
Sbjct: 1  MASVCDVCGKGPGFGHNVSHSHRRTNRRWNPNIQSVRTPAGG-GNTKKLKVCTSCIK 56


>gi|258652092|ref|YP_003201248.1| 50S ribosomal protein L28 [Nakamurella multipartita DSM 44233]
 gi|258555317|gb|ACV78259.1| ribosomal protein L28 [Nakamurella multipartita DSM 44233]
          Length = 63

 Score = 73.9 bits (181), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 15/57 (26%), Positives = 27/57 (47%), Gaps = 1/57 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALR 57
          M+ VC++  K    G  VSH++ +T RR+ PN+  +           +L +    L+
Sbjct: 1  MAAVCDVCGKGPGFGMSVSHSHRRTNRRWNPNIQPVRAQV-APGTVRKLNVCTSCLK 56


>gi|254425238|ref|ZP_05038956.1| ribosomal protein L28 [Synechococcus sp. PCC 7335]
 gi|196192727|gb|EDX87691.1| ribosomal protein L28 [Synechococcus sp. PCC 7335]
          Length = 78

 Score = 73.9 bits (181), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 19/63 (30%), Positives = 36/63 (57%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS+ C+LT K   +   VSH++ +T+R    NL    +      +  +LR+S  AL++++
Sbjct: 1  MSKKCDLTGKKANNAFSVSHSHRRTKRLQEANLQDKRIWWPQGNRFVRLRVSTKALKTLQ 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|297823141|ref|XP_002879453.1| 50S ribosomal protein L28, chloroplast [Arabidopsis lyrata subsp.
           lyrata]
 gi|297325292|gb|EFH55712.1| 50S ribosomal protein L28, chloroplast [Arabidopsis lyrata subsp.
           lyrata]
          Length = 143

 Score = 73.9 bits (181), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 22/70 (31%), Positives = 38/70 (54%), Gaps = 1/70 (1%)

Query: 3   RVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQ 62
           R+C  T K     NKVS +N+KT++    NL    +  +  ++  +LR+S  AL+++E+ 
Sbjct: 68  RICPFTGKKANRANKVSFSNHKTKKLQFVNLQYKRVWWEAGKRFVKLRLSTKALKTIEKN 127

Query: 63  GGLDRFLSNS 72
           G LD     +
Sbjct: 128 G-LDAVAKKA 136


>gi|292669804|ref|ZP_06603230.1| 50S ribosomal protein L28 [Selenomonas noxia ATCC 43541]
 gi|292648601|gb|EFF66573.1| 50S ribosomal protein L28 [Selenomonas noxia ATCC 43541]
          Length = 63

 Score = 73.9 bits (181), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 21/58 (36%), Positives = 33/58 (56%), Gaps = 2/58 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS 58
          M+ VCE+  K  MSGN VSH++ KT+R++ PN+ R+  +     +     +    LRS
Sbjct: 1  MASVCEVCGKGPMSGNNVSHSHVKTKRKWKPNIQRVRALVKGEVKHV--NVCTRCLRS 56


>gi|309810314|ref|ZP_07704152.1| ribosomal protein L28 [Dermacoccus sp. Ellin185]
 gi|308435742|gb|EFP59536.1| ribosomal protein L28 [Dermacoccus sp. Ellin185]
          Length = 64

 Score = 73.5 bits (180), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 15/58 (25%), Positives = 30/58 (51%), Gaps = 1/58 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIME-QKYQLRISKCALR 57
          M+  C++  K    G+ +SH+N +T+RR+ PN+ R+  +         +L +    L+
Sbjct: 1  MAATCDVCGKGPGFGHNISHSNRRTKRRWNPNIQRVRALVGEAGVTPKRLNVCTSCLK 58


>gi|302342676|ref|YP_003807205.1| ribosomal protein L28 [Desulfarculus baarsii DSM 2075]
 gi|301639289|gb|ADK84611.1| ribosomal protein L28 [Desulfarculus baarsii DSM 2075]
          Length = 63

 Score = 73.5 bits (180), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 22/58 (37%), Positives = 31/58 (53%), Gaps = 2/58 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS 58
          MS+VC    K    G  +SHA+NKT+RRF PNL  +  +        ++R+    LRS
Sbjct: 1  MSQVCAFCGKKPQVGYNISHAHNKTKRRFNPNLQSVRHV--EGGTVKRIRVCTRCLRS 56


>gi|88808581|ref|ZP_01124091.1| 50S ribosomal protein L28 [Synechococcus sp. WH 7805]
 gi|148239573|ref|YP_001224960.1| 50S ribosomal protein L28 [Synechococcus sp. WH 7803]
 gi|166228167|sp|A5GL48|RL28_SYNPW RecName: Full=50S ribosomal protein L28
 gi|88787569|gb|EAR18726.1| 50S ribosomal protein L28 [Synechococcus sp. WH 7805]
 gi|147848112|emb|CAK23663.1| 50S ribosomal protein L28 [Synechococcus sp. WH 7803]
          Length = 78

 Score = 73.5 bits (180), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 23/84 (27%), Positives = 44/84 (52%), Gaps = 6/84 (7%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC+LT     +G  VSH++ +T++    NL +  L     ++   LRI+  AL++++
Sbjct: 1  MSRVCQLTGTKANNGMAVSHSHIRTKKLQQANLQQRRLWWAEGKRWVNLRITTRALKTIQ 60

Query: 61 RQGGLDRFLSNSKKENLSARMRTL 84
          ++G        +  ++L   +  L
Sbjct: 61 KKG------LGAYAKSLGIDLARL 78


>gi|256374756|ref|YP_003098416.1| ribosomal protein L28 [Actinosynnema mirum DSM 43827]
 gi|255919059|gb|ACU34570.1| ribosomal protein L28 [Actinosynnema mirum DSM 43827]
          Length = 79

 Score = 73.5 bits (180), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 20/62 (32%), Positives = 35/62 (56%)

Query: 2  SRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVER 61
          +R C+LT +    G +VSH++ +T RR+LPN  R         +   L +S   +++V+R
Sbjct: 3  ARHCQLTGRKPGYGKQVSHSHRRTNRRWLPNTQRRRYWLPSENRYVVLTLSTKGVKTVDR 62

Query: 62 QG 63
          +G
Sbjct: 63 RG 64


>gi|108798902|ref|YP_639099.1| 50S ribosomal protein L28 [Mycobacterium sp. MCS]
 gi|119868017|ref|YP_937969.1| 50S ribosomal protein L28 [Mycobacterium sp. KMS]
 gi|126434502|ref|YP_001070193.1| 50S ribosomal protein L28 [Mycobacterium sp. JLS]
 gi|108769321|gb|ABG08043.1| LSU ribosomal protein L28P [Mycobacterium sp. MCS]
 gi|119694106|gb|ABL91179.1| LSU ribosomal protein L28P [Mycobacterium sp. KMS]
 gi|126234302|gb|ABN97702.1| LSU ribosomal protein L28P [Mycobacterium sp. JLS]
          Length = 64

 Score = 73.5 bits (180), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 16/57 (28%), Positives = 30/57 (52%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALR 57
          M+ VC++  K    G  VSH++ +T RR+ PN+  +  +S     K ++ +    L+
Sbjct: 1  MAAVCDVCGKGPGFGKSVSHSHRRTSRRWNPNIQTVRAVSHPGGNKKRVNVCTSCLK 57


>gi|158522067|ref|YP_001529937.1| ribosomal protein L28 [Desulfococcus oleovorans Hxd3]
 gi|226738068|sp|A8ZTS7|RL28_DESOH RecName: Full=50S ribosomal protein L28
 gi|158510893|gb|ABW67860.1| ribosomal protein L28 [Desulfococcus oleovorans Hxd3]
          Length = 63

 Score = 73.5 bits (180), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 23/58 (39%), Positives = 33/58 (56%), Gaps = 2/58 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS 58
          M+R CE+  K  M G  VSHA+N T+RRF PNL R+  + D   +   L +    ++S
Sbjct: 1  MARQCEICGKKPMVGANVSHAHNVTKRRFNPNLQRVRAVRD--GKPQTLYVCTNCIKS 56


>gi|60393665|sp|P68998|RL28_MYCLE RecName: Full=Putative 50S ribosomal protein L28
          Length = 64

 Score = 73.5 bits (180), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 16/57 (28%), Positives = 32/57 (56%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALR 57
          M+ VC++  K    G  VSH++ +T RR+ PN+  + +++     K QL++    ++
Sbjct: 1  MAAVCDICGKGPGFGKSVSHSHRRTSRRWDPNVQTVHMVTRPGGNKQQLKVCTSCIK 57


>gi|320093937|ref|ZP_08025770.1| 50S ribosomal protein L28 [Actinomyces sp. oral taxon 178 str.
          F0338]
 gi|319979131|gb|EFW10641.1| 50S ribosomal protein L28 [Actinomyces sp. oral taxon 178 str.
          F0338]
          Length = 63

 Score = 73.5 bits (180), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 18/58 (31%), Positives = 32/58 (55%), Gaps = 2/58 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS 58
          M+ VC++  K    G  VSH++ +T RR+ PN+ R+  + D   +  +L +    L+S
Sbjct: 1  MAAVCDVCGKGPGFGKSVSHSHVRTNRRWNPNIQRVRALVDGTPK--RLNVCTKCLKS 56


>gi|87124436|ref|ZP_01080285.1| ribosomal protein L28 [Synechococcus sp. RS9917]
 gi|86168008|gb|EAQ69266.1| ribosomal protein L28 [Synechococcus sp. RS9917]
          Length = 78

 Score = 73.5 bits (180), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 21/63 (33%), Positives = 38/63 (60%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC+LT     +G  VSH++ +T++    NL +  L     ++   LRI+  AL++++
Sbjct: 1  MSRVCQLTGTRANNGMAVSHSHIRTKKLQQANLQQRRLWWAEGKRWVNLRITTRALKTIQ 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|298529759|ref|ZP_07017162.1| ribosomal protein L28 [Desulfonatronospira thiodismutans ASO3-1]
 gi|298511195|gb|EFI35098.1| ribosomal protein L28 [Desulfonatronospira thiodismutans ASO3-1]
          Length = 68

 Score = 73.5 bits (180), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 25/58 (43%), Positives = 35/58 (60%), Gaps = 1/58 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS 58
          M++ CE+  K   +GN VSHANN TRRRF+PNL R+        +  ++R+    LRS
Sbjct: 1  MTKQCEVCGKKPATGNNVSHANNHTRRRFMPNLRRVRAQLP-QGRVRKIRVCTRCLRS 57


>gi|149194808|ref|ZP_01871902.1| 50S ribosomal protein L28 [Caminibacter mediatlanticus TB-2]
 gi|149134967|gb|EDM23449.1| 50S ribosomal protein L28 [Caminibacter mediatlanticus TB-2]
          Length = 61

 Score = 73.5 bits (180), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 21/61 (34%), Positives = 39/61 (63%), Gaps = 2/61 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+R CE+  K    GN+VSH+N KTR +F PN+  + +  D +++  +++I    L+S++
Sbjct: 1  MARKCEICGKGPQFGNRVSHSNRKTRHKFDPNIQHVRIEVDGVKK--RIKICTSCLKSLK 58

Query: 61 R 61
          +
Sbjct: 59 K 59


>gi|307205008|gb|EFN83531.1| 39S ribosomal protein L28, mitochondrial [Harpegnathos saltator]
          Length = 267

 Score = 73.5 bits (180), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 17/68 (25%), Positives = 36/68 (52%), Gaps = 1/68 (1%)

Query: 29  FLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFLSNSKKENL-SARMRTLRSQ 87
           +LP+L R  L S++++   ++ I+   +R +    G D +L  +   +L S     L+ +
Sbjct: 99  WLPDLQRSVLYSEVLDSYMRVVITPRVIRLIHEHYGFDHYLLKTPACDLQSLLALKLKRE 158

Query: 88  ILKKMSEK 95
           IL  +++K
Sbjct: 159 ILIALADK 166


>gi|47196557|emb|CAF88924.1| unnamed protein product [Tetraodon nigroviridis]
          Length = 157

 Score = 73.5 bits (180), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 16/75 (21%), Positives = 41/75 (54%), Gaps = 1/75 (1%)

Query: 24 KTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFLSNSKKENL-SARMR 82
          + ++ + P L +  L S+I++ K+ + ++   L  ++   G D ++  + KE+L S    
Sbjct: 4  RLKKTWKPQLFKRELYSEILDHKFTITVTARTLDLIDAAYGFDFYILKTPKEDLNSKLGM 63

Query: 83 TLRSQILKKMSEKSS 97
           L+  +L +++ +S+
Sbjct: 64 DLKRAMLLRLARRST 78


>gi|322437257|ref|YP_004219469.1| ribosomal protein L28 [Acidobacterium sp. MP5ACTX9]
 gi|321164984|gb|ADW70689.1| ribosomal protein L28 [Acidobacterium sp. MP5ACTX9]
          Length = 63

 Score = 73.1 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 20/58 (34%), Positives = 30/58 (51%), Gaps = 2/58 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS 58
          M+  C+L  K    GN VSHANNKTRRR+  NL  +    D      ++ +    +++
Sbjct: 1  MAAKCDLCGKGPQFGNNVSHANNKTRRRWNVNLQPVKAKVD--GGSKRMSVCTSCIKT 56


>gi|158254318|gb|AAI54266.1| Mrpl28 protein [Danio rerio]
          Length = 252

 Score = 73.1 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 18/95 (18%), Positives = 46/95 (48%), Gaps = 4/95 (4%)

Query: 7   LTKKTVMSGNKVSHANN---KTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQG 63
              +  +SG + +  +    +  + + P L    L S+I++QK+ + ++   L  ++   
Sbjct: 80  WGGEGWISGFRYAKDDKLSTRLPKTWKPQLFTRELYSEILDQKFSVTVTSRTLDLIDAAF 139

Query: 64  GLDRFLSNSKKENL-SARMRTLRSQILKKMSEKSS 97
           G D ++  + K++L S     L+  +L +++ K +
Sbjct: 140 GFDFYILKTPKQDLNSKFGMNLKRAMLLRLACKDT 174


>gi|218888189|ref|YP_002437510.1| 50S ribosomal protein L28 [Desulfovibrio vulgaris str. 'Miyazaki
          F']
 gi|226732826|sp|B8DJG5|RL28_DESVM RecName: Full=50S ribosomal protein L28
 gi|218759143|gb|ACL10042.1| ribosomal protein L28 [Desulfovibrio vulgaris str. 'Miyazaki F']
          Length = 69

 Score = 73.1 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 21/58 (36%), Positives = 30/58 (51%), Gaps = 1/58 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS 58
          MS+ C++  K    G+ VSH+N KT+RRF PNL  +        +   L +    LRS
Sbjct: 1  MSKQCDVCGKKAQVGHHVSHSNIKTKRRFEPNLQSVRHQYP-NGEVKTLSVCTRCLRS 57


>gi|18403278|ref|NP_565765.1| 50S ribosomal protein L28, chloroplast (CL28) [Arabidopsis
           thaliana]
 gi|21542433|sp|O22795|RK28_ARATH RecName: Full=50S ribosomal protein L28, chloroplastic; AltName:
           Full=CL28; Flags: Precursor
 gi|18252877|gb|AAL62365.1| putative chloroplast 50S ribosomal protein L28 [Arabidopsis
           thaliana]
 gi|20196843|gb|AAB80662.2| putative chloroplast 50S ribosomal protein L28 [Arabidopsis
           thaliana]
 gi|21387067|gb|AAM47937.1| putative chloroplast 50S ribosomal protein L28 [Arabidopsis
           thaliana]
 gi|21592705|gb|AAM64654.1| putative chloroplast 50S ribosomal protein L28 [Arabidopsis
           thaliana]
 gi|330253742|gb|AEC08836.1| 50S ribosomal protein L28 [Arabidopsis thaliana]
          Length = 143

 Score = 73.1 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 22/70 (31%), Positives = 38/70 (54%), Gaps = 1/70 (1%)

Query: 3   RVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQ 62
           R+C  T K     NKVS +N+KT++    NL    +  +  ++  +LR+S  AL+++E+ 
Sbjct: 68  RICPFTGKKANRANKVSFSNHKTKKLQFVNLQYKRVWWEAGKRFVKLRLSTKALKTIEKN 127

Query: 63  GGLDRFLSNS 72
           G LD     +
Sbjct: 128 G-LDAVAKKA 136


>gi|306820972|ref|ZP_07454592.1| 50S ribosomal protein L28 [Eubacterium yurii subsp. margaretiae
          ATCC 43715]
 gi|304551086|gb|EFM39057.1| 50S ribosomal protein L28 [Eubacterium yurii subsp. margaretiae
          ATCC 43715]
          Length = 63

 Score = 73.1 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 23/58 (39%), Positives = 33/58 (56%), Gaps = 2/58 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS 58
          M+ VCE+  K   SGN VSH+N  T+R F PNL  +  I D   +  ++++    LRS
Sbjct: 1  MAFVCEICGKGTTSGNNVSHSNRHTKRVFRPNLQSVKAIVDGTPR--RVKVCTRCLRS 56


>gi|218439797|ref|YP_002378126.1| ribosomal protein L28 [Cyanothece sp. PCC 7424]
 gi|226738063|sp|B7K8R0|RL28_CYAP7 RecName: Full=50S ribosomal protein L28
 gi|218172525|gb|ACK71258.1| ribosomal protein L28 [Cyanothece sp. PCC 7424]
          Length = 78

 Score = 73.1 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 19/63 (30%), Positives = 38/63 (60%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+R CELT K   +   +SH++ +T+R    NL    +  +  ++  +LR+S  A++++E
Sbjct: 1  MARHCELTGKKANNAFSISHSHRRTKRLQHANLQWKRIWWEEGKRWVKLRLSTKAIKTLE 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|15842529|ref|NP_337566.1| 50S ribosomal protein L28 [Mycobacterium tuberculosis CDC1551]
 gi|148662825|ref|YP_001284348.1| 50S ribosomal protein L28 [Mycobacterium tuberculosis H37Ra]
 gi|148824165|ref|YP_001288919.1| 50S ribosomal protein L28 [Mycobacterium tuberculosis F11]
 gi|167970004|ref|ZP_02552281.1| 50S ribosomal protein L28 [Mycobacterium tuberculosis H37Ra]
 gi|215404951|ref|ZP_03417132.1| 50S ribosomal protein L28 [Mycobacterium tuberculosis 02_1987]
 gi|215412819|ref|ZP_03421531.1| 50S ribosomal protein L28 [Mycobacterium tuberculosis 94_M4241A]
 gi|215428426|ref|ZP_03426345.1| 50S ribosomal protein L28 [Mycobacterium tuberculosis T92]
 gi|215431925|ref|ZP_03429844.1| 50S ribosomal protein L28 [Mycobacterium tuberculosis EAS054]
 gi|215447242|ref|ZP_03433994.1| 50S ribosomal protein L28 [Mycobacterium tuberculosis T85]
 gi|218754736|ref|ZP_03533532.1| 50S ribosomal protein L28 [Mycobacterium tuberculosis GM 1503]
 gi|219559007|ref|ZP_03538083.1| 50S ribosomal protein L28 [Mycobacterium tuberculosis T17]
 gi|253797932|ref|YP_003030933.1| 50S ribosomal protein L28 rpmB1 [Mycobacterium tuberculosis KZN
          1435]
 gi|254365611|ref|ZP_04981656.1| ribosomal protein L28 [Mycobacterium tuberculosis str. Haarlem]
 gi|254552052|ref|ZP_05142499.1| 50S ribosomal protein L28 [Mycobacterium tuberculosis '98-R604
          INH-RIF-EM']
 gi|260187999|ref|ZP_05765473.1| 50S ribosomal protein L28 [Mycobacterium tuberculosis CPHL_A]
 gi|260202117|ref|ZP_05769608.1| 50S ribosomal protein L28 [Mycobacterium tuberculosis T46]
 gi|260206299|ref|ZP_05773790.1| 50S ribosomal protein L28 [Mycobacterium tuberculosis K85]
 gi|289444539|ref|ZP_06434283.1| LSU ribosomal protein L28 [Mycobacterium tuberculosis T46]
 gi|289448647|ref|ZP_06438391.1| LSU ribosomal protein L28 [Mycobacterium tuberculosis CPHL_A]
 gi|289553235|ref|ZP_06442445.1| ribosomal protein L28 [Mycobacterium tuberculosis KZN 605]
 gi|289571173|ref|ZP_06451400.1| ribosomal protein L28 [Mycobacterium tuberculosis T17]
 gi|289575682|ref|ZP_06455909.1| LSU ribosomal protein L28 [Mycobacterium tuberculosis K85]
 gi|289746774|ref|ZP_06506152.1| ribosomal protein L28 [Mycobacterium tuberculosis 02_1987]
 gi|289751652|ref|ZP_06511030.1| 50S ribosomal protein L28 [Mycobacterium tuberculosis T92]
 gi|289755091|ref|ZP_06514469.1| ribosomal protein L28 [Mycobacterium tuberculosis EAS054]
 gi|289759100|ref|ZP_06518478.1| ribosomal protein L28 [Mycobacterium tuberculosis T85]
 gi|289763155|ref|ZP_06522533.1| ribosomal protein L28 [Mycobacterium tuberculosis GM 1503]
 gi|294993938|ref|ZP_06799629.1| 50S ribosomal protein L28 [Mycobacterium tuberculosis 210]
 gi|297635600|ref|ZP_06953380.1| 50S ribosomal protein L28 [Mycobacterium tuberculosis KZN 4207]
 gi|297732598|ref|ZP_06961716.1| 50S ribosomal protein L28 [Mycobacterium tuberculosis KZN R506]
 gi|298526445|ref|ZP_07013854.1| 50S ribosomal protein L28 [Mycobacterium tuberculosis 94_M4241A]
 gi|306777268|ref|ZP_07415605.1| ribosomal protein L28 [Mycobacterium tuberculosis SUMu001]
 gi|306781179|ref|ZP_07419516.1| ribosomal protein L28 [Mycobacterium tuberculosis SUMu002]
 gi|306785817|ref|ZP_07424139.1| ribosomal protein L28 [Mycobacterium tuberculosis SUMu003]
 gi|306789857|ref|ZP_07428179.1| ribosomal protein L28 [Mycobacterium tuberculosis SUMu004]
 gi|306794669|ref|ZP_07432971.1| ribosomal protein L28 [Mycobacterium tuberculosis SUMu005]
 gi|306798912|ref|ZP_07437214.1| ribosomal protein L28 [Mycobacterium tuberculosis SUMu006]
 gi|306804757|ref|ZP_07441425.1| ribosomal protein L28 [Mycobacterium tuberculosis SUMu008]
 gi|306808951|ref|ZP_07445619.1| ribosomal protein L28 [Mycobacterium tuberculosis SUMu007]
 gi|306969049|ref|ZP_07481710.1| ribosomal protein L28 [Mycobacterium tuberculosis SUMu009]
 gi|306973386|ref|ZP_07486047.1| ribosomal protein L28 [Mycobacterium tuberculosis SUMu010]
 gi|307081094|ref|ZP_07490264.1| ribosomal protein L28 [Mycobacterium tuberculosis SUMu011]
 gi|307085697|ref|ZP_07494810.1| ribosomal protein L28 [Mycobacterium tuberculosis SUMu012]
 gi|313659930|ref|ZP_07816810.1| 50S ribosomal protein L28 [Mycobacterium tuberculosis KZN V2475]
 gi|13882839|gb|AAK47380.1| ribosomal protein L28 [Mycobacterium tuberculosis CDC1551]
 gi|134151124|gb|EBA43169.1| ribosomal protein L28 [Mycobacterium tuberculosis str. Haarlem]
 gi|148506977|gb|ABQ74786.1| 50S ribosomal protein L28 [Mycobacterium tuberculosis H37Ra]
 gi|148722692|gb|ABR07317.1| 50S ribosomal protein L28 [Mycobacterium tuberculosis F11]
 gi|253319435|gb|ACT24038.1| 50S ribosomal protein L28 rpmB1 [Mycobacterium tuberculosis KZN
          1435]
 gi|289417458|gb|EFD14698.1| LSU ribosomal protein L28 [Mycobacterium tuberculosis T46]
 gi|289421605|gb|EFD18806.1| LSU ribosomal protein L28 [Mycobacterium tuberculosis CPHL_A]
 gi|289437867|gb|EFD20360.1| ribosomal protein L28 [Mycobacterium tuberculosis KZN 605]
 gi|289540113|gb|EFD44691.1| LSU ribosomal protein L28 [Mycobacterium tuberculosis K85]
 gi|289544927|gb|EFD48575.1| ribosomal protein L28 [Mycobacterium tuberculosis T17]
 gi|289687302|gb|EFD54790.1| ribosomal protein L28 [Mycobacterium tuberculosis 02_1987]
 gi|289692239|gb|EFD59668.1| 50S ribosomal protein L28 [Mycobacterium tuberculosis T92]
 gi|289695678|gb|EFD63107.1| ribosomal protein L28 [Mycobacterium tuberculosis EAS054]
 gi|289710661|gb|EFD74677.1| ribosomal protein L28 [Mycobacterium tuberculosis GM 1503]
 gi|289714664|gb|EFD78676.1| ribosomal protein L28 [Mycobacterium tuberculosis T85]
 gi|298496239|gb|EFI31533.1| 50S ribosomal protein L28 [Mycobacterium tuberculosis 94_M4241A]
 gi|308214413|gb|EFO73812.1| ribosomal protein L28 [Mycobacterium tuberculosis SUMu001]
 gi|308326014|gb|EFP14865.1| ribosomal protein L28 [Mycobacterium tuberculosis SUMu002]
 gi|308329592|gb|EFP18443.1| ribosomal protein L28 [Mycobacterium tuberculosis SUMu003]
 gi|308333683|gb|EFP22534.1| ribosomal protein L28 [Mycobacterium tuberculosis SUMu004]
 gi|308337081|gb|EFP25932.1| ribosomal protein L28 [Mycobacterium tuberculosis SUMu005]
 gi|308340893|gb|EFP29744.1| ribosomal protein L28 [Mycobacterium tuberculosis SUMu006]
 gi|308344730|gb|EFP33581.1| ribosomal protein L28 [Mycobacterium tuberculosis SUMu007]
 gi|308348710|gb|EFP37561.1| ribosomal protein L28 [Mycobacterium tuberculosis SUMu008]
 gi|308353406|gb|EFP42257.1| ribosomal protein L28 [Mycobacterium tuberculosis SUMu009]
 gi|308357282|gb|EFP46133.1| ribosomal protein L28 [Mycobacterium tuberculosis SUMu010]
 gi|308361295|gb|EFP50146.1| ribosomal protein L28 [Mycobacterium tuberculosis SUMu011]
 gi|308364781|gb|EFP53632.1| ribosomal protein L28 [Mycobacterium tuberculosis SUMu012]
 gi|323718449|gb|EGB27622.1| 50S ribosomal protein L28 rpmB1 [Mycobacterium tuberculosis
          CDC1551A]
 gi|326904589|gb|EGE51522.1| 50S ribosomal protein L28 [Mycobacterium tuberculosis W-148]
 gi|328457707|gb|AEB03130.1| ribosomal protein L28 [Mycobacterium tuberculosis KZN 4207]
          Length = 64

 Score = 73.1 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 15/57 (26%), Positives = 30/57 (52%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALR 57
          M+ VC++  K    G  VSH++ +T RR+ PN+  +  ++     K +L +    ++
Sbjct: 1  MAAVCDICGKGPGFGKSVSHSHRRTSRRWDPNIQTVHAVTRPGGNKKRLNVCTSCIK 57


>gi|229818292|ref|ZP_04448573.1| hypothetical protein BIFANG_03592 [Bifidobacterium angulatum DSM
          20098]
 gi|229784162|gb|EEP20276.1| hypothetical protein BIFANG_03592 [Bifidobacterium angulatum DSM
          20098]
          Length = 64

 Score = 73.1 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 15/57 (26%), Positives = 27/57 (47%), Gaps = 2/57 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALR 57
          M+  C +  K    G  VSH++ + +R F PNL  +    D   +  ++R+    L+
Sbjct: 1  MAARCAVCGKGPQVGYTVSHSHIRNKRTFRPNLQPVHTTVD--GENVRVRVCVKCLK 55


>gi|313896664|ref|ZP_07830212.1| ribosomal protein L28 [Selenomonas sp. oral taxon 137 str. F0430]
 gi|320529989|ref|ZP_08031065.1| ribosomal protein L28 [Selenomonas artemidis F0399]
 gi|312974581|gb|EFR40048.1| ribosomal protein L28 [Selenomonas sp. oral taxon 137 str. F0430]
 gi|320137786|gb|EFW29692.1| ribosomal protein L28 [Selenomonas artemidis F0399]
          Length = 63

 Score = 73.1 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 21/58 (36%), Positives = 34/58 (58%), Gaps = 2/58 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS 58
          M+ VCE+  K  MSGN VSH++ KT+R++ PN+ R+  +     +   + +    LRS
Sbjct: 1  MASVCEVCGKGPMSGNNVSHSHVKTKRKWKPNIQRVRALVK--GEIKHVNVCTRCLRS 56


>gi|16329458|ref|NP_440186.1| 50S ribosomal protein L28 [Synechocystis sp. PCC 6803]
 gi|2500318|sp|P72851|RL28_SYNY3 RecName: Full=50S ribosomal protein L28
 gi|1651940|dbj|BAA16866.1| 50S ribosomal protein L28 [Synechocystis sp. PCC 6803]
          Length = 78

 Score = 73.1 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 19/63 (30%), Positives = 36/63 (57%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+R C+LT K   +G  VSH++ +T++    NL    +      +  +LR+S  A++++E
Sbjct: 1  MARRCQLTGKKANNGFAVSHSHRRTKKLQQANLQWKRVWWPEGNRFVRLRLSTTAIKTLE 60

Query: 61 RQG 63
           +G
Sbjct: 61 SKG 63


>gi|316972747|gb|EFV56401.1| asparaginyl-tRNA synthetase, cytoplasmic [Trichinella spiralis]
          Length = 852

 Score = 73.1 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 19/97 (19%), Positives = 46/97 (47%), Gaps = 8/97 (8%)

Query: 7   LTKKTVMSGNKVSHANNKTRRR-------FLPNLCRITLISDIMEQKYQLRISKCALRSV 59
              + ++ G K+S+   + +R        + P L +  L S+I+++   + ++   L+ +
Sbjct: 93  WGGEGIVKGYKLSNIPPRRKRFLPRLPRFWFPTLMKKVLYSEILDKYMLVTVTSRTLQLI 152

Query: 60  ERQGGLDRFLSNSKKENL-SARMRTLRSQILKKMSEK 95
           +   GLD +L  + + +L S     L+  +L  ++ K
Sbjct: 153 DENQGLDYYLLRTNEVDLCSKLGCKLKRILLLALARK 189


>gi|229366872|gb|ACQ58416.1| 39S ribosomal protein L28, mitochondrial precursor [Anoplopoma
           fimbria]
          Length = 252

 Score = 73.1 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 17/95 (17%), Positives = 50/95 (52%), Gaps = 4/95 (4%)

Query: 7   LTKKTVMSGNKVSHAN---NKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQG 63
              +  +SG + ++ +   N+ ++ + P L +  L S+I++ K+ + ++   L  ++   
Sbjct: 79  WGGEGWISGFRYANNDKMSNRLKKTWKPQLFKRELYSEILDHKFTITVTPRTLNLIDAAF 138

Query: 64  GLDRFLSNSKKENL-SARMRTLRSQILKKMSEKSS 97
           G D ++  + +E+L S     L+  +L +++ +++
Sbjct: 139 GFDFYILRTPREDLNSKLGMDLKRAMLLRLARRNT 173


>gi|240168964|ref|ZP_04747623.1| 50S ribosomal protein L28 [Mycobacterium kansasii ATCC 12478]
          Length = 64

 Score = 73.1 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 15/57 (26%), Positives = 30/57 (52%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALR 57
          M+ VC++  K    G  VSH++ +T RR+ PN+  +  +S     K ++ +    ++
Sbjct: 1  MAAVCDICGKGPGFGKSVSHSHRRTSRRWDPNVQTVRAVSRPGGNKKRINVCTSCIK 57


>gi|224373597|ref|YP_002607969.1| ribosomal protein L28 [Nautilia profundicola AmH]
 gi|254801370|sp|B9L6I1|RL28_NAUPA RecName: Full=50S ribosomal protein L28
 gi|223589830|gb|ACM93566.1| ribosomal protein L28 [Nautilia profundicola AmH]
          Length = 61

 Score = 72.8 bits (178), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 22/61 (36%), Positives = 37/61 (60%), Gaps = 2/61 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+R CE+  K    GN+VSH+N KTR +F PN+  + +  +I     +++I    LRS++
Sbjct: 1  MARKCEICGKGPQFGNRVSHSNRKTRHKFNPNIQSVRI--EINGVSRKVKICTSCLRSLK 58

Query: 61 R 61
          +
Sbjct: 59 K 59


>gi|116750695|ref|YP_847382.1| 50S ribosomal protein L28 [Syntrophobacter fumaroxidans MPOB]
 gi|166228166|sp|A0LNE5|RL28_SYNFM RecName: Full=50S ribosomal protein L28
 gi|116699759|gb|ABK18947.1| LSU ribosomal protein L28P [Syntrophobacter fumaroxidans MPOB]
          Length = 64

 Score = 72.8 bits (178), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 22/58 (37%), Positives = 31/58 (53%), Gaps = 1/58 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS 58
          MSR CE   K    GN VSHANNKT+R + PNL  +  + D      +++     +R+
Sbjct: 1  MSRKCEFCGKEPHVGNNVSHANNKTKRLWYPNLQTVRHM-DKSGAVRRVKACTRCIRT 57


>gi|78223526|ref|YP_385273.1| 50S ribosomal protein L28 [Geobacter metallireducens GS-15]
 gi|123571476|sp|Q39T76|RL28_GEOMG RecName: Full=50S ribosomal protein L28
 gi|78194781|gb|ABB32548.1| LSU ribosomal protein L28P [Geobacter metallireducens GS-15]
          Length = 63

 Score = 72.8 bits (178), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 22/58 (37%), Positives = 31/58 (53%), Gaps = 2/58 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS 58
          MSR CE+  K    GN VSHANNKTR  + PNL ++  +         +++    +RS
Sbjct: 1  MSRKCEICGKGPSFGNNVSHANNKTRTTWYPNLQKVKAV--RNGSVQTIKVCTRCIRS 56


>gi|284928880|ref|YP_003421402.1| 50S ribosomal protein L28P [cyanobacterium UCYN-A]
 gi|284809339|gb|ADB95044.1| LSU ribosomal protein L28P [cyanobacterium UCYN-A]
          Length = 83

 Score = 72.8 bits (178), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 19/62 (30%), Positives = 37/62 (59%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR C+LT K   +G  VSH++ +T++    NL    +  +   +  +LR+S  A++++E
Sbjct: 6  MSRKCQLTGKKANNGFAVSHSHRRTKKLQQVNLQWKRIWWEEGNRWVKLRLSTKAIKTLE 65

Query: 61 RQ 62
          ++
Sbjct: 66 KK 67


>gi|161485759|ref|NP_683251.2| 50S ribosomal protein L28 [Thermosynechococcus elongatus BP-1]
 gi|67461522|sp|Q8DG62|RL28_THEEB RecName: Full=50S ribosomal protein L28
          Length = 78

 Score = 72.8 bits (178), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 20/63 (31%), Positives = 38/63 (60%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC+LT K   +   +SH++ +T++    NL    +     ++  +LR+S  A++++E
Sbjct: 1  MSRVCQLTGKKANNAYAISHSHRRTKKLQQVNLQWKRVWWPEGKRWVRLRLSTKAIKTLE 60

Query: 61 RQG 63
          R+G
Sbjct: 61 RKG 63


>gi|4808368|emb|CAB42782.1| putative 50S ribosomal protein L28 [Streptomyces coelicolor
          A3(2)]
          Length = 73

 Score = 72.8 bits (178), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 18/58 (31%), Positives = 30/58 (51%)

Query: 6  ELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQG 63
           LT      GN++SH++ +T RRF PN+           +  +LR+S   +R+V+  G
Sbjct: 1  MLTGARPGFGNRISHSHRRTSRRFDPNIQTKRYWLPSENRHVRLRLSTKGIRTVDSIG 58


>gi|254821175|ref|ZP_05226176.1| 50S ribosomal protein L28 [Mycobacterium intracellulare ATCC
          13950]
          Length = 63

 Score = 72.8 bits (178), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 14/57 (24%), Positives = 30/57 (52%), Gaps = 1/57 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALR 57
          M+ VC++  K    G  VSH++ +T RR+ PN+  + +      ++ +L +    ++
Sbjct: 1  MAAVCDICGKGPGFGKSVSHSHRRTSRRWDPNVQTVHVARPGGNKQ-RLNVCTSCIK 56


>gi|170077468|ref|YP_001734106.1| 50S ribosomal protein L28 [Synechococcus sp. PCC 7002]
 gi|226699175|sp|B1XIH9|RL28_SYNP2 RecName: Full=50S ribosomal protein L28
 gi|169885137|gb|ACA98850.1| 50S ribosomal protein L28 [Synechococcus sp. PCC 7002]
          Length = 78

 Score = 72.8 bits (178), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 18/63 (28%), Positives = 36/63 (57%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR C++T K   +   VSH++ +T++    NL    +      +  +LR+S  A++++E
Sbjct: 1  MSRKCQITGKKANNAMAVSHSHRRTKKLQEVNLQWKRVWWPEGNRFVRLRLSTKAIKTLE 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|159476894|ref|XP_001696546.1| plastid ribosomal protein L28 [Chlamydomonas reinhardtii]
 gi|158282771|gb|EDP08523.1| plastid ribosomal protein L28 [Chlamydomonas reinhardtii]
          Length = 195

 Score = 72.8 bits (178), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 19/61 (31%), Positives = 34/61 (55%)

Query: 3  RVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQ 62
          +VC+LT K     N V  +N K+R+   PNL    +  +  ++  +LRI   A++++E +
Sbjct: 35 KVCDLTGKKRNKANSVCFSNKKSRKWQEPNLQNKKVFWEEGQRWVKLRICTKAIKTLENK 94

Query: 63 G 63
          G
Sbjct: 95 G 95


>gi|17230122|ref|NP_486670.1| 50S ribosomal protein L28 [Nostoc sp. PCC 7120]
 gi|20139492|sp|Q8YTT3|RL28_ANASP RecName: Full=50S ribosomal protein L28
 gi|17131723|dbj|BAB74329.1| 50S ribosomal protein L28 [Nostoc sp. PCC 7120]
          Length = 78

 Score = 72.8 bits (178), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 19/63 (30%), Positives = 35/63 (55%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR C+LT K   +   VSH++ +T+R    NL    +      +  +L++S  A++++E
Sbjct: 1  MSRRCDLTGKKANNAFAVSHSHRRTKRLQQVNLQNKRVWWPSGNRWVKLKLSTKAIKTLE 60

Query: 61 RQG 63
           +G
Sbjct: 61 VKG 63


>gi|222824028|ref|YP_002575602.1| 50S ribosomal protein L28 [Campylobacter lari RM2100]
 gi|254801348|sp|B9KCR2|RL28_CAMLR RecName: Full=50S ribosomal protein L28
 gi|222539250|gb|ACM64351.1| 50S ribosomal protein L28 [Campylobacter lari RM2100]
          Length = 64

 Score = 72.8 bits (178), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 27/61 (44%), Positives = 42/61 (68%), Gaps = 1/61 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR+C++T K  M GN VSHANNKT+RRFLPNL  + +  +      ++R++   LR+++
Sbjct: 1  MSRICQITGKGPMVGNNVSHANNKTKRRFLPNLRTVRITLED-GTTRKVRVAASTLRTLK 59

Query: 61 R 61
          +
Sbjct: 60 K 60


>gi|91070560|gb|ABE11464.1| 50S ribosomal protein L28 [uncultured Prochlorococcus marinus
          clone HOT0M-7B6]
          Length = 78

 Score = 72.4 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 25/72 (34%), Positives = 44/72 (61%), Gaps = 1/72 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVCELT     +G  VSH++ +T++    NL +  L  +  ++   ++IS  AL+S++
Sbjct: 1  MSRVCELTGAKANNGMAVSHSHIRTKKLQQVNLQKRRLWWEEGKKWVNIKISTKALKSIQ 60

Query: 61 RQGGLDRFLSNS 72
          + G LD+F  ++
Sbjct: 61 KVG-LDKFAKSN 71


>gi|78357468|ref|YP_388917.1| 50S ribosomal protein L28 [Desulfovibrio desulfuricans subsp.
          desulfuricans str. G20]
 gi|123552043|sp|Q30YM4|RL28_DESDG RecName: Full=50S ribosomal protein L28
 gi|78219873|gb|ABB39222.1| LSU ribosomal protein L28P [Desulfovibrio desulfuricans subsp.
          desulfuricans str. G20]
          Length = 69

 Score = 72.4 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 22/58 (37%), Positives = 29/58 (50%), Gaps = 1/58 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS 58
          M + CE   K   +GN VSH+N KT+RRF+PNL           Q   + +    LRS
Sbjct: 1  MGKQCEFCGKKPQTGNNVSHSNIKTKRRFMPNLQSARHQLP-TGQIKTVSVCTRCLRS 57


>gi|312138607|ref|YP_004005943.1| 50S ribosomal protein l28 rpmb [Rhodococcus equi 103S]
 gi|311887946|emb|CBH47258.1| 50S ribosomal protein L28 RpmB [Rhodococcus equi 103S]
          Length = 72

 Score = 72.4 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 16/56 (28%), Positives = 30/56 (53%)

Query: 8  TKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQG 63
          T +    G  VSH++ +T RR+ PN+   T       ++  LR++   +R+++R G
Sbjct: 2  TGRRPGFGRSVSHSHRRTNRRWNPNIQTKTYFLPGEGRRITLRVTPKGIRTIDRDG 57


>gi|120403145|ref|YP_952974.1| 50S ribosomal protein L28 [Mycobacterium vanbaalenii PYR-1]
 gi|119955963|gb|ABM12968.1| LSU ribosomal protein L28P [Mycobacterium vanbaalenii PYR-1]
          Length = 64

 Score = 72.4 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 16/57 (28%), Positives = 31/57 (54%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALR 57
          M+ VCE+  K    G  VSH++ +T RR+ PN+  +  ++     K+++ +    L+
Sbjct: 1  MAAVCEICGKGPGFGKSVSHSHRRTSRRWDPNIQSVRAVAAPGGNKHRVNVCTSCLK 57


>gi|222055240|ref|YP_002537602.1| ribosomal protein L28 [Geobacter sp. FRC-32]
 gi|254801362|sp|B9M905|RL28_GEOSF RecName: Full=50S ribosomal protein L28
 gi|221564529|gb|ACM20501.1| ribosomal protein L28 [Geobacter sp. FRC-32]
          Length = 63

 Score = 72.4 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 23/58 (39%), Positives = 33/58 (56%), Gaps = 2/58 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS 58
          MS+VCE+  K    GN VSHANNKT R + PNL +I  + +   +    ++    +RS
Sbjct: 1  MSKVCEICGKGPSFGNNVSHANNKTSRTWYPNLQKIKAVKNGTVRSI--KVCTRCIRS 56


>gi|254818909|ref|ZP_05223910.1| 50S ribosomal protein L28 [Mycobacterium intracellulare ATCC
          13950]
          Length = 82

 Score = 72.4 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 20/62 (32%), Positives = 36/62 (58%)

Query: 2  SRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVER 61
          S  C++T +    GN VSH++ +TRRR+ PN+   T       ++ +LR+S   ++ ++R
Sbjct: 6  SAHCQVTGRRPGFGNAVSHSHRRTRRRWSPNIQLKTYYLPSEGRRIRLRVSAKGIKVIDR 65

Query: 62 QG 63
           G
Sbjct: 66 DG 67


>gi|309243067|ref|NP_001026530.2| 39S ribosomal protein L28, mitochondrial [Gallus gallus]
          Length = 251

 Score = 72.4 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 13/93 (13%), Positives = 43/93 (46%), Gaps = 4/93 (4%)

Query: 7   LTKKTVMSGNKVSHANN---KTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQG 63
              +  + G + ++ +    +  + + P L +    S+I++ K  + ++   L  +++  
Sbjct: 80  WGGEGWIRGFRYANNDKLSTRVPKIWKPQLFKRQFYSEILDAKLTITVTMRTLDLIDQAY 139

Query: 64  GLDRFLSNSKKENL-SARMRTLRSQILKKMSEK 95
           G D ++  + K ++ S     L+  +L +++ +
Sbjct: 140 GFDFYILKTPKADMCSKLGMDLKRTMLLRLARR 172


>gi|169630361|ref|YP_001704010.1| 50S ribosomal protein L28 [Mycobacterium abscessus ATCC 19977]
 gi|169242328|emb|CAM63356.1| 50S ribosomal protein L28 [Mycobacterium abscessus]
          Length = 65

 Score = 72.4 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 14/57 (24%), Positives = 29/57 (50%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALR 57
          M+ VC++  K    G  VSH++ +T RR+ PN+  +  ++     K ++      ++
Sbjct: 1  MAAVCDVCGKGPGFGKSVSHSHRRTNRRWNPNIQTVHAVTSPGGNKQRVNACTSCIK 57


>gi|329911396|ref|ZP_08275500.1| LSU ribosomal protein L28p [Oxalobacteraceae bacterium IMCC9480]
 gi|327545921|gb|EGF31021.1| LSU ribosomal protein L28p [Oxalobacteraceae bacterium IMCC9480]
          Length = 66

 Score = 72.4 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 27/63 (42%), Positives = 38/63 (60%), Gaps = 1/63 (1%)

Query: 13 MSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFLSNS 72
          M GN VSHANNKT+RRFLPNL R  +  +   +   LR+S   LR +++ G +D  L + 
Sbjct: 1  MVGNNVSHANNKTKRRFLPNLQRRRIFVESENRWVSLRLSNAGLRVIDKLG-IDAVLVDM 59

Query: 73 KKE 75
          +  
Sbjct: 60 RAR 62


>gi|149248730|ref|XP_001528752.1| conserved hypothetical protein [Lodderomyces elongisporus NRRL
           YB-4239]
 gi|146448706|gb|EDK43094.1| conserved hypothetical protein [Lodderomyces elongisporus NRRL
           YB-4239]
          Length = 283

 Score = 72.4 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 21/89 (23%), Positives = 44/89 (49%), Gaps = 3/89 (3%)

Query: 9   KKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRF 68
            +        S   NK  R   PN     + S+ M++++++R+S   LR++ + GGLD++
Sbjct: 114 GRQRKKSKTCSEFLNKNLRAHKPNRQVAKIWSEAMQRQFKVRVSTKFLRTMTKDGGLDQY 173

Query: 69  LSNS---KKENLSARMRTLRSQILKKMSE 94
           L  S   + + +      +R  +L +++E
Sbjct: 174 LLKSTPGRIKTMGLLGWKMRYNLLNRLAE 202


>gi|268680228|ref|YP_003304659.1| ribosomal protein L28 [Sulfurospirillum deleyianum DSM 6946]
 gi|268618259|gb|ACZ12624.1| ribosomal protein L28 [Sulfurospirillum deleyianum DSM 6946]
          Length = 62

 Score = 72.4 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 29/63 (46%), Positives = 41/63 (65%), Gaps = 1/63 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+R C LT K  M GN VSHANNKT+RRFLPNL  + +  +      ++RI+   LR+++
Sbjct: 1  MARKCALTGKGPMVGNNVSHANNKTKRRFLPNLRTVRVTLED-GTTKKIRIAASTLRTMK 59

Query: 61 RQG 63
          + G
Sbjct: 60 KNG 62


>gi|269957068|ref|YP_003326857.1| 50S ribosomal protein L28 [Xylanimonas cellulosilytica DSM 15894]
 gi|269305749|gb|ACZ31299.1| ribosomal protein L28 [Xylanimonas cellulosilytica DSM 15894]
          Length = 63

 Score = 72.4 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 13/57 (22%), Positives = 31/57 (54%), Gaps = 2/57 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALR 57
          M+  C++  K    G+ +SH++ +T+RR+ PN+ R+  +     +  ++ +    L+
Sbjct: 1  MAANCDVCGKGPGFGHSISHSHIRTKRRWNPNIQRVRAVVAGTPK--RVNVCTSCLK 55


>gi|197128497|gb|ACH44995.1| putative mitochondrial ribosomal protein L28 variant 2 [Taeniopygia
           guttata]
          Length = 248

 Score = 72.4 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 11/93 (11%), Positives = 40/93 (43%), Gaps = 4/93 (4%)

Query: 7   LTKKTVMSGNKVSHANN---KTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQG 63
              +  + G + +  +    +  + + P L +    S+I++    + ++   L  ++   
Sbjct: 80  WGGEGWVRGFRYARDDKLSTRLPKTWKPQLFKRQFYSEILDATLTITVTMRTLDLIDAAF 139

Query: 64  GLDRFLSNSKKENL-SARMRTLRSQILKKMSEK 95
           G D ++  + + ++ S     L+  +L +++ +
Sbjct: 140 GFDFYILKTPRADMCSKLGMDLKRTMLLRLARR 172


>gi|197128496|gb|ACH44994.1| putative mitochondrial ribosomal protein L28 variant 1 [Taeniopygia
           guttata]
          Length = 248

 Score = 72.4 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 11/93 (11%), Positives = 40/93 (43%), Gaps = 4/93 (4%)

Query: 7   LTKKTVMSGNKVSHANN---KTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQG 63
              +  + G + +  +    +  + + P L +    S+I++    + ++   L  ++   
Sbjct: 80  WGGEGWVRGFRYARDDKLSTRLPKTWKPQLFKRQFYSEILDATLTITVTMRTLDLIDAAF 139

Query: 64  GLDRFLSNSKKENL-SARMRTLRSQILKKMSEK 95
           G D ++  + + ++ S     L+  +L +++ +
Sbjct: 140 GFDFYILKTPRADMCSKLGMDLKRTMLLRLARR 172


>gi|78189699|ref|YP_380037.1| 50S ribosomal protein L28 [Chlorobium chlorochromatii CaD3]
 gi|123579318|sp|Q3APT1|RL28_CHLCH RecName: Full=50S ribosomal protein L28
 gi|78171898|gb|ABB28994.1| LSU ribosomal protein L28P [Chlorobium chlorochromatii CaD3]
          Length = 72

 Score = 72.4 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 26/63 (41%), Positives = 38/63 (60%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS+VC LT K    GN VSHANN TR RF PNL    +  +  +Q  ++++S  A++ + 
Sbjct: 1  MSKVCLLTGKKPKYGNSVSHANNHTRTRFEPNLHTKKIWIEEEKQFVKVKLSAKAMKIIA 60

Query: 61 RQG 63
          + G
Sbjct: 61 KTG 63


>gi|307154461|ref|YP_003889845.1| 50S ribosomal protein L28 [Cyanothece sp. PCC 7822]
 gi|306984689|gb|ADN16570.1| ribosomal protein L28 [Cyanothece sp. PCC 7822]
          Length = 78

 Score = 72.4 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 18/63 (28%), Positives = 37/63 (58%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+R C+LT K   +   +SH++ +T+R    NL    +     ++  +LR+S  A++++E
Sbjct: 1  MARHCQLTGKKANNAYSISHSHRRTKRLQEANLQWKRIWWAEGKRWVKLRLSTKAIKTLE 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|239908626|ref|YP_002955368.1| 50S ribosomal protein L28 [Desulfovibrio magneticus RS-1]
 gi|259646734|sp|C4XNY1|RL28_DESMR RecName: Full=50S ribosomal protein L28
 gi|239798493|dbj|BAH77482.1| 50S ribosomal protein L28 [Desulfovibrio magneticus RS-1]
          Length = 68

 Score = 72.0 bits (176), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 22/58 (37%), Positives = 32/58 (55%), Gaps = 1/58 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS 58
          M+++C+   K   SGN VSHANNK++RRF PNL  +        +   + +    LRS
Sbjct: 1  MAKICDHCGKKPQSGNNVSHANNKSKRRFEPNLVSVRAQLPS-GEVKTVTVCTRCLRS 57


>gi|328885304|emb|CCA58543.1| LSU ribosomal protein L28p [Streptomyces venezuelae ATCC 10712]
          Length = 61

 Score = 72.0 bits (176), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 14/57 (24%), Positives = 30/57 (52%), Gaps = 2/57 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALR 57
          M+  C++  K    GN +SH++ +T RR+ PN+ R+  +     +  +L +    ++
Sbjct: 1  MAANCDVCGKGPGFGNNISHSHRRTPRRWNPNIQRVRAVVGRTPK--RLNVCTSCIK 55


>gi|156552085|ref|XP_001604861.1| PREDICTED: similar to GA17686-PA [Nasonia vitripennis]
          Length = 279

 Score = 72.0 bits (176), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 16/90 (17%), Positives = 43/90 (47%), Gaps = 1/90 (1%)

Query: 7   LTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLD 66
              + V+ G      + +    ++P L +  + S+I+++  +  ++  AL+ +    G D
Sbjct: 86  WGGEAVVQGFTKKFKHRRVPHFWVPKLLKSVIYSEILDKYVKTIVTYRALQLIHDNYGFD 145

Query: 67  RFLSNSKKENL-SARMRTLRSQILKKMSEK 95
            ++  +K  +L S     L+ ++L ++ +K
Sbjct: 146 HYVLKTKACDLRSLLALKLKREMLIQLWDK 175


>gi|57237504|ref|YP_178518.1| 50S ribosomal protein L28 [Campylobacter jejuni RM1221]
 gi|86149067|ref|ZP_01067299.1| ribosomal protein L28 [Campylobacter jejuni subsp. jejuni CF93-6]
 gi|86151668|ref|ZP_01069882.1| ribosomal protein L28 [Campylobacter jejuni subsp. jejuni 260.94]
 gi|86153713|ref|ZP_01071916.1| ribosomal protein L28 [Campylobacter jejuni subsp. jejuni
          HB93-13]
 gi|88597135|ref|ZP_01100371.1| ribosomal protein L28 [Campylobacter jejuni subsp. jejuni 84-25]
 gi|121613410|ref|YP_001000157.1| 50S ribosomal protein L28 [Campylobacter jejuni subsp. jejuni
          81-176]
 gi|157414743|ref|YP_001481999.1| 50S ribosomal protein L28 [Campylobacter jejuni subsp. jejuni
          81116]
 gi|167005115|ref|ZP_02270873.1| 50S ribosomal protein L28 [Campylobacter jejuni subsp. jejuni
          81-176]
 gi|218562105|ref|YP_002343884.1| 50S ribosomal protein L28 [Campylobacter jejuni subsp. jejuni
          NCTC 11168]
 gi|283955872|ref|ZP_06373362.1| ribosomal protein L28 [Campylobacter jejuni subsp. jejuni 1336]
 gi|14195144|sp|Q9PI58|RL28_CAMJE RecName: Full=50S ribosomal protein L28
 gi|67461264|sp|Q5HW17|RL28_CAMJR RecName: Full=50S ribosomal protein L28
 gi|166226560|sp|A1VYG6|RL28_CAMJJ RecName: Full=50S ribosomal protein L28
 gi|172047068|sp|A8FKN5|RL28_CAMJ8 RecName: Full=50S ribosomal protein L28
 gi|57166308|gb|AAW35087.1| ribosomal protein L28 [Campylobacter jejuni RM1221]
 gi|85840425|gb|EAQ57682.1| ribosomal protein L28 [Campylobacter jejuni subsp. jejuni CF93-6]
 gi|85841297|gb|EAQ58545.1| ribosomal protein L28 [Campylobacter jejuni subsp. jejuni 260.94]
 gi|85842674|gb|EAQ59886.1| ribosomal protein L28 [Campylobacter jejuni subsp. jejuni
          HB93-13]
 gi|87250183|gb|EAQ73141.1| ribosomal protein L28 [Campylobacter jejuni subsp. jejuni 81-176]
 gi|88190824|gb|EAQ94797.1| ribosomal protein L28 [Campylobacter jejuni subsp. jejuni 84-25]
 gi|112359811|emb|CAL34598.1| 50S ribosomal protein L28 [Campylobacter jejuni subsp. jejuni
          NCTC 11168]
 gi|157385707|gb|ABV52022.1| 50S ribosomal protein L28 [Campylobacter jejuni subsp. jejuni
          81116]
 gi|283792532|gb|EFC31311.1| ribosomal protein L28 [Campylobacter jejuni subsp. jejuni 1336]
 gi|284925717|gb|ADC28069.1| 50S ribosomal protein L28 [Campylobacter jejuni subsp. jejuni
          IA3902]
 gi|315057870|gb|ADT72199.1| LSU ribosomal protein L28p [Campylobacter jejuni subsp. jejuni
          S3]
 gi|315928222|gb|EFV07539.1| ribosomal protein L28 [Campylobacter jejuni subsp. jejuni
          DFVF1099]
 gi|315931111|gb|EFV10085.1| ribosomal protein L28 [Campylobacter jejuni subsp. jejuni 327]
          Length = 64

 Score = 72.0 bits (176), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 28/61 (45%), Positives = 42/61 (68%), Gaps = 1/61 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVC++T K  M GN VSHANNKT+RRFLPNL  + +  +      ++RI+   LR+++
Sbjct: 1  MARVCQITGKGPMVGNNVSHANNKTKRRFLPNLRTVRVTLED-GTTRKMRIAASTLRTLK 59

Query: 61 R 61
          +
Sbjct: 60 K 60


>gi|315655511|ref|ZP_07908410.1| 50S ribosomal protein L28 [Mobiluncus curtisii ATCC 51333]
 gi|315490166|gb|EFU79792.1| 50S ribosomal protein L28 [Mobiluncus curtisii ATCC 51333]
          Length = 79

 Score = 72.0 bits (176), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 17/58 (29%), Positives = 31/58 (53%), Gaps = 2/58 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS 58
          M+ VC++  K    G  VSH++ + +RRF PN+ R+  I +   +   L +    ++S
Sbjct: 15 MAAVCDVCGKGPGFGMSVSHSHRRNKRRFNPNIQRVRAIVEGTPRH--LNVCTKCIKS 70


>gi|283954257|ref|ZP_06371781.1| ribosomal protein L28 [Campylobacter jejuni subsp. jejuni 414]
 gi|283794275|gb|EFC33020.1| ribosomal protein L28 [Campylobacter jejuni subsp. jejuni 414]
          Length = 64

 Score = 72.0 bits (176), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 28/61 (45%), Positives = 42/61 (68%), Gaps = 1/61 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVC++T K  M GN VSHANNKT+RRFLPNL  + +  +      ++RI+   LR+++
Sbjct: 1  MARVCQITGKGPMVGNNVSHANNKTKRRFLPNLRTVRVTLED-GTTKKMRIAASTLRTLK 59

Query: 61 R 61
          +
Sbjct: 60 K 60


>gi|268533978|ref|XP_002632119.1| Hypothetical protein CBG06974 [Caenorhabditis briggsae]
 gi|187033731|emb|CAP27366.1| hypothetical protein CBG_06974 [Caenorhabditis briggsae AF16]
          Length = 310

 Score = 72.0 bits (176), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 21/88 (23%), Positives = 46/88 (52%), Gaps = 8/88 (9%)

Query: 8   TKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDR 67
           TKK ++    V        + F P L  + L S+I+++  ++ +++ A+R ++   GLD 
Sbjct: 119 TKKKILPRYWVP-------KLFFPALKTVVLHSEILDKYMKVTVTERAMRLIDENFGLDY 171

Query: 68  FLSNSKKENL-SARMRTLRSQILKKMSE 94
           ++  SK+ +L S     L+ ++L  ++ 
Sbjct: 172 YILKSKEIDLDSKFANLLKREMLLTLAA 199


>gi|219681464|ref|YP_002467849.1| 50S ribosomal protein L28 [Buchnera aphidicola str. 5A
          (Acyrthosiphon pisum)]
 gi|219682020|ref|YP_002468404.1| 50S ribosomal protein L28 [Buchnera aphidicola str. Tuc7
          (Acyrthosiphon pisum)]
 gi|257471139|ref|ZP_05635138.1| 50S ribosomal protein L28 [Buchnera aphidicola str. LSR1
          (Acyrthosiphon pisum)]
 gi|254801346|sp|B8D8P0|RL28_BUCA5 RecName: Full=50S ribosomal protein L28
 gi|254801347|sp|B8D6Z4|RL28_BUCAT RecName: Full=50S ribosomal protein L28
 gi|219621753|gb|ACL29909.1| 50S ribosomal protein L28 [Buchnera aphidicola str. Tuc7
          (Acyrthosiphon pisum)]
 gi|219624307|gb|ACL30462.1| 50S ribosomal protein L28 [Buchnera aphidicola str. 5A
          (Acyrthosiphon pisum)]
 gi|311085828|gb|ADP65910.1| 50S ribosomal protein L28 [Buchnera aphidicola str. LL01
          (Acyrthosiphon pisum)]
 gi|311086401|gb|ADP66482.1| 50S ribosomal protein L28 [Buchnera aphidicola str. TLW03
          (Acyrthosiphon pisum)]
 gi|311086980|gb|ADP67060.1| 50S ribosomal protein L28 [Buchnera aphidicola str. JF99
          (Acyrthosiphon pisum)]
 gi|311087556|gb|ADP67635.1| 50S ribosomal protein L28 [Buchnera aphidicola str. JF98
          (Acyrthosiphon pisum)]
          Length = 75

 Score = 72.0 bits (176), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 23/63 (36%), Positives = 38/63 (60%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR+C++T K  M GN  SHA N T+R+FL N+          ++  +LR+S   +R ++
Sbjct: 1  MSRICQITGKKRMIGNNRSHALNATKRKFLINIQYHRFWIADEKRFIKLRVSTNGMRYID 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|310659149|ref|YP_003936870.1| 50S ribosomal protein L28 [Clostridium sticklandii DSM 519]
 gi|308825927|emb|CBH21965.1| ribosomal protein L28 [Clostridium sticklandii]
          Length = 63

 Score = 72.0 bits (176), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 21/58 (36%), Positives = 33/58 (56%), Gaps = 2/58 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS 58
          M+RVCE+  K  +SGN VSH+N  T+R + PNL  +  + +   +    ++    LRS
Sbjct: 1  MARVCEVCGKGKVSGNNVSHSNRHTKRTWSPNLRNVKAVVEGTPKTI--KVCTRCLRS 56


>gi|118617567|ref|YP_905899.1| 50S ribosomal protein L28 [Mycobacterium ulcerans Agy99]
 gi|183981753|ref|YP_001850044.1| 50S ribosomal protein L28 RpmB2_1 [Mycobacterium marinum M]
 gi|118569677|gb|ABL04428.1| 50S ribosomal protein L28 RpmB2_1 [Mycobacterium ulcerans Agy99]
 gi|183175079|gb|ACC40189.1| 50S ribosomal protein L28 RpmB2_1 [Mycobacterium marinum M]
          Length = 64

 Score = 72.0 bits (176), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 15/57 (26%), Positives = 30/57 (52%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALR 57
          M+ VC++  K    G  VSH++ +T RR+ PN+  +  ++     K +L +    ++
Sbjct: 1  MAAVCDICGKGPGFGKSVSHSHRRTSRRWDPNVQTVRAVTRPGGNKKRLNVCTSCIK 57


>gi|298346965|ref|YP_003719652.1| 50S ribosomal protein L28 [Mobiluncus curtisii ATCC 43063]
 gi|304389324|ref|ZP_07371289.1| 50S ribosomal protein L28 [Mobiluncus curtisii subsp. curtisii
          ATCC 35241]
 gi|315656582|ref|ZP_07909469.1| 50S ribosomal protein L28 [Mobiluncus curtisii subsp. holmesii
          ATCC 35242]
 gi|298237026|gb|ADI68158.1| 50S ribosomal protein L28 [Mobiluncus curtisii ATCC 43063]
 gi|304327442|gb|EFL94675.1| 50S ribosomal protein L28 [Mobiluncus curtisii subsp. curtisii
          ATCC 35241]
 gi|315492537|gb|EFU82141.1| 50S ribosomal protein L28 [Mobiluncus curtisii subsp. holmesii
          ATCC 35242]
          Length = 79

 Score = 72.0 bits (176), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 17/58 (29%), Positives = 31/58 (53%), Gaps = 2/58 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS 58
          M+ VC++  K    G  VSH++ + +RRF PN+ R+  I +   +   L +    ++S
Sbjct: 15 MAAVCDVCGKGPGFGMSVSHSHRRNKRRFNPNIQRVRAIVEGTPRH--LNVCTKCIKS 70


>gi|298490729|ref|YP_003720906.1| 50S ribosomal protein L28 ['Nostoc azollae' 0708]
 gi|298232647|gb|ADI63783.1| ribosomal protein L28 ['Nostoc azollae' 0708]
          Length = 78

 Score = 71.6 bits (175), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 20/63 (31%), Positives = 35/63 (55%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT K   +   VSH++ +T+R    NL    +      +  +L++S  A++++E
Sbjct: 1  MSRRCELTGKKANNAMAVSHSHRRTKRLQHANLQSKRVWWAGGNRWVRLKLSTKAIKTLE 60

Query: 61 RQG 63
           +G
Sbjct: 61 TKG 63


>gi|75906367|ref|YP_320663.1| 50S ribosomal protein L28 [Anabaena variabilis ATCC 29413]
 gi|123610919|sp|Q3MGW8|RL28_ANAVT RecName: Full=50S ribosomal protein L28
 gi|75700092|gb|ABA19768.1| LSU ribosomal protein L28P [Anabaena variabilis ATCC 29413]
          Length = 78

 Score = 71.6 bits (175), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 19/63 (30%), Positives = 35/63 (55%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR C+LT K   +   VSH++ +T+R    NL    +      +  +L++S  A++++E
Sbjct: 1  MSRRCDLTGKKANNAFAVSHSHRRTKRLQQANLQSKRVWWPSGNRWVKLKLSTKAIKTLE 60

Query: 61 RQG 63
           +G
Sbjct: 61 VKG 63


>gi|126661297|ref|ZP_01732367.1| 50S ribosomal protein L28 [Cyanothece sp. CCY0110]
 gi|126617421|gb|EAZ88220.1| 50S ribosomal protein L28 [Cyanothece sp. CCY0110]
          Length = 78

 Score = 71.6 bits (175), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 19/63 (30%), Positives = 36/63 (57%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR C+LT K   +   VSH++ +T++    NL    +      +  +LR+S  A++++E
Sbjct: 1  MSRKCQLTGKKANNAFAVSHSHRRTKKLQEANLQWKRVWWPEGNRWVRLRLSTKAIKTLE 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|301382570|ref|ZP_07230988.1| 50S ribosomal protein L28 [Pseudomonas syringae pv. tomato Max13]
 gi|302063063|ref|ZP_07254604.1| 50S ribosomal protein L28 [Pseudomonas syringae pv. tomato K40]
 gi|302133589|ref|ZP_07259579.1| 50S ribosomal protein L28 [Pseudomonas syringae pv. tomato NCPPB
          1108]
 gi|302184916|ref|ZP_07261589.1| 50S ribosomal protein L28 [Pseudomonas syringae pv. syringae 642]
 gi|320322244|gb|EFW78340.1| 50S ribosomal protein L28 [Pseudomonas syringae pv. glycinea str.
          B076]
 gi|320331893|gb|EFW87831.1| 50S ribosomal protein L28 [Pseudomonas syringae pv. glycinea str.
          race 4]
 gi|331018551|gb|EGH98607.1| 50S ribosomal protein L28 [Pseudomonas syringae pv. lachrymans
          str. M302278PT]
          Length = 65

 Score = 71.6 bits (175), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 23/51 (45%), Positives = 35/51 (68%)

Query: 13 MSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQG 63
          M+GN +SHANNKTRRRFLPNL       +  ++  +LR+S   +R ++++G
Sbjct: 1  MTGNNISHANNKTRRRFLPNLQHHRFWVEGEKRFVRLRVSAKGMRIIDKRG 51


>gi|224282407|ref|ZP_03645729.1| 50S ribosomal protein L28 [Bifidobacterium bifidum NCIMB 41171]
 gi|310286849|ref|YP_003938107.1| 50S ribosomal protein L28 [Bifidobacterium bifidum S17]
 gi|311063751|ref|YP_003970476.1| 50S ribosomal protein L28P RpmB [Bifidobacterium bifidum PRL2010]
 gi|313139551|ref|ZP_07801744.1| 50S ribosomal protein L28 [Bifidobacterium bifidum NCIMB 41171]
 gi|309250785|gb|ADO52533.1| 50S ribosomal protein L28 [Bifidobacterium bifidum S17]
 gi|310866070|gb|ADP35439.1| RpmB LSU ribosomal protein L28P [Bifidobacterium bifidum PRL2010]
 gi|313132061|gb|EFR49678.1| 50S ribosomal protein L28 [Bifidobacterium bifidum NCIMB 41171]
          Length = 64

 Score = 71.6 bits (175), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 16/57 (28%), Positives = 27/57 (47%), Gaps = 2/57 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALR 57
          M+  C +  K    G  VSH++ + +R F PNL  +    D   Q  ++R+    L+
Sbjct: 1  MAARCAVCGKGPQVGYTVSHSHIRNKRTFRPNLQPVRTTVD--GQNVRVRVCVKCLK 55


>gi|218247551|ref|YP_002372922.1| 50S ribosomal protein L28 [Cyanothece sp. PCC 8801]
 gi|257061114|ref|YP_003139002.1| 50S ribosomal protein L28 [Cyanothece sp. PCC 8802]
 gi|226738064|sp|B7K5N3|RL28_CYAP8 RecName: Full=50S ribosomal protein L28
 gi|218168029|gb|ACK66766.1| ribosomal protein L28 [Cyanothece sp. PCC 8801]
 gi|256591280|gb|ACV02167.1| ribosomal protein L28 [Cyanothece sp. PCC 8802]
          Length = 78

 Score = 71.6 bits (175), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 19/63 (30%), Positives = 35/63 (55%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR C+LT K   +   VSH++ +T++    NL    +      +  +LR+S  A++++E
Sbjct: 1  MSRKCQLTGKKANNAYAVSHSHRRTKKLQEANLQWKRVWWPEGNRWVRLRLSTKAIKTLE 60

Query: 61 RQG 63
           +G
Sbjct: 61 TKG 63


>gi|193215033|ref|YP_001996232.1| 50S ribosomal protein L28 [Chloroherpeton thalassium ATCC 35110]
 gi|226738052|sp|B3QZ92|RL28_CHLT3 RecName: Full=50S ribosomal protein L28
 gi|193088510|gb|ACF13785.1| ribosomal protein L28 [Chloroherpeton thalassium ATCC 35110]
          Length = 74

 Score = 71.6 bits (175), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 23/63 (36%), Positives = 38/63 (60%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS+VC LT K    GN VSHANN  R RF PN+    +  +  ++  ++++S  A++ + 
Sbjct: 1  MSKVCILTGKKHQYGNTVSHANNHRRTRFEPNIQAKRIWLEEEKRWVKVKLSAKAIKIIS 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KRG 63


>gi|317125443|ref|YP_004099555.1| 50S ribosomal protein L28P [Intrasporangium calvum DSM 43043]
 gi|315589531|gb|ADU48828.1| LSU ribosomal protein L28P [Intrasporangium calvum DSM 43043]
          Length = 62

 Score = 71.6 bits (175), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 13/57 (22%), Positives = 31/57 (54%), Gaps = 1/57 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALR 57
          M+  C++  K    G+ +SH++ +T+RR+ PN+ R+  +   +    ++ +    L+
Sbjct: 1  MAANCDVCGKGPSFGHNISHSHRRTKRRWNPNIQRVRTLVGGV-TPKRINVCTSCLK 56


>gi|167630215|ref|YP_001680714.1| 50S ribosomal protein l28 [Heliobacterium modesticaldum Ice1]
 gi|226694926|sp|B0TGU2|RL28_HELMI RecName: Full=50S ribosomal protein L28
 gi|167592955|gb|ABZ84703.1| 50S ribosomal protein l28 [Heliobacterium modesticaldum Ice1]
          Length = 63

 Score = 71.6 bits (175), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 19/58 (32%), Positives = 31/58 (53%), Gaps = 2/58 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS 58
          M+R C +  K V  G +VSH++ +T+R + PNL R+  +        +L +    LRS
Sbjct: 1  MARKCAICGKGVQMGMQVSHSHIRTKRTWSPNLQRVRAVVK--GAPVRLNVCTRCLRS 56


>gi|39997332|ref|NP_953283.1| 50S ribosomal protein L28 [Geobacter sulfurreducens PCA]
 gi|67461477|sp|Q74AW5|RL28_GEOSL RecName: Full=50S ribosomal protein L28
 gi|39984223|gb|AAR35610.1| ribosomal protein L28 [Geobacter sulfurreducens PCA]
 gi|298506269|gb|ADI84992.1| ribosomal protein L28 [Geobacter sulfurreducens KN400]
          Length = 63

 Score = 71.6 bits (175), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 22/58 (37%), Positives = 32/58 (55%), Gaps = 2/58 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS 58
          MS+VCE+  K    GN VSHANNKTR  + PNL ++  +         +++    +RS
Sbjct: 1  MSKVCEICGKGPSFGNNVSHANNKTRTTWHPNLQKVKAV--RNGSVKTIKVCTRCIRS 56


>gi|256397127|ref|YP_003118691.1| 50S ribosomal protein L28 [Catenulispora acidiphila DSM 44928]
 gi|256363353|gb|ACU76850.1| ribosomal protein L28 [Catenulispora acidiphila DSM 44928]
          Length = 65

 Score = 71.6 bits (175), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 11/57 (19%), Positives = 30/57 (52%), Gaps = 2/57 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALR 57
          M+  C++  K    G+ +SH++ +T+RR+ PN+  +  + +   +  ++      ++
Sbjct: 1  MAANCDVCGKGPGFGHNISHSHRRTKRRWNPNIQTVRAVVNGTPK--RVNACTSCIK 55


>gi|194335825|ref|YP_002017619.1| ribosomal protein L28 [Pelodictyon phaeoclathratiforme BU-1]
 gi|226699142|sp|B4SE11|RL28_PELPB RecName: Full=50S ribosomal protein L28
 gi|194308302|gb|ACF43002.1| ribosomal protein L28 [Pelodictyon phaeoclathratiforme BU-1]
          Length = 72

 Score = 71.6 bits (175), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 24/63 (38%), Positives = 37/63 (58%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS+VC LT K  + GN VSHANN  R RF PNL    +  +  ++  ++++S  A+  + 
Sbjct: 1  MSKVCLLTGKRPIYGNTVSHANNHVRTRFEPNLHTKRIWIEEEKRFVKVKLSAKAMTIIA 60

Query: 61 RQG 63
          + G
Sbjct: 61 KTG 63


>gi|288574877|ref|ZP_06393234.1| ribosomal protein L28 [Dethiosulfovibrio peptidovorans DSM 11002]
 gi|288570618|gb|EFC92175.1| ribosomal protein L28 [Dethiosulfovibrio peptidovorans DSM 11002]
          Length = 64

 Score = 71.6 bits (175), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 25/58 (43%), Positives = 36/58 (62%), Gaps = 1/58 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS 58
          MS+VC+   K  ++GN VSH++ KTRRR+LPNL  + +      +  +LRI    LRS
Sbjct: 1  MSKVCDCCGKGPVTGNSVSHSHRKTRRRWLPNLHSVRVDLGA-GETRKLRICSRCLRS 57


>gi|157413325|ref|YP_001484191.1| 50S ribosomal protein L28 [Prochlorococcus marinus str. MIT 9215]
 gi|166987914|sp|A8G4S4|RL28_PROM2 RecName: Full=50S ribosomal protein L28
 gi|157387900|gb|ABV50605.1| 50S ribosomal protein L28 [Prochlorococcus marinus str. MIT 9215]
          Length = 78

 Score = 71.6 bits (175), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 25/72 (34%), Positives = 44/72 (61%), Gaps = 1/72 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVCELT     +G  VSH++ +T++    NL +  L  +  ++   ++IS  AL+S++
Sbjct: 1  MSRVCELTGAKANNGMAVSHSHIRTKKLQQVNLQKRRLWWEEGKKWVNIKISTKALKSIQ 60

Query: 61 RQGGLDRFLSNS 72
          + G LD+F  ++
Sbjct: 61 KVG-LDKFAKSN 71


>gi|315638422|ref|ZP_07893599.1| 50S ribosomal protein L28 [Campylobacter upsaliensis JV21]
 gi|315481413|gb|EFU72040.1| 50S ribosomal protein L28 [Campylobacter upsaliensis JV21]
          Length = 64

 Score = 71.6 bits (175), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 27/61 (44%), Positives = 42/61 (68%), Gaps = 1/61 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+R+C++T K  M GN VSHANNKT+RRFLPNL  + +  +      ++RI+   LR+++
Sbjct: 1  MARICQITGKGPMVGNNVSHANNKTKRRFLPNLRTVRITLED-GTTRKVRIAASTLRTLK 59

Query: 61 R 61
          +
Sbjct: 60 K 60


>gi|330812586|ref|YP_004357048.1| 50S ribosomal protein L28 [Pseudomonas brassicacearum subsp.
          brassicacearum NFM421]
 gi|327380694|gb|AEA72044.1| 50S ribosomal protein L28 [Pseudomonas brassicacearum subsp.
          brassicacearum NFM421]
          Length = 65

 Score = 71.6 bits (175), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 23/51 (45%), Positives = 35/51 (68%)

Query: 13 MSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQG 63
          M+GN +SHANNKTRRRFLPNL       +  ++  +LR+S   +R ++++G
Sbjct: 1  MTGNNISHANNKTRRRFLPNLQHHRFWVEEEKRFVRLRVSAKGMRIIDKRG 51


>gi|194333387|ref|YP_002015247.1| 50S ribosomal protein L28 [Prosthecochloris aestuarii DSM 271]
 gi|226699146|sp|B4S5K3|RL28_PROA2 RecName: Full=50S ribosomal protein L28
 gi|194311205|gb|ACF45600.1| ribosomal protein L28 [Prosthecochloris aestuarii DSM 271]
          Length = 72

 Score = 71.6 bits (175), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 27/63 (42%), Positives = 39/63 (61%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS+VC LT K    GN VSHANN  R+RF PNL    +  +  ++  ++++S  AL+ + 
Sbjct: 1  MSKVCVLTGKRPKYGNTVSHANNHRRKRFEPNLHTKRVWLEEEKRWVKVKVSAKALKIMS 60

Query: 61 RQG 63
          RQG
Sbjct: 61 RQG 63


>gi|225873415|ref|YP_002754874.1| ribosomal protein L28 [Acidobacterium capsulatum ATCC 51196]
 gi|254801492|sp|C1F7R8|RL28_ACIC5 RecName: Full=50S ribosomal protein L28
 gi|225792205|gb|ACO32295.1| ribosomal protein L28 [Acidobacterium capsulatum ATCC 51196]
          Length = 63

 Score = 71.6 bits (175), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 19/58 (32%), Positives = 32/58 (55%), Gaps = 1/58 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS 58
          M++VCE+  K    GN +SHA+N TRRR+  NL  + +         ++R+    ++S
Sbjct: 1  MAQVCEICGKGPQFGNNISHAHNVTRRRWNVNLRPVKVKVGPT-ANKRVRVCTSCIKS 57


>gi|297202614|ref|ZP_06920011.1| ribosomal protein L28 [Streptomyces sviceus ATCC 29083]
 gi|297148154|gb|EFH28858.1| ribosomal protein L28 [Streptomyces sviceus ATCC 29083]
          Length = 61

 Score = 71.6 bits (175), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 13/57 (22%), Positives = 28/57 (49%), Gaps = 2/57 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALR 57
          M+  C++  K    GN VS ++ +T RR+ PN+  +  +     +  +L +    ++
Sbjct: 1  MAANCDVCGKGPGFGNSVSFSHRRTSRRWNPNIQHVRTVVGGTPK--RLNVCTSCIK 55


>gi|67922358|ref|ZP_00515870.1| Ribosomal protein L28 [Crocosphaera watsonii WH 8501]
 gi|67855809|gb|EAM51056.1| Ribosomal protein L28 [Crocosphaera watsonii WH 8501]
          Length = 78

 Score = 71.6 bits (175), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 19/63 (30%), Positives = 36/63 (57%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR C+LT K   +   VSH++ +T++    NL    +      +  +LR+S  A++++E
Sbjct: 1  MSRRCQLTGKKANNAFAVSHSHRRTKKLQEANLQWKRVWWPEGNRWVKLRLSTKAIKTLE 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|148265186|ref|YP_001231892.1| 50S ribosomal protein L28 [Geobacter uraniireducens Rf4]
 gi|189029442|sp|A5G6A1|RL28_GEOUR RecName: Full=50S ribosomal protein L28
 gi|146398686|gb|ABQ27319.1| LSU ribosomal protein L28P [Geobacter uraniireducens Rf4]
          Length = 63

 Score = 71.6 bits (175), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 22/58 (37%), Positives = 33/58 (56%), Gaps = 2/58 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS 58
          MS++CE+  K    GN VSHANNKT R + PNL +I  + +   +    ++    +RS
Sbjct: 1  MSKICEICGKGPSFGNNVSHANNKTSRIWYPNLQKIKAVKNGTVRSI--KVCTRCIRS 56


>gi|57168586|ref|ZP_00367719.1| ribosomal protein L28 [Campylobacter coli RM2228]
 gi|305433005|ref|ZP_07402161.1| 50S ribosomal protein L28 [Campylobacter coli JV20]
 gi|57020091|gb|EAL56768.1| ribosomal protein L28 [Campylobacter coli RM2228]
 gi|304443706|gb|EFM36363.1| 50S ribosomal protein L28 [Campylobacter coli JV20]
          Length = 64

 Score = 71.6 bits (175), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 27/61 (44%), Positives = 42/61 (68%), Gaps = 1/61 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+R+C++T K  M GN VSHANNKT+RRFLPNL  + +  +      ++RI+   LR+++
Sbjct: 1  MARICQITGKGPMVGNNVSHANNKTKRRFLPNLRTVRVTLED-GTTRKMRIAASTLRTLK 59

Query: 61 R 61
          +
Sbjct: 60 K 60


>gi|303245780|ref|ZP_07332063.1| ribosomal protein L28 [Desulfovibrio fructosovorans JJ]
 gi|302493043|gb|EFL52908.1| ribosomal protein L28 [Desulfovibrio fructosovorans JJ]
          Length = 68

 Score = 71.6 bits (175), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 23/58 (39%), Positives = 33/58 (56%), Gaps = 1/58 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS 58
          M+++CE   K   SGN VSHANNK++RRF PNL ++        +   + +    LRS
Sbjct: 1  MAKICEHCGKKPQSGNNVSHANNKSKRRFSPNLVKVRAQLPS-GEVTTMTVCTRCLRS 57


>gi|169627438|ref|YP_001701087.1| 50S ribosomal protein L28-2 [Mycobacterium abscessus ATCC 19977]
 gi|169239405|emb|CAM60433.1| 50S ribosomal protein L28-2 [Mycobacterium abscessus]
          Length = 82

 Score = 71.6 bits (175), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 21/62 (33%), Positives = 38/62 (61%)

Query: 2  SRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVER 61
          S  CE+T ++   GN VSH++ +TRRR+ PN+   T      +++ +LR+S   ++ ++R
Sbjct: 6  SAHCEVTGRSPGFGNAVSHSHRRTRRRWSPNIQLKTYYLPSEDRRIKLRVSTKGIKVIDR 65

Query: 62 QG 63
           G
Sbjct: 66 DG 67


>gi|153951942|ref|YP_001398512.1| 50S ribosomal protein L28 [Campylobacter jejuni subsp. doylei
          269.97]
 gi|166226559|sp|A7H4T2|RL28_CAMJD RecName: Full=50S ribosomal protein L28
 gi|152939388|gb|ABS44129.1| ribosomal protein L28 [Campylobacter jejuni subsp. doylei 269.97]
          Length = 64

 Score = 71.6 bits (175), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 27/61 (44%), Positives = 42/61 (68%), Gaps = 1/61 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+R+C++T K  M GN VSHANNKT+RRFLPNL  + +  +      ++RI+   LR+++
Sbjct: 1  MARICQITGKGPMVGNNVSHANNKTKRRFLPNLRTVRVTLED-GTTKKMRIAASTLRTLK 59

Query: 61 R 61
          +
Sbjct: 60 K 60


>gi|308459187|ref|XP_003091918.1| hypothetical protein CRE_31545 [Caenorhabditis remanei]
 gi|308254815|gb|EFO98767.1| hypothetical protein CRE_31545 [Caenorhabditis remanei]
          Length = 358

 Score = 71.6 bits (175), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 21/90 (23%), Positives = 48/90 (53%), Gaps = 8/90 (8%)

Query: 8   TKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDR 67
           TKK ++    V        + F P L    L S+++++  ++ +++ A+R ++   GLD 
Sbjct: 167 TKKKILPRYWVP-------KLFFPTLKTAVLYSEVLDKYIKVTVTERAMRLIDEHFGLDY 219

Query: 68  FLSNSKKENL-SARMRTLRSQILKKMSEKS 96
           ++  S++ +L S    +L+ +IL  ++ +S
Sbjct: 220 YILQSQEIDLDSKFANSLKREILLTLATES 249


>gi|118475728|ref|YP_892139.1| 50S ribosomal protein L28 [Campylobacter fetus subsp. fetus
          82-40]
 gi|166226557|sp|A0RPK6|RL28_CAMFF RecName: Full=50S ribosomal protein L28
 gi|118414954|gb|ABK83374.1| ribosomal protein L28 [Campylobacter fetus subsp. fetus 82-40]
          Length = 63

 Score = 71.6 bits (175), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 24/61 (39%), Positives = 41/61 (67%), Gaps = 1/61 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS+ C +T K  M GN VSHANN+T+RRF+PNL  + ++ +      ++R++   LR+++
Sbjct: 1  MSKRCAITGKGPMVGNNVSHANNRTKRRFMPNLRTVRVMLED-GTTRKIRVAASTLRTMK 59

Query: 61 R 61
          +
Sbjct: 60 K 60


>gi|290958449|ref|YP_003489631.1| 50S ribosomal protein L28 [Streptomyces scabiei 87.22]
 gi|260647975|emb|CBG71080.1| putative 50S ribosomal protein L28 [Streptomyces scabiei 87.22]
          Length = 73

 Score = 71.2 bits (174), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 17/58 (29%), Positives = 30/58 (51%)

Query: 6  ELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQG 63
           LT      GN++SH++ +T RRF PN+           +  +LR+S   +++V+  G
Sbjct: 1  MLTGARPGFGNRISHSHRRTSRRFDPNIQSKRYWLPSENRHVRLRLSARGIKTVDVIG 58


>gi|154509015|ref|ZP_02044657.1| hypothetical protein ACTODO_01532 [Actinomyces odontolyticus ATCC
          17982]
 gi|293192357|ref|ZP_06609468.1| ribosomal protein L28 [Actinomyces odontolyticus F0309]
 gi|315604398|ref|ZP_07879464.1| 50S ribosomal protein L28 [Actinomyces sp. oral taxon 180 str.
          F0310]
 gi|153798649|gb|EDN81069.1| hypothetical protein ACTODO_01532 [Actinomyces odontolyticus ATCC
          17982]
 gi|292820272|gb|EFF79266.1| ribosomal protein L28 [Actinomyces odontolyticus F0309]
 gi|315314104|gb|EFU62155.1| 50S ribosomal protein L28 [Actinomyces sp. oral taxon 180 str.
          F0310]
          Length = 63

 Score = 71.2 bits (174), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 17/58 (29%), Positives = 32/58 (55%), Gaps = 2/58 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS 58
          M+ VC++  K    G  VSH++ +T RR+ PN+ R+  + +   +  +L +    L+S
Sbjct: 1  MAAVCDVCGKGPGFGKSVSHSHVRTNRRWNPNIQRVRALVNGTPK--RLNVCTKCLKS 56


>gi|15616708|ref|NP_239920.1| 50S ribosomal protein L28 [Buchnera aphidicola str. APS
          (Acyrthosiphon pisum)]
 gi|11134521|sp|P57188|RL28_BUCAI RecName: Full=50S ribosomal protein L28
 gi|25295494|pir||F84939 50S ribosomal protein L28 [imported] - Buchnera sp. (strain APS)
 gi|10038771|dbj|BAB12806.1| 50S ribosomal protein L28 [Buchnera aphidicola str. APS
          (Acyrthosiphon pisum)]
          Length = 75

 Score = 71.2 bits (174), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 22/63 (34%), Positives = 37/63 (58%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR+C++T K  M GN  SHA N T+R+FL N+          ++  +L +S   +R ++
Sbjct: 1  MSRICQITGKKRMIGNNRSHALNATKRKFLINIQYHRFWIADEKRFIKLHVSTNGMRYID 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|197128495|gb|ACH44993.1| putative mitochondrial ribosomal protein L28 variant 1 [Taeniopygia
           guttata]
 gi|197128498|gb|ACH44996.1| putative mitochondrial ribosomal protein L28 variant 1 [Taeniopygia
           guttata]
          Length = 248

 Score = 71.2 bits (174), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 11/93 (11%), Positives = 40/93 (43%), Gaps = 4/93 (4%)

Query: 7   LTKKTVMSGNKVSHANN---KTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQG 63
              +  + G + +  +    +  + + P L +    S+I++    + ++   L  ++   
Sbjct: 80  WGGEGWVRGFRYARDDXLSTRLPKTWKPQLFKRQFYSEILDATLTITVTMRTLDLIDAAF 139

Query: 64  GLDRFLSNSKKENL-SARMRTLRSQILKKMSEK 95
           G D ++  + + ++ S     L+  +L +++ +
Sbjct: 140 GFDFYILKTPRADMCSKLGMDLKRTMLLRLARR 172


>gi|254495923|ref|ZP_05108831.1| 50S ribosomal protein L28 [Legionella drancourtii LLAP12]
 gi|254354801|gb|EET13428.1| 50S ribosomal protein L28 [Legionella drancourtii LLAP12]
          Length = 66

 Score = 71.2 bits (174), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 25/63 (39%), Positives = 37/63 (58%), Gaps = 1/63 (1%)

Query: 13 MSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFLSNS 72
          M+GNKVSHANNKTRRRFLPN+   +   +   +   LR+S   +R +++ G +   L   
Sbjct: 1  MTGNKVSHANNKTRRRFLPNIQNHSFWVEEENRFVTLRVSTKGMRIIDKLG-IKAVLDKI 59

Query: 73 KKE 75
          +  
Sbjct: 60 RAN 62


>gi|326773649|ref|ZP_08232932.1| ribosomal protein L28 [Actinomyces viscosus C505]
 gi|326636879|gb|EGE37782.1| ribosomal protein L28 [Actinomyces viscosus C505]
          Length = 63

 Score = 71.2 bits (174), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 16/57 (28%), Positives = 30/57 (52%), Gaps = 2/57 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALR 57
          M+ VC++  K  + G  VSH++ +T RR+ PN+ R+  +        +L +    L+
Sbjct: 1  MAAVCDVCGKGPIFGKSVSHSHVRTNRRWNPNIQRVRALVG--GAPKRLNVCTSCLK 55


>gi|218290484|ref|ZP_03494604.1| ribosomal protein L28 [Alicyclobacillus acidocaldarius LAA1]
 gi|218239505|gb|EED06700.1| ribosomal protein L28 [Alicyclobacillus acidocaldarius LAA1]
          Length = 63

 Score = 71.2 bits (174), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 18/57 (31%), Positives = 31/57 (54%), Gaps = 2/57 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALR 57
          M+R CE+  +    GNK+SH++  T+RR+ PNL  +    D      ++R+    L+
Sbjct: 1  MARRCEVCGRGPQVGNKISHSHILTKRRWYPNLQTVRAEVD--GSVKRIRVCTRCLK 55


>gi|126696295|ref|YP_001091181.1| 50S ribosomal protein L28 [Prochlorococcus marinus str. MIT 9301]
 gi|166226598|sp|A3PCV5|RL28_PROM0 RecName: Full=50S ribosomal protein L28
 gi|126543338|gb|ABO17580.1| 50S ribosomal protein L28 [Prochlorococcus marinus str. MIT 9301]
          Length = 78

 Score = 71.2 bits (174), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 25/72 (34%), Positives = 44/72 (61%), Gaps = 1/72 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVCELT     +G  VSH++ +T++    NL +  L  +  ++   ++IS  AL+S++
Sbjct: 1  MSRVCELTGAKANNGMAVSHSHIRTKKLQQVNLQKRRLWWEEGKKWVNIKISTKALKSIQ 60

Query: 61 RQGGLDRFLSNS 72
          + G LD+F  ++
Sbjct: 61 KVG-LDKFAKSN 71


>gi|227495859|ref|ZP_03926170.1| 50S ribosomal protein L28 [Actinomyces urogenitalis DSM 15434]
 gi|320533340|ref|ZP_08034034.1| ribosomal protein L28 [Actinomyces sp. oral taxon 171 str. F0337]
 gi|325068481|ref|ZP_08127154.1| ribosomal protein L28 [Actinomyces oris K20]
 gi|329947087|ref|ZP_08294463.1| ribosomal protein L28 [Actinomyces sp. oral taxon 170 str. F0386]
 gi|226834616|gb|EEH66999.1| 50S ribosomal protein L28 [Actinomyces urogenitalis DSM 15434]
 gi|320134455|gb|EFW26709.1| ribosomal protein L28 [Actinomyces sp. oral taxon 171 str. F0337]
 gi|328526264|gb|EGF53281.1| ribosomal protein L28 [Actinomyces sp. oral taxon 170 str. F0386]
          Length = 63

 Score = 71.2 bits (174), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 16/57 (28%), Positives = 31/57 (54%), Gaps = 2/57 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALR 57
          M+ VC++  K  + G  VSH++ +T RR+ PN+ R+  + +      +L +    L+
Sbjct: 1  MAAVCDVCGKGPIFGKSVSHSHVRTNRRWNPNIQRVRALVN--GAPKRLNVCTSCLK 55


>gi|110764475|ref|XP_395930.3| PREDICTED: 39S ribosomal protein L28, mitochondrial [Apis
           mellifera]
          Length = 274

 Score = 71.2 bits (174), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 17/79 (21%), Positives = 36/79 (45%), Gaps = 5/79 (6%)

Query: 22  NNKTRRR----FLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFLSNSKKENL 77
            NK  RR    + P L +  + S++++    + I+   +  +    G D +L  +   +L
Sbjct: 97  KNKYARRHPHFWFPTLKKSVVYSEVLDTYLSVVITNRTIDLINEHYGFDHYLLKTPACDL 156

Query: 78  -SARMRTLRSQILKKMSEK 95
            S     ++ QIL  +++K
Sbjct: 157 KSELALKIKRQILLSLADK 175


>gi|226502588|ref|NP_001148032.1| LOC100281641 [Zea mays]
 gi|195615378|gb|ACG29519.1| 50S ribosomal protein L28 [Zea mays]
          Length = 141

 Score = 71.2 bits (174), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 24/70 (34%), Positives = 39/70 (55%), Gaps = 1/70 (1%)

Query: 3   RVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQ 62
           RVC  T K     NKVS +N+KT+++   NL    L  +  ++  +LR+S  AL+++E+ 
Sbjct: 66  RVCPFTDKKTNRANKVSFSNHKTKKQQFVNLQYKKLWWEAGKRFVKLRLSTKALKTIEKH 125

Query: 63  GGLDRFLSNS 72
           G LD     +
Sbjct: 126 G-LDAVARKA 134


>gi|117928789|ref|YP_873340.1| 50S ribosomal protein L28 [Acidothermus cellulolyticus 11B]
 gi|166226531|sp|A0LV94|RL28_ACIC1 RecName: Full=50S ribosomal protein L28
 gi|117649252|gb|ABK53354.1| LSU ribosomal protein L28P [Acidothermus cellulolyticus 11B]
          Length = 62

 Score = 71.2 bits (174), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 15/57 (26%), Positives = 29/57 (50%), Gaps = 1/57 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALR 57
          M+ VC++  K    G  VSH++ +T RR+ PN+ R+  +        ++ +    L+
Sbjct: 1  MAAVCDICGKGPGFGMAVSHSHRRTHRRWNPNIQRVRALIGR-GTYKRINVCTSCLK 56


>gi|254392469|ref|ZP_05007649.1| 50S ribosomal protein L28 [Streptomyces clavuligerus ATCC 27064]
 gi|297191827|ref|ZP_06909225.1| 50S ribosomal protein L28 [Streptomyces pristinaespiralis ATCC
          25486]
 gi|326443696|ref|ZP_08218430.1| 50S ribosomal protein L28 [Streptomyces clavuligerus ATCC 27064]
 gi|197706136|gb|EDY51948.1| 50S ribosomal protein L28 [Streptomyces clavuligerus ATCC 27064]
 gi|197722016|gb|EDY65924.1| 50S ribosomal protein L28 [Streptomyces pristinaespiralis ATCC
          25486]
          Length = 61

 Score = 71.2 bits (174), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 14/57 (24%), Positives = 30/57 (52%), Gaps = 2/57 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALR 57
          M+  C++  K    GN +SH++ +T RR+ PN+ R+  +     +  +L +    ++
Sbjct: 1  MAANCDVCGKGPGFGNNISHSHRRTSRRWNPNIQRVRAVVGRTPK--RLNVCTSCIK 55


>gi|70943001|ref|XP_741599.1| hypothetical protein [Plasmodium chabaudi chabaudi]
 gi|56520081|emb|CAH84010.1| conserved hypothetical protein [Plasmodium chabaudi chabaudi]
          Length = 279

 Score = 71.2 bits (174), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 22/74 (29%), Positives = 41/74 (55%), Gaps = 2/74 (2%)

Query: 17  KVSHANNKTRRRFLPNLCRITLISDIMEQKY-QLRISKCALRSVERQGGLDRFLSNSKKE 75
           KVS++  KTR +  PN+ +  ++S+I+      +RI+  AL +++  GG D ++  +  E
Sbjct: 60  KVSYSLKKTRIKIKPNVFKKHIVSNILNTIIPSVRITTSALHAIDDAGGFDNYILRTPPE 119

Query: 76  NL-SARMRTLRSQI 88
            L S     LR+ +
Sbjct: 120 ELRSNFGEKLRNVM 133


>gi|313672663|ref|YP_004050774.1| LSU ribosomal protein l28p [Calditerrivibrio nitroreducens DSM
          19672]
 gi|312939419|gb|ADR18611.1| LSU ribosomal protein L28P [Calditerrivibrio nitroreducens DSM
          19672]
          Length = 63

 Score = 71.2 bits (174), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 17/57 (29%), Positives = 34/57 (59%), Gaps = 1/57 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALR 57
          M+R C++  K  M G+ +SHA+N TRR F PNL ++ +++       ++++    ++
Sbjct: 1  MARRCDICGKGPMFGHNISHAHNVTRRVFYPNLHKVKVLNPD-GTVARIKVCTKCIK 56


>gi|159903399|ref|YP_001550743.1| 50S ribosomal protein L28 [Prochlorococcus marinus str. MIT 9211]
 gi|226699147|sp|A9BAC7|RL28_PROM4 RecName: Full=50S ribosomal protein L28
 gi|159888575|gb|ABX08789.1| 50S ribosomal protein L28 [Prochlorococcus marinus str. MIT 9211]
          Length = 78

 Score = 71.2 bits (174), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 17/63 (26%), Positives = 39/63 (61%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC+L+     +G  VSH++ +T++    NL +  L  +  ++  ++R++   L++++
Sbjct: 1  MSRVCDLSGTRANNGMAVSHSHIRTKKLQQANLQQRKLWWEEGKKWIKVRVTTRTLKTIQ 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|312897746|ref|ZP_07757162.1| ribosomal protein L28 [Megasphaera micronuciformis F0359]
 gi|310621130|gb|EFQ04674.1| ribosomal protein L28 [Megasphaera micronuciformis F0359]
          Length = 63

 Score = 71.2 bits (174), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 21/58 (36%), Positives = 33/58 (56%), Gaps = 2/58 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS 58
          M+  CE+  K  MSG  VSH++ KT+R + PN+ R+  I D   +  ++ +    LRS
Sbjct: 1  MANYCEICGKGTMSGMNVSHSHLKTKRTWKPNIQRVRAIVD--GEAKRVNVCTRCLRS 56


>gi|300783673|ref|YP_003763964.1| 50S ribosomal protein L28 [Amycolatopsis mediterranei U32]
 gi|299793187|gb|ADJ43562.1| large subunit ribosomal protein L28 [Amycolatopsis mediterranei
          U32]
          Length = 63

 Score = 70.8 bits (173), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 15/57 (26%), Positives = 31/57 (54%), Gaps = 1/57 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALR 57
          M+ VC++  K    G  VSH++ +T RR+ PN+  +     + ++K +L +    ++
Sbjct: 1  MAAVCDVCGKGPGFGKSVSHSHRRTNRRWNPNIQTVHAKVGVSQRK-RLNVCTSCIK 56


>gi|242034375|ref|XP_002464582.1| hypothetical protein SORBIDRAFT_01g021250 [Sorghum bicolor]
 gi|241918436|gb|EER91580.1| hypothetical protein SORBIDRAFT_01g021250 [Sorghum bicolor]
          Length = 145

 Score = 70.8 bits (173), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 24/70 (34%), Positives = 39/70 (55%), Gaps = 1/70 (1%)

Query: 3   RVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQ 62
           RVC  T K     NKVS +N+KT+++   NL    L  +  ++  +LR+S  AL+++E+ 
Sbjct: 70  RVCPFTDKKTNRANKVSFSNHKTKKQQFVNLQYKKLWWEAGKRFVKLRLSTKALKTIEKH 129

Query: 63  GGLDRFLSNS 72
           G LD     +
Sbjct: 130 G-LDAVARKA 138


>gi|295111735|emb|CBL28485.1| LSU ribosomal protein L28P [Synergistetes bacterium SGP1]
          Length = 73

 Score = 70.8 bits (173), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 20/58 (34%), Positives = 33/58 (56%), Gaps = 1/58 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS 58
          M++ C+   +   SGN VSH+N  TRRR+L NL  + + +      +++R+    LRS
Sbjct: 3  MAKFCQCCGRGPASGNAVSHSNRHTRRRWLVNLQSVRIDAGD-GTTFKVRVCTKCLRS 59


>gi|213405036|ref|XP_002173290.1| 54S ribosomal protein L24 [Schizosaccharomyces japonicus yFS275]
 gi|212001337|gb|EEB06997.1| 54S ribosomal protein L24 [Schizosaccharomyces japonicus yFS275]
          Length = 194

 Score = 70.8 bits (173), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 23/87 (26%), Positives = 40/87 (45%), Gaps = 3/87 (3%)

Query: 9   KKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRF 68
             +   G  V     KT R +  N     L SD ++  ++L +    L+++++ GGLD +
Sbjct: 50  GSSTYYGKNVPDKGPKTLRTWEVNAHTKRLWSDALQMHFRLNVRARVLKTIKKDGGLDEY 109

Query: 69  LSN---SKKENLSARMRTLRSQILKKM 92
           L     S+ + L  R   LRS +  K+
Sbjct: 110 LLKSTPSRLKQLGLRGTELRSLVAYKL 136


>gi|296140529|ref|YP_003647772.1| ribosomal protein L28 [Tsukamurella paurometabola DSM 20162]
 gi|296028663|gb|ADG79433.1| ribosomal protein L28 [Tsukamurella paurometabola DSM 20162]
          Length = 63

 Score = 70.8 bits (173), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 15/57 (26%), Positives = 28/57 (49%), Gaps = 1/57 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALR 57
          M+ VC++  K    G  VSH++ +T RR+ PN+  +        Q  +L +    ++
Sbjct: 1  MAAVCDVCDKGPGFGKSVSHSHRRTNRRWNPNIQTVRAQV-APGQTKRLNVCTSCIK 56


>gi|224102207|ref|XP_002312590.1| predicted protein [Populus trichocarpa]
 gi|222852410|gb|EEE89957.1| predicted protein [Populus trichocarpa]
          Length = 126

 Score = 70.8 bits (173), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 21/70 (30%), Positives = 38/70 (54%), Gaps = 1/70 (1%)

Query: 3   RVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQ 62
           R+C  T K     NKVS +N+KT++    NL    +  +  ++  +LR+S  AL++ +++
Sbjct: 51  RICPFTGKKANRANKVSFSNHKTKKLQFVNLQYKRVWWEAGKRYVKLRLSTKALKT-KQK 109

Query: 63  GGLDRFLSNS 72
            GLD     +
Sbjct: 110 NGLDAVAKKA 119


>gi|284992419|ref|YP_003410973.1| 50S ribosomal protein L28 [Geodermatophilus obscurus DSM 43160]
 gi|284065664|gb|ADB76602.1| ribosomal protein L28 [Geodermatophilus obscurus DSM 43160]
          Length = 63

 Score = 70.8 bits (173), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 14/57 (24%), Positives = 29/57 (50%), Gaps = 1/57 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALR 57
          M+ VC++  K    G  VSH++ +T RR+ PN+  +  +     ++ ++      +R
Sbjct: 1  MAAVCDVCGKGPGFGMSVSHSHRRTPRRWNPNIQSVRALVAPGNRR-RINACTSCIR 56


>gi|115461559|ref|NP_001054379.1| Os05g0101400 [Oryza sativa Japonica Group]
 gi|57863893|gb|AAG03094.2|AC073405_10 putative ribosomal protein L28 [Oryza sativa Japonica Group]
 gi|57863847|gb|AAW56888.1| unknown protein [Oryza sativa Japonica Group]
 gi|113577930|dbj|BAF16293.1| Os05g0101400 [Oryza sativa Japonica Group]
 gi|215695247|dbj|BAG90438.1| unnamed protein product [Oryza sativa Japonica Group]
 gi|222629862|gb|EEE61994.1| hypothetical protein OsJ_16775 [Oryza sativa Japonica Group]
          Length = 137

 Score = 70.8 bits (173), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 23/70 (32%), Positives = 39/70 (55%), Gaps = 1/70 (1%)

Query: 3   RVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQ 62
           R+C  T K     NKVS +N+KT+++   NL    L  +  ++  +LR+S  AL+++E+ 
Sbjct: 62  RICPFTDKKTNRANKVSFSNHKTKKQQFVNLQYKKLWWEEGKRFVKLRLSTKALKTIEKH 121

Query: 63  GGLDRFLSNS 72
           G LD     +
Sbjct: 122 G-LDAVAKKA 130


>gi|17536507|ref|NP_493672.1| hypothetical protein T25D3.2 [Caenorhabditis elegans]
 gi|3319437|gb|AAC26291.1| Hypothetical protein T25D3.2 [Caenorhabditis elegans]
          Length = 310

 Score = 70.8 bits (173), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 22/90 (24%), Positives = 49/90 (54%), Gaps = 8/90 (8%)

Query: 8   TKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDR 67
           TKK ++    V        + F P L  + L S+I+++  ++ +++ A+R ++   GLD 
Sbjct: 119 TKKKILPRYWVP-------KLFFPALKNVVLYSEILDKYIKVTVTERAMRLIDEHFGLDY 171

Query: 68  FLSNSKKENL-SARMRTLRSQILKKMSEKS 96
           ++  SK+ +L S    +L+ ++L  ++ +S
Sbjct: 172 YILESKEIDLDSKFANSLKREMLLTLTTES 201


>gi|189425341|ref|YP_001952518.1| 50S ribosomal protein L28 [Geobacter lovleyi SZ]
 gi|226694925|sp|B3E4R2|RL28_GEOLS RecName: Full=50S ribosomal protein L28
 gi|189421600|gb|ACD95998.1| ribosomal protein L28 [Geobacter lovleyi SZ]
          Length = 64

 Score = 70.8 bits (173), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 22/58 (37%), Positives = 32/58 (55%), Gaps = 1/58 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS 58
          MSR CE+  K   +GN VSHANNKTR  + PNL ++   +        +++    +RS
Sbjct: 1  MSRKCEICGKGPSTGNNVSHANNKTRTTWYPNLQKVKAKA-ANGSVSTIKVCTRCIRS 57


>gi|221632124|ref|YP_002521345.1| 50S ribosomal protein L28 [Thermomicrobium roseum DSM 5159]
 gi|254801384|sp|B9L2A7|RL28_THERP RecName: Full=50S ribosomal protein L28
 gi|221156171|gb|ACM05298.1| ribosomal protein L28 [Thermomicrobium roseum DSM 5159]
          Length = 63

 Score = 70.8 bits (173), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 23/58 (39%), Positives = 38/58 (65%), Gaps = 2/58 (3%)

Query: 5  CELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQ 62
          CEL  K  M G+ VSH+N KT R+F PN+ R+T+I + + +  ++RI    LR++ ++
Sbjct: 4  CELCGKKPMFGHNVSHSNRKTNRKFKPNVQRVTVILNGVPK--RMRICTRCLRTLYKE 59


>gi|290566745|gb|ADD39722.1| mitochondrial ribosomal protein L28 [Trichinella spiralis]
          Length = 253

 Score = 70.8 bits (173), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 19/99 (19%), Positives = 46/99 (46%), Gaps = 10/99 (10%)

Query: 7   LTKKTVMSGNKVSHANNKTRRR---------FLPNLCRITLISDIMEQKYQLRISKCALR 57
              + ++ G K+S+   + +R          + P L +  L S+I+++   + ++   L+
Sbjct: 93  WGGEGIVKGYKLSNIPPRRKRFLPRFWLPRFWFPTLMKKVLYSEILDKYMLVTVTSRTLQ 152

Query: 58  SVERQGGLDRFLSNSKKENL-SARMRTLRSQILKKMSEK 95
            ++   GLD +L  + + +L S     L+  +L  ++ K
Sbjct: 153 LIDENQGLDYYLLRTNEVDLCSKLGCKLKRILLLALARK 191


>gi|119510400|ref|ZP_01629534.1| 50S ribosomal protein L28 [Nodularia spumigena CCY9414]
 gi|119464929|gb|EAW45832.1| 50S ribosomal protein L28 [Nodularia spumigena CCY9414]
          Length = 78

 Score = 70.8 bits (173), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 20/63 (31%), Positives = 35/63 (55%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT K   +   VSH++ +T+R    NL    +      +  ++++S  A++S+E
Sbjct: 1  MSRRCELTGKKANNAFAVSHSHRRTKRLQHANLQNKRVWWAGGNRWVRMKLSTKAIKSLE 60

Query: 61 RQG 63
           +G
Sbjct: 61 TKG 63


>gi|29829217|ref|NP_823851.1| 50S ribosomal protein L28 [Streptomyces avermitilis MA-4680]
 gi|239928715|ref|ZP_04685668.1| 50S ribosomal protein L28 [Streptomyces ghanaensis ATCC 14672]
 gi|291437039|ref|ZP_06576429.1| 50S ribosomal protein L28 [Streptomyces ghanaensis ATCC 14672]
 gi|302558170|ref|ZP_07310512.1| 50S ribosomal protein L28 [Streptomyces griseoflavus Tu4000]
 gi|329936752|ref|ZP_08286459.1| 50S ribosomal protein L28 [Streptomyces griseoaurantiacus M045]
 gi|29606323|dbj|BAC70386.1| putative ribosomal protein L28 [Streptomyces avermitilis MA-4680]
 gi|291339934|gb|EFE66890.1| 50S ribosomal protein L28 [Streptomyces ghanaensis ATCC 14672]
 gi|302475788|gb|EFL38881.1| 50S ribosomal protein L28 [Streptomyces griseoflavus Tu4000]
 gi|329303982|gb|EGG47865.1| 50S ribosomal protein L28 [Streptomyces griseoaurantiacus M045]
          Length = 61

 Score = 70.8 bits (173), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 13/57 (22%), Positives = 29/57 (50%), Gaps = 2/57 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALR 57
          M+  C++  K    GN +SH++ +T RR+ PN+ R+  +     +  ++      ++
Sbjct: 1  MAANCDVCGKGPGFGNNISHSHRRTPRRWNPNIQRVRTVVGGTPK--RVNACTSCIK 55


>gi|171741408|ref|ZP_02917215.1| hypothetical protein BIFDEN_00491 [Bifidobacterium dentium ATCC
          27678]
 gi|283455244|ref|YP_003359808.1| 50S ribosomal protein L28P [Bifidobacterium dentium Bd1]
 gi|306823694|ref|ZP_07457069.1| 50S ribosomal protein L28 [Bifidobacterium dentium ATCC 27679]
 gi|309802962|ref|ZP_07697063.1| ribosomal protein L28 [Bifidobacterium dentium JCVIHMP022]
 gi|171277022|gb|EDT44683.1| hypothetical protein BIFDEN_00491 [Bifidobacterium dentium ATCC
          27678]
 gi|283101878|gb|ADB08984.1| rpmB LSU ribosomal protein L28P [Bifidobacterium dentium Bd1]
 gi|304553401|gb|EFM41313.1| 50S ribosomal protein L28 [Bifidobacterium dentium ATCC 27679]
 gi|308220429|gb|EFO76740.1| ribosomal protein L28 [Bifidobacterium dentium JCVIHMP022]
          Length = 64

 Score = 70.8 bits (173), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 15/57 (26%), Positives = 28/57 (49%), Gaps = 2/57 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALR 57
          M+  C +  K   +G  VSH++ + +R F PNL  +    D   +  ++R+    L+
Sbjct: 1  MAARCAVCGKGPQTGYTVSHSHIRNKRTFRPNLQPVRTTID--GENVRVRVCVKCLK 55


>gi|167957091|ref|ZP_02544165.1| hypothetical protein cdiviTM7_00351 [candidate division TM7
          single-cell isolate TM7c]
          Length = 68

 Score = 70.8 bits (173), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 24/65 (36%), Positives = 39/65 (60%), Gaps = 2/65 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+  C+LT K    GN VS +  +T+R F PNL + T + D   QK  + +S  A+R+++
Sbjct: 1  MASRCDLTGKGKQYGNNVSFSLRRTKRVFKPNLQKKTFVVD--GQKITMTLSTQAIRTLK 58

Query: 61 RQGGL 65
          ++G L
Sbjct: 59 KKGIL 63


>gi|116625692|ref|YP_827848.1| 50S ribosomal protein L28 [Candidatus Solibacter usitatus
          Ellin6076]
 gi|122252115|sp|Q01S07|RL28_SOLUE RecName: Full=50S ribosomal protein L28
 gi|116228854|gb|ABJ87563.1| LSU ribosomal protein L28P [Candidatus Solibacter usitatus
          Ellin6076]
          Length = 63

 Score = 70.8 bits (173), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 16/57 (28%), Positives = 33/57 (57%), Gaps = 2/57 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALR 57
          M++ C+L  +    GN++SHA+N T+RR+  NL  +  + +   +  ++R+    +R
Sbjct: 1  MAQTCDLCGRGPAFGNRISHAHNVTKRRWNINLQSVRALVNGAGR--RMRVCTSCIR 55


>gi|291454384|ref|ZP_06593774.1| 50S ribosomal protein L28 [Streptomyces albus J1074]
 gi|291357333|gb|EFE84235.1| 50S ribosomal protein L28 [Streptomyces albus J1074]
          Length = 61

 Score = 70.8 bits (173), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 14/57 (24%), Positives = 30/57 (52%), Gaps = 2/57 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALR 57
          M+  C++  K    GN +SH++ +T RR+ PN+ R+  +     +  +L +    ++
Sbjct: 1  MAANCDVCGKGPSFGNNISHSHRRTSRRWNPNIQRVRAVVGRTPK--RLNVCTSCIK 55


>gi|220904652|ref|YP_002479964.1| 50S ribosomal protein L28 [Desulfovibrio desulfuricans subsp.
          desulfuricans str. ATCC 27774]
 gi|254801355|sp|B8J0K9|RL28_DESDA RecName: Full=50S ribosomal protein L28
 gi|219868951|gb|ACL49286.1| ribosomal protein L28 [Desulfovibrio desulfuricans subsp.
          desulfuricans str. ATCC 27774]
          Length = 69

 Score = 70.8 bits (173), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 23/58 (39%), Positives = 28/58 (48%), Gaps = 1/58 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS 58
          MS+ C    K    GN VSH+N KT+RRF PNL R+            L +    LRS
Sbjct: 1  MSKECIFCGKKPQVGNLVSHSNIKTKRRFNPNLQRVRHQF-ADGSVRTLTVCTRCLRS 57


>gi|258511311|ref|YP_003184745.1| 50S ribosomal protein L28 [Alicyclobacillus acidocaldarius subsp.
          acidocaldarius DSM 446]
 gi|257478037|gb|ACV58356.1| ribosomal protein L28 [Alicyclobacillus acidocaldarius subsp.
          acidocaldarius DSM 446]
          Length = 63

 Score = 70.8 bits (173), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 18/57 (31%), Positives = 32/57 (56%), Gaps = 2/57 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALR 57
          M+R CE+  +    GNK+SH++  T+RR+ PNL  +  + D      ++R+    L+
Sbjct: 1  MARRCEVCGRGPQVGNKISHSHILTKRRWYPNLQSVRAVVD--GSVKRIRVCTRCLK 55


>gi|254411356|ref|ZP_05025133.1| ribosomal protein L28 [Microcoleus chthonoplastes PCC 7420]
 gi|196181857|gb|EDX76844.1| ribosomal protein L28 [Microcoleus chthonoplastes PCC 7420]
          Length = 78

 Score = 70.8 bits (173), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 18/63 (28%), Positives = 36/63 (57%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR C+LT K   +   +SH++ +T++    NL    +      +  +LR+S  A++++E
Sbjct: 1  MSRKCQLTGKKANNAYAISHSHRRTKKLQEANLQWKRVWWQEGNRWVKLRLSTKAIKTLE 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|321478309|gb|EFX89266.1| hypothetical protein DAPPUDRAFT_94742 [Daphnia pulex]
          Length = 257

 Score = 70.5 bits (172), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 15/74 (20%), Positives = 39/74 (52%), Gaps = 1/74 (1%)

Query: 23  NKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFLSNSKKENL-SARM 81
            +    + P+L +  L S+I+++  ++ ++   LR V++  G D ++  +  ++L S   
Sbjct: 88  RRAAHFWFPSLIKSVLYSEILDKHMEITVTPRTLRLVDQHYGFDSYILETPPQDLKSNLG 147

Query: 82  RTLRSQILKKMSEK 95
             L+  +L  +++K
Sbjct: 148 VKLKRSLLLALAKK 161


>gi|291299621|ref|YP_003510899.1| 50S ribosomal protein L28 [Stackebrandtia nassauensis DSM 44728]
 gi|290568841|gb|ADD41806.1| ribosomal protein L28 [Stackebrandtia nassauensis DSM 44728]
          Length = 63

 Score = 70.5 bits (172), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 16/57 (28%), Positives = 28/57 (49%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALR 57
          MSR CE+  K    G+ V  +  KT RR+ PNL  +   +   +   ++++    L+
Sbjct: 1  MSRKCEVCGKGPGFGHNVPWSKKKTNRRWNPNLQSVRASTGSGDNLKRVKVCTSCLK 57


>gi|51892497|ref|YP_075188.1| 50S ribosomal protein L28 [Symbiobacterium thermophilum IAM
          14863]
 gi|67461381|sp|Q67PP9|RL28_SYMTH RecName: Full=50S ribosomal protein L28
 gi|51856186|dbj|BAD40344.1| 50S ribosomal protein L28 [Symbiobacterium thermophilum IAM
          14863]
          Length = 63

 Score = 70.5 bits (172), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 21/58 (36%), Positives = 33/58 (56%), Gaps = 2/58 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS 58
          M+R CE+  K V  G+ VSHA NKT+R + PN+  +  + D   +  ++ +    LRS
Sbjct: 1  MARRCEVCNKGVSHGHNVSHAENKTKRTWSPNVQTVRAVVD--GRVKRITVCTRCLRS 56


>gi|330906445|ref|XP_003295477.1| hypothetical protein PTT_01224 [Pyrenophora teres f. teres 0-1]
 gi|311333213|gb|EFQ96431.1| hypothetical protein PTT_01224 [Pyrenophora teres f. teres 0-1]
          Length = 486

 Score = 70.5 bits (172), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 27/86 (31%), Positives = 49/86 (56%), Gaps = 4/86 (4%)

Query: 10  KTVMSGNKVSHAN-NKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRF 68
           K V  GN VS     KTRR++ PN+   +L S  +++K +L ++K  L+ ++R+GGLD +
Sbjct: 91  KRVRFGNNVSKKTETKTRRKWTPNVLTKSLYSVALKKKIKLALAKHILKIIDREGGLDEY 150

Query: 69  LSN---SKKENLSARMRTLRSQILKK 91
           L     ++ + L      LR  ++++
Sbjct: 151 LLKDNEARIKELGPMGWALRWTLMQR 176


>gi|94987268|ref|YP_595201.1| 50S ribosomal protein L28 [Lawsonia intracellularis PHE/MN1-00]
 gi|166226584|sp|Q1MQ47|RL28_LAWIP RecName: Full=50S ribosomal protein L28
 gi|94731517|emb|CAJ54880.1| ribosomal protein L28 [Lawsonia intracellularis PHE/MN1-00]
          Length = 69

 Score = 70.5 bits (172), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 20/58 (34%), Positives = 30/58 (51%), Gaps = 1/58 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS 58
          M++ CE+  K  + GN VSH+N KT+R F PNL  +        +   + I    +RS
Sbjct: 1  MAKQCEICGKKPLVGNYVSHSNIKTKRVFNPNLQHMRNQFPD-GRIKTITICTRCIRS 57


>gi|205355326|ref|ZP_03222097.1| 50S ribosomal protein L28 [Campylobacter jejuni subsp. jejuni
          CG8421]
 gi|205346560|gb|EDZ33192.1| 50S ribosomal protein L28 [Campylobacter jejuni subsp. jejuni
          CG8421]
          Length = 78

 Score = 70.5 bits (172), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 28/61 (45%), Positives = 42/61 (68%), Gaps = 1/61 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVC++T K  M GN VSHANNKT+RRFLPNL  + +  +      ++RI+   LR+++
Sbjct: 15 MARVCQITGKGPMVGNNVSHANNKTKRRFLPNLRTVRVTLED-GTTRKMRIAASTLRTLK 73

Query: 61 R 61
          +
Sbjct: 74 K 74


>gi|261749205|ref|YP_003256890.1| 50S ribosomal protein L28 [Blattabacterium sp. (Periplaneta
          americana) str. BPLAN]
 gi|261497297|gb|ACX83747.1| 50S ribosomal protein L28 [Blattabacterium sp. (Periplaneta
          americana) str. BPLAN]
          Length = 75

 Score = 70.5 bits (172), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 28/63 (44%), Positives = 39/63 (61%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS+VCELT K  M GN+VSHANNK +RRF  NLC+        ++   L+I   A++ + 
Sbjct: 1  MSKVCELTGKRAMIGNRVSHANNKNKRRFNINLCKKRFFLTKEKKWITLKICTSAIKLIN 60

Query: 61 RQG 63
          + G
Sbjct: 61 KIG 63


>gi|78044163|ref|YP_360301.1| 50S ribosomal protein L28 [Carboxydothermus hydrogenoformans
          Z-2901]
 gi|123576142|sp|Q3AC33|RL28_CARHZ RecName: Full=50S ribosomal protein L28
 gi|77996278|gb|ABB15177.1| ribosomal protein L28 [Carboxydothermus hydrogenoformans Z-2901]
          Length = 62

 Score = 70.5 bits (172), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 19/58 (32%), Positives = 38/58 (65%), Gaps = 2/58 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS 58
          M++VCE+  K V+ G+++SH+N  T+R++LPNL R+  + +   +  ++ +    L+S
Sbjct: 1  MAKVCEICGKGVVYGHQISHSNIHTKRKWLPNLQRVRAVVNGTRR--RITVCTTCLKS 56


>gi|227875293|ref|ZP_03993435.1| 50S ribosomal protein L28 [Mobiluncus mulieris ATCC 35243]
 gi|269978180|ref|ZP_06185130.1| ribosomal protein L28 [Mobiluncus mulieris 28-1]
 gi|306818555|ref|ZP_07452278.1| 50S ribosomal protein L28 [Mobiluncus mulieris ATCC 35239]
 gi|307700759|ref|ZP_07637784.1| ribosomal protein L28 [Mobiluncus mulieris FB024-16]
 gi|227844198|gb|EEJ54365.1| 50S ribosomal protein L28 [Mobiluncus mulieris ATCC 35243]
 gi|269933689|gb|EEZ90273.1| ribosomal protein L28 [Mobiluncus mulieris 28-1]
 gi|304648728|gb|EFM46030.1| 50S ribosomal protein L28 [Mobiluncus mulieris ATCC 35239]
 gi|307613754|gb|EFN92998.1| ribosomal protein L28 [Mobiluncus mulieris FB024-16]
          Length = 65

 Score = 70.5 bits (172), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 16/58 (27%), Positives = 30/58 (51%), Gaps = 2/58 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS 58
          M+ VC++  K    G  VSH++ + +RRF PN+ R+  +     +   L +    ++S
Sbjct: 1  MAAVCDICGKGPGFGMSVSHSHRRNKRRFNPNIQRVRALVKGTPKH--LNVCTKCIKS 56


>gi|297626614|ref|YP_003688377.1| ribosomal protein L28 [Propionibacterium freudenreichii subsp.
          shermanii CIRM-BIA1]
 gi|296922379|emb|CBL56951.1| Ribosomal protein L28 [Propionibacterium freudenreichii subsp.
          shermanii CIRM-BIA1]
          Length = 61

 Score = 70.5 bits (172), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 16/57 (28%), Positives = 29/57 (50%), Gaps = 2/57 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALR 57
          M+ VCE+  K    G+ V  +  KT RR+ PN+ R+  + +   +  +L +    L+
Sbjct: 1  MAAVCEICGKGPGFGHNVPWSKKKTNRRWNPNIQRVHAVVNGTAK--RLNVCTSCLK 55


>gi|258405533|ref|YP_003198275.1| 50S ribosomal protein L28 [Desulfohalobium retbaense DSM 5692]
 gi|257797760|gb|ACV68697.1| ribosomal protein L28 [Desulfohalobium retbaense DSM 5692]
          Length = 65

 Score = 70.5 bits (172), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 25/58 (43%), Positives = 31/58 (53%), Gaps = 1/58 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS 58
          MS+ C    K    GN VSHANNKT+RRF+PNL R+        Q  ++      LRS
Sbjct: 1  MSKECYFCGKKPQVGNNVSHANNKTKRRFMPNLQRVRTQL-SSGQVKKVTACTRCLRS 57


>gi|94967196|ref|YP_589244.1| 50S ribosomal protein L28 [Candidatus Koribacter versatilis
          Ellin345]
 gi|166226529|sp|Q1IVD0|RL28_ACIBL RecName: Full=50S ribosomal protein L28
 gi|94549246|gb|ABF39170.1| LSU ribosomal protein L28P [Candidatus Koribacter versatilis
          Ellin345]
          Length = 62

 Score = 70.5 bits (172), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 19/58 (32%), Positives = 32/58 (55%), Gaps = 2/58 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS 58
          M++VC++  K    GN +SHA+N T+RR+  NL  +    +      ++R+    LRS
Sbjct: 1  MAQVCDMCGKGPQFGNNISHAHNVTKRRWNVNLRPVRAKVN--GATKRMRVCTTCLRS 56


>gi|145220200|ref|YP_001130909.1| 50S ribosomal protein L28 [Prosthecochloris vibrioformis DSM 265]
 gi|189029450|sp|A4SFZ8|RL28_PROVI RecName: Full=50S ribosomal protein L28
 gi|145206364|gb|ABP37407.1| LSU ribosomal protein L28P [Chlorobium phaeovibrioides DSM 265]
          Length = 72

 Score = 70.5 bits (172), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 25/63 (39%), Positives = 37/63 (58%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS+VC LT K    GN VSHANN  R RF PNL    +  +  ++  ++++S  A+R + 
Sbjct: 1  MSKVCVLTGKRPKYGNTVSHANNHRRTRFEPNLHTKRIWIEEEKRWAKVKLSAKAMRIIA 60

Query: 61 RQG 63
          + G
Sbjct: 61 KTG 63


>gi|312076938|ref|XP_003141083.1| hypothetical protein LOAG_05498 [Loa loa]
 gi|307763750|gb|EFO22984.1| hypothetical protein LOAG_05498 [Loa loa]
          Length = 611

 Score = 70.5 bits (172), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 19/89 (21%), Positives = 46/89 (51%), Gaps = 8/89 (8%)

Query: 7   LTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLD 66
            TKK ++  + V H        F PNL  +   S+++++  ++ +++   R +++  GLD
Sbjct: 120 FTKKKILPRHWVPHF-------FFPNLKNVLTYSEVLDKHMKITMTERTCRLIDQHFGLD 172

Query: 67  RFLSNSKKENL-SARMRTLRSQILKKMSE 94
            +L  + + ++ S     L+ +IL  +++
Sbjct: 173 LYLLETPEIDIASKLGNKLKREILLVLAK 201


>gi|33237910|gb|AAP99977.1| Ribosomal protein L28 [Prochlorococcus marinus subsp. marinus
          str. CCMP1375]
          Length = 82

 Score = 70.5 bits (172), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 21/68 (30%), Positives = 41/68 (60%), Gaps = 1/68 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVCEL+     +G  VSH++ +T++    NL +  L  +  ++   +R+S   L++++
Sbjct: 5  MSRVCELSGTRANNGMAVSHSHIRTKKLQQANLQKRRLWWEEGKKWLNIRVSTSTLKTIQ 64

Query: 61 RQGGLDRF 68
          ++G LD +
Sbjct: 65 KKG-LDSY 71


>gi|57242275|ref|ZP_00370214.1| ribosomal protein L28 [Campylobacter upsaliensis RM3195]
 gi|57016955|gb|EAL53737.1| ribosomal protein L28 [Campylobacter upsaliensis RM3195]
          Length = 64

 Score = 70.5 bits (172), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 27/61 (44%), Positives = 41/61 (67%), Gaps = 1/61 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+R+C++T K  M GN VSHANNKT+RRFLPNL  + +  +      + RI+   LR+++
Sbjct: 1  MARICQITGKGPMVGNNVSHANNKTKRRFLPNLRTVRITLED-GTTRKARIAASTLRTLK 59

Query: 61 R 61
          +
Sbjct: 60 K 60


>gi|119356418|ref|YP_911062.1| 50S ribosomal protein L28 [Chlorobium phaeobacteroides DSM 266]
 gi|166226561|sp|A1BE11|RL28_CHLPD RecName: Full=50S ribosomal protein L28
 gi|119353767|gb|ABL64638.1| LSU ribosomal protein L28P [Chlorobium phaeobacteroides DSM 266]
          Length = 72

 Score = 70.5 bits (172), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 24/63 (38%), Positives = 37/63 (58%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS+VC LT K    GN VSHANN  R RF PNL    +  +  ++  ++++S  A++ + 
Sbjct: 1  MSKVCVLTGKRPKYGNTVSHANNHVRTRFEPNLHTKKIWIEEEKRFVKVKLSAKAMKIIA 60

Query: 61 RQG 63
          + G
Sbjct: 61 KTG 63


>gi|32491152|ref|NP_871406.1| hypothetical protein WGLp403 [Wigglesworthia glossinidia
          endosymbiont of Glossina brevipalpis]
 gi|31340353|sp|Q8D2F1|RL28_WIGBR RecName: Full=50S ribosomal protein L28
 gi|25166359|dbj|BAC24549.1| rpmB [Wigglesworthia glossinidia endosymbiont of Glossina
          brevipalpis]
          Length = 78

 Score = 70.1 bits (171), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 27/63 (42%), Positives = 39/63 (61%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR+C++T K  +SGNK SH+ N  +R+F PNL       D  ++   LRISK  LR ++
Sbjct: 1  MSRICQITGKKPLSGNKRSHSMNAKKRKFFPNLHNHRFWLDKEKKFINLRISKQGLRLID 60

Query: 61 RQG 63
          + G
Sbjct: 61 KYG 63


>gi|241729588|ref|XP_002404608.1| 39S ribosomal protein L28, putative [Ixodes scapularis]
 gi|215505496|gb|EEC14990.1| 39S ribosomal protein L28, putative [Ixodes scapularis]
          Length = 270

 Score = 70.1 bits (171), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 17/97 (17%), Positives = 48/97 (49%), Gaps = 5/97 (5%)

Query: 3   RVCE---LTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSV 59
           + C+      + ++SG +      +  + F P L R  + S+I+++  ++ +++  +  +
Sbjct: 73  KECQQGIWGGEGIISGYRRRKYG-RYSKYFTPILKRGVVYSEILDKYMRVTLTERTVLLI 131

Query: 60  ERQGGLDRFLSNSKKENL-SARMRTLRSQILKKMSEK 95
            +  G D+++  +  ++L S     LR ++L  ++ K
Sbjct: 132 NQNFGFDQYILKTPVQDLKSQLALDLRRKMLLALARK 168


>gi|312880184|ref|ZP_07739984.1| LSU ribosomal protein L28P [Aminomonas paucivorans DSM 12260]
 gi|310783475|gb|EFQ23873.1| LSU ribosomal protein L28P [Aminomonas paucivorans DSM 12260]
          Length = 64

 Score = 70.1 bits (171), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 21/58 (36%), Positives = 31/58 (53%), Gaps = 1/58 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS 58
          MSRVC+   +   +GN VSH+   TRRR+L NL  + +      +  +L +    LRS
Sbjct: 1  MSRVCDCCGRGPQTGNSVSHSVRHTRRRWLINLQSVRVDVGC-GETKRLHVCTKCLRS 57


>gi|311898527|dbj|BAJ30935.1| putative ribosomal protein L28 [Kitasatospora setae KM-6054]
          Length = 61

 Score = 70.1 bits (171), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 13/57 (22%), Positives = 29/57 (50%), Gaps = 2/57 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALR 57
          M+  C++  K    GN +SH++ +T RR+ PN+  +  +     +  +L +    ++
Sbjct: 1  MAANCDVCGKGPGFGNSISHSHRRTPRRWNPNIQTVRAVIGRTPK--RLNVCTSCIK 55


>gi|290967866|ref|ZP_06559417.1| ribosomal protein L28 [Megasphaera genomosp. type_1 str. 28L]
 gi|290782106|gb|EFD94683.1| ribosomal protein L28 [Megasphaera genomosp. type_1 str. 28L]
          Length = 63

 Score = 70.1 bits (171), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 18/58 (31%), Positives = 33/58 (56%), Gaps = 2/58 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS 58
          M+  CE+  K  M+G  VSH++ KT+R + PN+ R+  + +   +  ++ +    LRS
Sbjct: 1  MANYCEICGKGKMAGMNVSHSHLKTKRTWKPNIQRVRAMVE--GEVKRVNVCTRCLRS 56


>gi|304437378|ref|ZP_07397337.1| 50S ribosomal protein L28 [Selenomonas sp. oral taxon 149 str.
          67H29BP]
 gi|304369634|gb|EFM23300.1| 50S ribosomal protein L28 [Selenomonas sp. oral taxon 149 str.
          67H29BP]
          Length = 63

 Score = 70.1 bits (171), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 21/58 (36%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS 58
          M+ VCE+  K +MSGN VSH++ KT+R++ PN+ R+  +     +  ++ +    LRS
Sbjct: 1  MASVCEVCGKGMMSGNNVSHSHVKTKRKWKPNIQRVRALVK--GEVKRVNVCTRCLRS 56


>gi|311742952|ref|ZP_07716760.1| 50S ribosomal protein L28 [Aeromicrobium marinum DSM 15272]
 gi|311313632|gb|EFQ83541.1| 50S ribosomal protein L28 [Aeromicrobium marinum DSM 15272]
          Length = 64

 Score = 70.1 bits (171), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 16/56 (28%), Positives = 32/56 (57%), Gaps = 2/56 (3%)

Query: 2  SRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALR 57
          + VC++  K    G+ VSH++ +T+RRF PN+ R+  + +   Q  ++ +    L+
Sbjct: 5  AAVCDVCSKGPGFGHNVSHSHRRTKRRFDPNIQRVRAVVNGTPQ--RVNVCTSCLK 58


>gi|156100187|ref|XP_001615821.1| hypothetical protein [Plasmodium vivax SaI-1]
 gi|148804695|gb|EDL46094.1| hypothetical protein, conserved [Plasmodium vivax]
          Length = 281

 Score = 70.1 bits (171), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 20/74 (27%), Positives = 41/74 (55%), Gaps = 2/74 (2%)

Query: 17  KVSHANNKTRRRFLPNLCRITLISDIMEQKY-QLRISKCALRSVERQGGLDRFLSNSKKE 75
           KVS++  KTR +  PN+ +  ++S+I+      ++++  AL +++  GG D ++  +  E
Sbjct: 60  KVSYSLKKTRIKLKPNVFKKHIVSNILNTIIPNVKVTTSALHAMDDAGGFDNYILRTPPE 119

Query: 76  NL-SARMRTLRSQI 88
            L S     L+S +
Sbjct: 120 ELRSNFGEKLKSVM 133


>gi|157163889|ref|YP_001466762.1| 50S ribosomal protein L28 [Campylobacter concisus 13826]
 gi|166226555|sp|A7ZDA4|RL28_CAMC1 RecName: Full=50S ribosomal protein L28
 gi|112800136|gb|EAT97480.1| ribosomal protein L28 [Campylobacter concisus 13826]
          Length = 63

 Score = 70.1 bits (171), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 26/61 (42%), Positives = 40/61 (65%), Gaps = 1/61 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS+ C +T K  M GN VSHANNKT+RRFLPNL  I +  +      +++++   LR+++
Sbjct: 1  MSKRCAITGKGPMVGNNVSHANNKTKRRFLPNLRTIRVTLED-GTTRRIKVAASTLRTMK 59

Query: 61 R 61
          +
Sbjct: 60 K 60


>gi|300864309|ref|ZP_07109187.1| 50S ribosomal protein L28 [Oscillatoria sp. PCC 6506]
 gi|300337698|emb|CBN54333.1| 50S ribosomal protein L28 [Oscillatoria sp. PCC 6506]
          Length = 78

 Score = 70.1 bits (171), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 18/63 (28%), Positives = 35/63 (55%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR C+LT K   +G  VSH++ +T +    NL    +     ++  +L +S  A+++++
Sbjct: 1  MSRKCQLTGKKANNGMAVSHSHRRTHKLQEANLQWKRIWWPQGKRWVKLHLSTKAIKTIQ 60

Query: 61 RQG 63
           +G
Sbjct: 61 LKG 63


>gi|154173798|ref|YP_001408511.1| 50S ribosomal protein L28 [Campylobacter curvus 525.92]
 gi|166226556|sp|A7GZ69|RL28_CAMC5 RecName: Full=50S ribosomal protein L28
 gi|112803079|gb|EAU00423.1| ribosomal protein L28 [Campylobacter curvus 525.92]
          Length = 63

 Score = 70.1 bits (171), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 27/61 (44%), Positives = 40/61 (65%), Gaps = 1/61 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR C +T K  M GN VSHANNKT+RRFLPNL  I +  +      +++++   LR+++
Sbjct: 1  MSRRCAITGKGPMVGNNVSHANNKTKRRFLPNLRTIRVTLED-GTTRKIKVAASTLRTMK 59

Query: 61 R 61
          +
Sbjct: 60 K 60


>gi|89895425|ref|YP_518912.1| 50S ribosomal protein L28 [Desulfitobacterium hafniense Y51]
 gi|219669856|ref|YP_002460291.1| 50S ribosomal protein L28 [Desulfitobacterium hafniense DCB-2]
 gi|122482250|sp|Q24U24|RL28_DESHY RecName: Full=50S ribosomal protein L28
 gi|254801356|sp|B8FS67|RL28_DESHD RecName: Full=50S ribosomal protein L28
 gi|89334873|dbj|BAE84468.1| 50S ribosomal protein L28 [Desulfitobacterium hafniense Y51]
 gi|219540116|gb|ACL21855.1| ribosomal protein L28 [Desulfitobacterium hafniense DCB-2]
          Length = 63

 Score = 70.1 bits (171), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 20/58 (34%), Positives = 33/58 (56%), Gaps = 2/58 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS 58
          M+ VC +  K V SG +VSH++ +T+R + PNL R+  I +      ++ +    LRS
Sbjct: 1  MANVCAICGKGVASGIQVSHSHIRTKRTWKPNLQRVHAIVN--GTPTRISVCTRCLRS 56


>gi|222099405|ref|YP_002533973.1| 50S ribosomal protein L28 [Thermotoga neapolitana DSM 4359]
 gi|221571795|gb|ACM22607.1| 50S ribosomal protein L28 [Thermotoga neapolitana DSM 4359]
          Length = 72

 Score = 70.1 bits (171), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 32/57 (56%), Gaps = 1/57 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALR 57
          M++ CE+  K   SGN VSH+N KT R F PNL ++ ++        ++R+    L+
Sbjct: 3  MAKRCEVCGKAPRSGNNVSHSNKKTGRWFRPNLQKVRVVLPD-GTIKRMRVCTSCLK 58


>gi|161407960|ref|NP_875325.2| 50S ribosomal protein L28 [Prochlorococcus marinus subsp. marinus
          str. CCMP1375]
 gi|67461503|sp|Q7VC09|RL28_PROMA RecName: Full=50S ribosomal protein L28
          Length = 78

 Score = 70.1 bits (171), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 21/68 (30%), Positives = 41/68 (60%), Gaps = 1/68 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVCEL+     +G  VSH++ +T++    NL +  L  +  ++   +R+S   L++++
Sbjct: 1  MSRVCELSGTRANNGMAVSHSHIRTKKLQQANLQKRRLWWEEGKKWLNIRVSTSTLKTIQ 60

Query: 61 RQGGLDRF 68
          ++G LD +
Sbjct: 61 KKG-LDSY 67


>gi|307109659|gb|EFN57896.1| hypothetical protein CHLNCDRAFT_15707 [Chlorella variabilis]
          Length = 77

 Score = 70.1 bits (171), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 20/83 (24%), Positives = 40/83 (48%), Gaps = 6/83 (7%)

Query: 2  SRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVER 61
          SRVC+LT K   +G  V+ ++ + ++    NL    +     ++  +LRIS  A++S+E+
Sbjct: 1  SRVCDLTGKRANNGYVVTFSHKRNKKLQQVNLQYKKVYWPEGQRWVKLRISTKAIKSIEK 60

Query: 62 QGGLDRFLSNSKKENLSARMRTL 84
          +G        +  +     +  L
Sbjct: 61 KG------LQTMADEAGIDLWKL 77


>gi|262203092|ref|YP_003274300.1| 50S ribosomal protein L28 [Gordonia bronchialis DSM 43247]
 gi|262086439|gb|ACY22407.1| ribosomal protein L28 [Gordonia bronchialis DSM 43247]
          Length = 63

 Score = 70.1 bits (171), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 15/57 (26%), Positives = 29/57 (50%), Gaps = 1/57 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALR 57
          M+ VC++  K    G  VSH++ +T RR+ PN+  + +      +K +  +    L+
Sbjct: 1  MAAVCDICGKGPGFGKSVSHSHRRTNRRWNPNIQSVRVEVAPGNRK-RKNVCTSCLK 56


>gi|313901536|ref|ZP_07834981.1| LSU ribosomal protein L28P [Thermaerobacter subterraneus DSM
          13965]
 gi|313468197|gb|EFR63666.1| LSU ribosomal protein L28P [Thermaerobacter subterraneus DSM
          13965]
          Length = 63

 Score = 70.1 bits (171), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 22/58 (37%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS 58
          M+R CE+  K V  GN+VSH+N K+RR + PNL R+  ++    +  ++R+    L+S
Sbjct: 1  MARRCEICGKGVDYGNQVSHSNRKSRRIWGPNLQRVRAVTPQGVR--RIRVCTTCLKS 56


>gi|289643461|ref|ZP_06475580.1| ribosomal protein L28 [Frankia symbiont of Datisca glomerata]
 gi|289506713|gb|EFD27693.1| ribosomal protein L28 [Frankia symbiont of Datisca glomerata]
          Length = 80

 Score = 69.7 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 23/86 (26%), Positives = 43/86 (50%), Gaps = 8/86 (9%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKY--QLRISKCALRS 58
          MS  C++T +    G +VSH++ +TRRR+ PN+ + T       ++    L +S   +++
Sbjct: 1  MSARCQVTGRKPGFGMRVSHSHRRTRRRWDPNIQKKTYWLPGENRRVTLTLTLSAKGIKT 60

Query: 59 VERQGGLDRFLSNSKKENLSARMRTL 84
          V+R+G        +    L AR   +
Sbjct: 61 VDRRG------IEAVVRELRARGVKV 80


>gi|325001794|ref|ZP_08122906.1| 50S ribosomal protein L28 [Pseudonocardia sp. P1]
          Length = 63

 Score = 69.7 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 14/57 (24%), Positives = 29/57 (50%), Gaps = 1/57 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALR 57
          M+ VC++  K    G  VSH++ +T RR+ PN+  +    +   ++ ++      L+
Sbjct: 1  MAAVCDVCGKGPGFGMSVSHSHRRTNRRWNPNIQTVRAAINGGNRR-RINACTSCLK 56


>gi|303286063|ref|XP_003062321.1| predicted protein [Micromonas pusilla CCMP1545]
 gi|226455838|gb|EEH53140.1| predicted protein [Micromonas pusilla CCMP1545]
          Length = 200

 Score = 69.7 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 17/61 (27%), Positives = 31/61 (50%)

Query: 3   RVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQ 62
           R C LT K   +G  VS ++ + ++    NL    +     ++  +LRIS  AL+++ + 
Sbjct: 58  RKCMLTGKKANNGYTVSFSHIRNKKLQGANLQYKRVYWPEQQRYIRLRISTNALKTINKV 117

Query: 63  G 63
           G
Sbjct: 118 G 118


>gi|169830811|ref|YP_001716793.1| 50S ribosomal protein L28 [Candidatus Desulforudis audaxviator
          MP104C]
 gi|226738067|sp|B1I2D5|RL28_DESAP RecName: Full=50S ribosomal protein L28
 gi|169637655|gb|ACA59161.1| ribosomal protein L28 [Candidatus Desulforudis audaxviator
          MP104C]
          Length = 63

 Score = 69.7 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 20/58 (34%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS 58
          M++ C+L  K V+ G K+SH++ +T+R + PNL R+  + D   +  ++R+    LRS
Sbjct: 1  MAKKCDLCGKGVVVGMKLSHSHIRTKRTWEPNLQRVRALVD--GKPRRIRVCTRCLRS 56


>gi|158335837|ref|YP_001517011.1| 50S ribosomal protein L28 [Acaryochloris marina MBIC11017]
 gi|189042422|sp|B0C811|RL28_ACAM1 RecName: Full=50S ribosomal protein L28
 gi|158306078|gb|ABW27695.1| 50S ribosomal protein L28 [Acaryochloris marina MBIC11017]
          Length = 78

 Score = 69.7 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 17/63 (26%), Positives = 35/63 (55%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M + C+LT K   +   VSH++ +T +    NL    +     ++  +LR+S  A++++E
Sbjct: 1  MGKKCQLTGKKANNAFAVSHSHRRTHKLQEANLQWKRVWWPQEKRWVKLRLSTKAIKTLE 60

Query: 61 RQG 63
          ++G
Sbjct: 61 KKG 63


>gi|8928328|sp|O50656|RL28_SELRU RecName: Full=50S ribosomal protein L28
 gi|2897823|dbj|BAA24922.1| hypothetical protein [Selenomonas ruminantium]
 gi|28804805|dbj|BAC57939.1| ribosomal protein L28 [Selenomonas ruminantium]
          Length = 63

 Score = 69.7 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 21/58 (36%), Positives = 35/58 (60%), Gaps = 2/58 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS 58
          M+ VCE+  K  +SGN VSH++ KTRR + PN+ R+  + +   +  ++ +    LRS
Sbjct: 1  MASVCEICAKGELSGNNVSHSHLKTRRTWKPNIQRVRAVVE--GEVKRVNVCTRCLRS 56


>gi|302554397|ref|ZP_07306739.1| ribosomal protein L28 [Streptomyces viridochromogenes DSM 40736]
 gi|302472015|gb|EFL35108.1| ribosomal protein L28 [Streptomyces viridochromogenes DSM 40736]
          Length = 61

 Score = 69.7 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 13/57 (22%), Positives = 29/57 (50%), Gaps = 2/57 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALR 57
          M+  C++  K    GN +SH++ +T RR+ PN+ R+  +     +  ++      ++
Sbjct: 1  MAANCDVCGKGPGFGNNISHSHRRTSRRWNPNIQRVRTVVGGTPK--RVNACTSCIK 55


>gi|118468800|ref|YP_886741.1| 50S ribosomal protein L28 [Mycobacterium smegmatis str. MC2 155]
 gi|118170087|gb|ABK70983.1| ribosomal protein L28 [Mycobacterium smegmatis str. MC2 155]
          Length = 64

 Score = 69.7 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 14/57 (24%), Positives = 29/57 (50%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALR 57
          M+ VC++  K    G  VSH++ +T RR+ PN+  +  ++     K ++      ++
Sbjct: 1  MAAVCDICGKGPGFGKSVSHSHRRTSRRWNPNIQPVRAVTRPGGNKQRINACTSCIK 57


>gi|319955905|ref|YP_004167168.1| LSU ribosomal protein l28p [Nitratifractor salsuginis DSM 16511]
 gi|319418309|gb|ADV45419.1| LSU ribosomal protein L28P [Nitratifractor salsuginis DSM 16511]
          Length = 70

 Score = 69.7 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 21/62 (33%), Positives = 41/62 (66%), Gaps = 1/62 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+R C++T K  + G  VSHA+NKT++R LPNL  + +  +   +K +++++   LR++ 
Sbjct: 1  MARRCQITGKGPLVGYNVSHAHNKTKKRQLPNLRTVRITLEDGTRK-KIKVAASTLRTMR 59

Query: 61 RQ 62
          ++
Sbjct: 60 KK 61


>gi|148925829|ref|ZP_01809516.1| 50S ribosomal protein L28 [Campylobacter jejuni subsp. jejuni
          CG8486]
 gi|145844815|gb|EDK21919.1| 50S ribosomal protein L28 [Campylobacter jejuni subsp. jejuni
          CG8486]
 gi|307747382|gb|ADN90652.1| 50S ribosomal protein L28 [Campylobacter jejuni subsp. jejuni M1]
          Length = 78

 Score = 69.7 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 28/61 (45%), Positives = 42/61 (68%), Gaps = 1/61 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+RVC++T K  M GN VSHANNKT+RRFLPNL  + +  +      ++RI+   LR+++
Sbjct: 15 MARVCQITGKGPMVGNNVSHANNKTKRRFLPNLRTVRVTLED-GTTRKMRIAASTLRTLK 73

Query: 61 R 61
          +
Sbjct: 74 K 74


>gi|182435709|ref|YP_001823428.1| 50S ribosomal protein L28 [Streptomyces griseus subsp. griseus
          NBRC 13350]
 gi|282861346|ref|ZP_06270411.1| ribosomal protein L28 [Streptomyces sp. ACTE]
 gi|326776334|ref|ZP_08235599.1| 50S ribosomal protein L28 [Streptomyces cf. griseus XylebKG-1]
 gi|178464225|dbj|BAG18745.1| putative 50S ribosomal protein L28 [Streptomyces griseus subsp.
          griseus NBRC 13350]
 gi|282564004|gb|EFB69541.1| ribosomal protein L28 [Streptomyces sp. ACTE]
 gi|320008322|gb|ADW03172.1| ribosomal protein L28 [Streptomyces flavogriseus ATCC 33331]
 gi|326656667|gb|EGE41513.1| 50S ribosomal protein L28 [Streptomyces cf. griseus XylebKG-1]
          Length = 61

 Score = 69.7 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 14/57 (24%), Positives = 30/57 (52%), Gaps = 2/57 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALR 57
          M+  C++  K    GN +SH++ +T RR+ PN+ R+  +     +  +L +    ++
Sbjct: 1  MAANCDVCGKGPSFGNSISHSHRRTSRRWNPNIQRVRAVVGRTPK--RLNVCTSCIK 55


>gi|77918893|ref|YP_356708.1| 50S ribosomal protein L28 [Pelobacter carbinolicus DSM 2380]
 gi|123574379|sp|Q3A519|RL28_PELCD RecName: Full=50S ribosomal protein L28
 gi|77544976|gb|ABA88538.1| LSU ribosomal protein L28P [Pelobacter carbinolicus DSM 2380]
          Length = 63

 Score = 69.7 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 22/58 (37%), Positives = 35/58 (60%), Gaps = 2/58 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS 58
          MSRVC++  K   +GN VSHA+NKTR+ + PNL ++  +     +   +++    LRS
Sbjct: 1  MSRVCDICGKKPTTGNNVSHAHNKTRKVWYPNLQKVRALHK--GKVQAIKVCTRCLRS 56


>gi|118580811|ref|YP_902061.1| 50S ribosomal protein L28 [Pelobacter propionicus DSM 2379]
 gi|166226596|sp|A1ARN3|RL28_PELPD RecName: Full=50S ribosomal protein L28
 gi|118503521|gb|ABL00004.1| LSU ribosomal protein L28P [Pelobacter propionicus DSM 2379]
          Length = 63

 Score = 69.7 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 22/58 (37%), Positives = 31/58 (53%), Gaps = 2/58 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS 58
          MSR+C +  K    GN VSHANNKTR  + PNL +I  +         +++    +RS
Sbjct: 1  MSRICAICGKGPSFGNNVSHANNKTRTVWYPNLQKIKAV--RNGSVKTIKVCTRCIRS 56


>gi|302823364|ref|XP_002993335.1| hypothetical protein SELMODRAFT_136927 [Selaginella
          moellendorffii]
 gi|300138844|gb|EFJ05597.1| hypothetical protein SELMODRAFT_136927 [Selaginella
          moellendorffii]
          Length = 77

 Score = 69.7 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 21/61 (34%), Positives = 39/61 (63%)

Query: 3  RVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQ 62
          RVCELT K   +  K+S+++ +TR++  PNL    L  +  ++  +LRI   AL++++++
Sbjct: 1  RVCELTGKKYNNARKISYSHIRTRKKQQPNLQYKRLWWEAGQRFVRLRICTQALKTIDKK 60

Query: 63 G 63
          G
Sbjct: 61 G 61


>gi|325290437|ref|YP_004266618.1| LSU ribosomal protein L28P [Syntrophobotulus glycolicus DSM 8271]
 gi|324965838|gb|ADY56617.1| LSU ribosomal protein L28P [Syntrophobotulus glycolicus DSM 8271]
          Length = 63

 Score = 69.7 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 22/58 (37%), Positives = 33/58 (56%), Gaps = 2/58 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS 58
          MS VC +  K V +G KVSH++ +T+R + PNL R+  + +       LR+    LRS
Sbjct: 1  MSNVCAICGKGVSTGMKVSHSHIRTKRTWKPNLQRVRAVVNGTPTH--LRVCTRCLRS 56


>gi|256832899|ref|YP_003161626.1| 50S ribosomal protein L28 [Jonesia denitrificans DSM 20603]
 gi|256686430|gb|ACV09323.1| ribosomal protein L28 [Jonesia denitrificans DSM 20603]
          Length = 63

 Score = 69.7 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 15/57 (26%), Positives = 32/57 (56%), Gaps = 2/57 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALR 57
          M+ +C++  K    G+ +SH++ +T+RR+ PN+ R+  I +      +L +    L+
Sbjct: 1  MAAICDVCAKGPSFGHSISHSHVRTKRRWNPNIQRVRAIVN--GAPKRLNVCTSCLK 55


>gi|134102560|ref|YP_001108221.1| 50S ribosomal protein L28 [Saccharopolyspora erythraea NRRL 2338]
 gi|291007069|ref|ZP_06565042.1| 50S ribosomal protein L28 [Saccharopolyspora erythraea NRRL 2338]
 gi|133915183|emb|CAM05296.1| 50S ribosomal protein L28 [Saccharopolyspora erythraea NRRL 2338]
          Length = 63

 Score = 69.7 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 18/57 (31%), Positives = 32/57 (56%), Gaps = 1/57 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALR 57
          M+ VC++  K    GN VSH++ KTRRR+ PN+  +      + Q+ ++ +    L+
Sbjct: 1  MAAVCDVCSKGPGFGNSVSHSHRKTRRRWNPNIQTVHAKI-GLSQRKRMNVCTSCLK 56


>gi|319779276|ref|YP_004130189.1| LSU ribosomal protein L28p [Taylorella equigenitalis MCE9]
 gi|317109300|gb|ADU92046.1| LSU ribosomal protein L28p [Taylorella equigenitalis MCE9]
          Length = 61

 Score = 69.7 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 25/60 (41%), Positives = 39/60 (65%), Gaps = 1/60 (1%)

Query: 19 SHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFLSNSKKENLS 78
          SHA+NKT+RRFLPNL       +   +  +LRIS  ALR+++++G +D  L++ +K   S
Sbjct: 2  SHAHNKTKRRFLPNLQTHRFWVESENRWVRLRISSAALRTIDKKG-IDAVLADMRKNGQS 60


>gi|51598608|ref|YP_072796.1| 50S ribosomal protein L28 [Borrelia garinii PBi]
 gi|67461376|sp|Q661R7|RL28_BORGA RecName: Full=50S ribosomal protein L28
 gi|51573179|gb|AAU07204.1| ribosomal protein L28 [Borrelia garinii PBi]
          Length = 92

 Score = 69.7 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 27/85 (31%), Positives = 38/85 (44%), Gaps = 14/85 (16%)

Query: 1  MSRVCELTKKTVMSGNKVS-------------HANNKTRRRFLPNLCRITLISDIMEQKY 47
          M+R CE+T K  M GN V              H   KT+R F  NL         + +  
Sbjct: 1  MARKCEITGKKTMFGNNVPRKGLAKKKGGAGQHIGVKTKRTFKVNLINKKFFIPELGRSI 60

Query: 48 QLRISKCALRSVERQGGLDRFLSNS 72
           +++S  ALRS+ + G LD FL  +
Sbjct: 61 NIKVSANALRSISKVG-LDAFLKKN 84


>gi|78779282|ref|YP_397394.1| 50S ribosomal protein L28 [Prochlorococcus marinus str. MIT 9312]
 gi|123554241|sp|Q31AY7|RL28_PROM9 RecName: Full=50S ribosomal protein L28
 gi|78712781|gb|ABB49958.1| LSU ribosomal protein L28P [Prochlorococcus marinus str. MIT
          9312]
          Length = 78

 Score = 69.7 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 26/72 (36%), Positives = 44/72 (61%), Gaps = 1/72 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVCELT     +G  VSH++ +T++    NL +  L  +  ++   ++IS  AL+SV+
Sbjct: 1  MSRVCELTGAKANNGMAVSHSHIRTKKLQQVNLQKRRLWWEEGKKWVNIKISTKALKSVQ 60

Query: 61 RQGGLDRFLSNS 72
          + G LD+F  ++
Sbjct: 61 KVG-LDKFAKSN 71


>gi|294815342|ref|ZP_06773985.1| LSU ribosomal protein L28P [Streptomyces clavuligerus ATCC 27064]
 gi|294327941|gb|EFG09584.1| LSU ribosomal protein L28P [Streptomyces clavuligerus ATCC 27064]
          Length = 65

 Score = 69.7 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 13/56 (23%), Positives = 29/56 (51%), Gaps = 2/56 (3%)

Query: 2  SRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALR 57
          +  C++  K    GN +SH++ +T RR+ PN+ R+  +     +  +L +    ++
Sbjct: 6  AANCDVCGKGPGFGNNISHSHRRTSRRWNPNIQRVRAVVGRTPK--RLNVCTSCIK 59


>gi|257054975|ref|YP_003132807.1| 50S ribosomal protein L28P [Saccharomonospora viridis DSM 43017]
 gi|256584847|gb|ACU95980.1| LSU ribosomal protein L28P [Saccharomonospora viridis DSM 43017]
          Length = 66

 Score = 69.7 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 15/56 (26%), Positives = 29/56 (51%), Gaps = 1/56 (1%)

Query: 2  SRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALR 57
          + VC++  K    G  VSH++ +T RR+ PN+  +      + QK +L +    ++
Sbjct: 5  AAVCDVCGKGPGFGKSVSHSHRRTNRRWNPNIQTVHARV-GLSQKKRLNVCTSCIK 59


>gi|212712580|ref|ZP_03320708.1| hypothetical protein PROVALCAL_03675 [Providencia alcalifaciens
          DSM 30120]
 gi|282600470|ref|ZP_05974416.2| ribosomal protein L28 [Providencia rustigianii DSM 4541]
 gi|212684796|gb|EEB44324.1| hypothetical protein PROVALCAL_03675 [Providencia alcalifaciens
          DSM 30120]
 gi|282565171|gb|EFB70706.1| ribosomal protein L28 [Providencia rustigianii DSM 4541]
          Length = 66

 Score = 69.7 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 23/63 (36%), Positives = 36/63 (57%), Gaps = 1/63 (1%)

Query: 13 MSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFLSNS 72
          MSGN  SHA N T+RRFLPNL       +  ++   LR+S   +R ++++G +D  L+  
Sbjct: 1  MSGNNRSHALNATKRRFLPNLHSHRFWVESEKRFVTLRVSAKGMRVIDKKG-IDAVLAEL 59

Query: 73 KKE 75
          +  
Sbjct: 60 RTR 62


>gi|290957129|ref|YP_003488311.1| 50S ribosomal protein L28 [Streptomyces scabiei 87.22]
 gi|260646655|emb|CBG69752.1| putative 50S ribosomal protein L28 [Streptomyces scabiei 87.22]
          Length = 61

 Score = 69.7 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 13/57 (22%), Positives = 29/57 (50%), Gaps = 2/57 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALR 57
          M+  C++  K    GN +SH++ +T RR+ PN+ R+  +     +  ++      ++
Sbjct: 1  MAANCDVCGKGPSFGNNISHSHRRTSRRWNPNIQRVRTVVGGTPK--RVNACTSCIK 55


>gi|283782815|ref|YP_003373569.1| ribosomal protein L28 [Gardnerella vaginalis 409-05]
 gi|283441728|gb|ADB14194.1| ribosomal protein L28 [Gardnerella vaginalis 409-05]
          Length = 64

 Score = 69.7 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 15/57 (26%), Positives = 28/57 (49%), Gaps = 2/57 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALR 57
          M+  C +  K   +G  VSH++ + +R F PNL  +    D   +  +LR+    ++
Sbjct: 1  MAARCAVCGKGPQTGFTVSHSHIRNKRTFRPNLQPVRTTID--GENVRLRVCVKCIK 55


>gi|84498314|ref|ZP_00997111.1| 50S ribosomal protein L28 [Janibacter sp. HTCC2649]
 gi|84381814|gb|EAP97697.1| 50S ribosomal protein L28 [Janibacter sp. HTCC2649]
          Length = 64

 Score = 69.3 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 14/58 (24%), Positives = 30/58 (51%), Gaps = 1/58 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIME-QKYQLRISKCALR 57
          M+  C++  K    G+ +SH++ +T+RR+ PN+ R+  +         +L +    L+
Sbjct: 1  MAANCDVCGKGPGFGHSISHSHRRTKRRWNPNIQRVKALVGDKGVTPKRLNVCTSCLK 58


>gi|256379972|ref|YP_003103632.1| ribosomal protein L28 [Actinosynnema mirum DSM 43827]
 gi|255924275|gb|ACU39786.1| ribosomal protein L28 [Actinosynnema mirum DSM 43827]
          Length = 63

 Score = 69.3 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 15/57 (26%), Positives = 30/57 (52%), Gaps = 1/57 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALR 57
          M+ VC++  K    G  VSH++ +T RR+ PN+  +       +++ +L +    L+
Sbjct: 1  MAAVCDVCGKGPGFGKSVSHSHRRTNRRWNPNIQTVRAKVSSSQRQ-RLNVCTSCLK 56


>gi|221059319|ref|XP_002260305.1| hypothetical protein, conserved in Apicomplexan species [Plasmodium
           knowlesi strain H]
 gi|193810378|emb|CAQ41572.1| hypothetical protein, conserved in Apicomplexan species [Plasmodium
           knowlesi strain H]
          Length = 281

 Score = 69.3 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 20/74 (27%), Positives = 41/74 (55%), Gaps = 2/74 (2%)

Query: 17  KVSHANNKTRRRFLPNLCRITLISDIMEQKY-QLRISKCALRSVERQGGLDRFLSNSKKE 75
           KVS++  KTR +  PN+ +  ++S+I+      ++++  AL +++  GG D ++  +  E
Sbjct: 60  KVSYSLKKTRIKLKPNVFKKHIVSNILNTIIPNVKVTTSALHAMDDAGGFDNYILRTPPE 119

Query: 76  NL-SARMRTLRSQI 88
            L S     L+S +
Sbjct: 120 ELRSNYGEKLKSVM 133


>gi|297183384|gb|ADI19518.1| hypothetical protein [uncultured Chloroflexi bacterium
          HF0770_09E03]
          Length = 63

 Score = 69.3 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 26/58 (44%), Positives = 37/58 (63%), Gaps = 2/58 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS 58
          M+RVCE+  K  ++GN VSHA+NK+RRR+ PNL R+    D      ++R+    LRS
Sbjct: 1  MARVCEMCGKKPVAGNSVSHAHNKSRRRWNPNLQRVKANID--GSIKRVRVCTKCLRS 56


>gi|291166054|gb|EFE28100.1| 50S ribosomal protein L28 [Filifactor alocis ATCC 35896]
          Length = 62

 Score = 69.3 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 20/58 (34%), Positives = 32/58 (55%), Gaps = 2/58 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS 58
          M+RVC++  K  MSGN VSH+N   +R + PNL  +  + +   +    ++    LRS
Sbjct: 1  MARVCDVCGKGKMSGNAVSHSNRHNKRTWAPNLRTVHAVVNGTPKTI--KVCTRCLRS 56


>gi|32307506|gb|AAP79158.1| ribosomal protein rpL28 [Bigelowiella natans]
          Length = 241

 Score = 69.3 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 17/93 (18%), Positives = 45/93 (48%), Gaps = 10/93 (10%)

Query: 3   RVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQ 62
           R C LT K+  +  K   ++ +  +R  PN+ +  +     ++  ++++S  AL+S++++
Sbjct: 65  RRCGLTGKSGTTAYKYCFSHKRATKRQHPNIQQKYVFWPEGQRMVKIKLSTSALKSIDKK 124

Query: 63  G--------GLDRFLSNSKKENLSARMRTLRSQ 87
           G        G+D  L+    +++    +  + +
Sbjct: 125 GLQVMAKEAGID--LNKLPFKDMRPERQEYKEK 155


>gi|219685441|ref|ZP_03540259.1| ribosomal protein L28 [Borrelia garinii Far04]
 gi|219672997|gb|EED30018.1| ribosomal protein L28 [Borrelia garinii Far04]
          Length = 92

 Score = 69.3 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 27/85 (31%), Positives = 39/85 (45%), Gaps = 14/85 (16%)

Query: 1  MSRVCELTKKTVMSGNKVS-------------HANNKTRRRFLPNLCRITLISDIMEQKY 47
          M+R CE+T K  M GN V              H   KT+R F  NL         + +  
Sbjct: 1  MARKCEITGKKTMFGNNVPRKGLAKKKGGAGQHIGVKTKRTFKVNLINKKFFIPDLGRSI 60

Query: 48 QLRISKCALRSVERQGGLDRFLSNS 72
          ++++S  ALRS+ + G LD FL  +
Sbjct: 61 KIKVSANALRSISKIG-LDAFLKKN 84


>gi|312140468|ref|YP_004007804.1| 50S ribosomal protein l28 rpmb [Rhodococcus equi 103S]
 gi|325675913|ref|ZP_08155597.1| 50S ribosomal protein L28 [Rhodococcus equi ATCC 33707]
 gi|311889807|emb|CBH49124.1| 50S ribosomal protein L28 RpmB [Rhodococcus equi 103S]
 gi|325553884|gb|EGD23562.1| 50S ribosomal protein L28 [Rhodococcus equi ATCC 33707]
          Length = 63

 Score = 69.3 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 15/57 (26%), Positives = 27/57 (47%), Gaps = 1/57 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALR 57
          M+ VC++  K    G  VSH++ +T RR+ PN+  +           +L +    L+
Sbjct: 1  MAAVCDVCAKGPGFGKSVSHSHRRTNRRWNPNIQPVRAQV-APGNTKKLNVCTSCLK 56


>gi|269127645|ref|YP_003301015.1| 50S ribosomal protein L28 [Thermomonospora curvata DSM 43183]
 gi|268312603|gb|ACY98977.1| ribosomal protein L28 [Thermomonospora curvata DSM 43183]
          Length = 64

 Score = 69.3 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 14/57 (24%), Positives = 30/57 (52%), Gaps = 2/57 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALR 57
          M+ VC++  K    G +VSH++ +T RR+ PN+ R+  + +      ++      ++
Sbjct: 1  MASVCDVCGKGPGFGMRVSHSHRRTSRRWNPNIQRVRAVVN--GATKRINACTSCIK 55


>gi|297242907|ref|ZP_06926845.1| ribosomal protein L28 [Gardnerella vaginalis AMD]
 gi|308235870|ref|ZP_07666607.1| 50S ribosomal protein L28 [Gardnerella vaginalis ATCC 14018]
 gi|311115034|ref|YP_003986255.1| 50S ribosomal protein L28 [Gardnerella vaginalis ATCC 14019]
 gi|296889118|gb|EFH27852.1| ribosomal protein L28 [Gardnerella vaginalis AMD]
 gi|310946528|gb|ADP39232.1| 50S ribosomal protein L28 [Gardnerella vaginalis ATCC 14019]
          Length = 64

 Score = 69.3 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 15/57 (26%), Positives = 28/57 (49%), Gaps = 2/57 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALR 57
          M+  C +  K   +G  VSH++ + +R F PNL  +    D   +  +LR+    ++
Sbjct: 1  MAARCAVCGKGPQTGFSVSHSHIRNKRTFRPNLQPVRTTID--GENVRLRVCVKCIK 55


>gi|119025221|ref|YP_909066.1| 50S ribosomal protein L28 [Bifidobacterium adolescentis ATCC
          15703]
 gi|154486602|ref|ZP_02028009.1| hypothetical protein BIFADO_00419 [Bifidobacterium adolescentis
          L2-32]
 gi|166226546|sp|A0ZZV1|RL28_BIFAA RecName: Full=50S ribosomal protein L28
 gi|118764805|dbj|BAF38984.1| 50S ribosomal protein L28 [Bifidobacterium adolescentis ATCC
          15703]
 gi|154084465|gb|EDN83510.1| hypothetical protein BIFADO_00419 [Bifidobacterium adolescentis
          L2-32]
          Length = 64

 Score = 69.3 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 14/57 (24%), Positives = 28/57 (49%), Gaps = 2/57 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALR 57
          M+  C +  K   +G  VSH++ + +R F PNL  +    D   +  ++R+    ++
Sbjct: 1  MAARCAVCGKGPQTGFTVSHSHIRNKRTFRPNLQPVRTTID--GENVRVRVCVKCIK 55


>gi|239991051|ref|ZP_04711715.1| 50S ribosomal protein L28 [Streptomyces roseosporus NRRL 11379]
 gi|291448052|ref|ZP_06587442.1| 50S ribosomal protein L28 [Streptomyces roseosporus NRRL 15998]
 gi|291350999|gb|EFE77903.1| 50S ribosomal protein L28 [Streptomyces roseosporus NRRL 15998]
          Length = 61

 Score = 68.9 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 14/57 (24%), Positives = 29/57 (50%), Gaps = 2/57 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALR 57
          M+  C++  K    GN VS ++ +T RR+ PN+ R+  +     +  +L +    ++
Sbjct: 1  MAANCDVCGKGPSFGNSVSFSHRRTSRRWNPNIQRVRAVVGRTPK--RLNVCTSCIK 55


>gi|163845857|ref|YP_001633901.1| 50S ribosomal protein L28 [Chloroflexus aurantiacus J-10-fl]
 gi|222523569|ref|YP_002568039.1| 50S ribosomal protein L28 [Chloroflexus sp. Y-400-fl]
 gi|163667146|gb|ABY33512.1| ribosomal protein L28 [Chloroflexus aurantiacus J-10-fl]
 gi|222447448|gb|ACM51714.1| ribosomal protein L28 [Chloroflexus sp. Y-400-fl]
          Length = 61

 Score = 68.9 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 19/61 (31%), Positives = 31/61 (50%), Gaps = 2/61 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+  CEL  K    G+ VS +  +T R + PN+ + TL      Q  Q+RI    +R++ 
Sbjct: 1  MA-TCELCGKKPSFGHNVSFSKRRTNRIWRPNIQKTTLTVPG-GQSVQVRICTRCMRTLA 58

Query: 61 R 61
          +
Sbjct: 59 K 59


>gi|197119577|ref|YP_002140004.1| 50S ribosomal protein L28 [Geobacter bemidjiensis Bem]
 gi|253699684|ref|YP_003020873.1| 50S ribosomal protein L28 [Geobacter sp. M21]
 gi|322420741|ref|YP_004199964.1| 50S ribosomal protein L28 [Geobacter sp. M18]
 gi|226694924|sp|B5E9N4|RL28_GEOBB RecName: Full=50S ribosomal protein L28
 gi|259646739|sp|C6E2G9|RL28_GEOSM RecName: Full=50S ribosomal protein L28
 gi|197088937|gb|ACH40208.1| ribosomal protein L28 [Geobacter bemidjiensis Bem]
 gi|251774534|gb|ACT17115.1| ribosomal protein L28 [Geobacter sp. M21]
 gi|320127128|gb|ADW14688.1| ribosomal protein L28 [Geobacter sp. M18]
          Length = 63

 Score = 68.9 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 22/58 (37%), Positives = 33/58 (56%), Gaps = 2/58 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS 58
          MSR+CE+  K    GN VSHANNKT + + PNL +I  + +   +    ++    +RS
Sbjct: 1  MSRICEICGKGPSFGNNVSHANNKTSKIWRPNLQKIKAVKNGTVRSI--KVCTRCIRS 56


>gi|255075129|ref|XP_002501239.1| predicted protein [Micromonas sp. RCC299]
 gi|226516503|gb|ACO62497.1| predicted protein [Micromonas sp. RCC299]
          Length = 208

 Score = 68.9 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 17/61 (27%), Positives = 31/61 (50%)

Query: 3   RVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQ 62
           R C LT K   +G  VS ++ + ++    NL    +     ++  +LRIS  A++S+ + 
Sbjct: 66  RKCMLTGKKANNGWTVSFSHIRNKKLQGVNLQYKRVYWPEKQRYVRLRISTSAMKSINKI 125

Query: 63  G 63
           G
Sbjct: 126 G 126


>gi|269792516|ref|YP_003317420.1| 50S ribosomal protein L28 [Thermanaerovibrio acidaminovorans DSM
          6589]
 gi|269100151|gb|ACZ19138.1| ribosomal protein L28 [Thermanaerovibrio acidaminovorans DSM
          6589]
          Length = 64

 Score = 68.9 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 22/58 (37%), Positives = 33/58 (56%), Gaps = 1/58 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS 58
          MSRVC+   +   +GN VSH+N  TRRR+L NL  + +      +  +L++    LRS
Sbjct: 1  MSRVCDCCGRGPQTGNAVSHSNRHTRRRWLINLRSVRVDLGC-GETRKLKVCTKCLRS 57


>gi|113477546|ref|YP_723607.1| 50S ribosomal protein L28 [Trichodesmium erythraeum IMS101]
 gi|122964496|sp|Q10X90|RL28_TRIEI RecName: Full=50S ribosomal protein L28
 gi|110168594|gb|ABG53134.1| LSU ribosomal protein L28P [Trichodesmium erythraeum IMS101]
          Length = 78

 Score = 68.9 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 18/63 (28%), Positives = 36/63 (57%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR C+LT K   +G  VSH++ +T +    NL    +     ++  +L++S  A+++++
Sbjct: 1  MSRKCQLTGKKANNGYSVSHSHIRTHKLQHANLQWKKVWWPQGKKWVKLKLSTKAIKTLQ 60

Query: 61 RQG 63
           +G
Sbjct: 61 SKG 63


>gi|227883805|ref|ZP_04001610.1| ribosomal protein L28 [Escherichia coli 83972]
 gi|300815124|ref|ZP_07095349.1| ribosomal protein L28 [Escherichia coli MS 107-1]
 gi|300822407|ref|ZP_07102547.1| ribosomal protein L28 [Escherichia coli MS 119-7]
 gi|300898571|ref|ZP_07116902.1| ribosomal protein L28 [Escherichia coli MS 198-1]
 gi|300907678|ref|ZP_07125306.1| ribosomal protein L28 [Escherichia coli MS 84-1]
 gi|300919796|ref|ZP_07136271.1| ribosomal protein L28 [Escherichia coli MS 115-1]
 gi|300923421|ref|ZP_07139462.1| ribosomal protein L28 [Escherichia coli MS 182-1]
 gi|300927933|ref|ZP_07143492.1| ribosomal protein L28 [Escherichia coli MS 187-1]
 gi|300948029|ref|ZP_07162170.1| ribosomal protein L28 [Escherichia coli MS 116-1]
 gi|300954469|ref|ZP_07166919.1| ribosomal protein L28 [Escherichia coli MS 175-1]
 gi|300983483|ref|ZP_07176630.1| ribosomal protein L28 [Escherichia coli MS 200-1]
 gi|300984963|ref|ZP_07177215.1| ribosomal protein L28 [Escherichia coli MS 45-1]
 gi|301018966|ref|ZP_07183189.1| ribosomal protein L28 [Escherichia coli MS 69-1]
 gi|301028396|ref|ZP_07191642.1| ribosomal protein L28 [Escherichia coli MS 196-1]
 gi|301047426|ref|ZP_07194506.1| ribosomal protein L28 [Escherichia coli MS 185-1]
 gi|301303870|ref|ZP_07209989.1| ribosomal protein L28 [Escherichia coli MS 124-1]
 gi|301325319|ref|ZP_07218826.1| ribosomal protein L28 [Escherichia coli MS 78-1]
 gi|301644303|ref|ZP_07244305.1| ribosomal protein L28 [Escherichia coli MS 146-1]
 gi|309784386|ref|ZP_07679025.1| ribosomal protein L28 [Shigella dysenteriae 1617]
 gi|309797622|ref|ZP_07692010.1| ribosomal protein L28 [Escherichia coli MS 145-7]
 gi|312968022|ref|ZP_07782233.1| ribosomal protein L28 [Escherichia coli 2362-75]
 gi|312972078|ref|ZP_07786252.1| ribosomal protein L28 [Escherichia coli 1827-70]
 gi|329996934|ref|ZP_08302631.1| ribosomal protein L28 [Klebsiella sp. MS 92-3]
 gi|227839083|gb|EEJ49549.1| ribosomal protein L28 [Escherichia coli 83972]
 gi|299878507|gb|EFI86718.1| ribosomal protein L28 [Escherichia coli MS 196-1]
 gi|300300700|gb|EFJ57085.1| ribosomal protein L28 [Escherichia coli MS 185-1]
 gi|300306947|gb|EFJ61467.1| ribosomal protein L28 [Escherichia coli MS 200-1]
 gi|300318548|gb|EFJ68332.1| ribosomal protein L28 [Escherichia coli MS 175-1]
 gi|300357757|gb|EFJ73627.1| ribosomal protein L28 [Escherichia coli MS 198-1]
 gi|300399460|gb|EFJ82998.1| ribosomal protein L28 [Escherichia coli MS 69-1]
 gi|300400614|gb|EFJ84152.1| ribosomal protein L28 [Escherichia coli MS 84-1]
 gi|300408243|gb|EFJ91781.1| ribosomal protein L28 [Escherichia coli MS 45-1]
 gi|300413149|gb|EFJ96459.1| ribosomal protein L28 [Escherichia coli MS 115-1]
 gi|300420331|gb|EFK03642.1| ribosomal protein L28 [Escherichia coli MS 182-1]
 gi|300452424|gb|EFK16044.1| ribosomal protein L28 [Escherichia coli MS 116-1]
 gi|300464025|gb|EFK27518.1| ribosomal protein L28 [Escherichia coli MS 187-1]
 gi|300525054|gb|EFK46123.1| ribosomal protein L28 [Escherichia coli MS 119-7]
 gi|300532016|gb|EFK53078.1| ribosomal protein L28 [Escherichia coli MS 107-1]
 gi|300840833|gb|EFK68593.1| ribosomal protein L28 [Escherichia coli MS 124-1]
 gi|300847846|gb|EFK75606.1| ribosomal protein L28 [Escherichia coli MS 78-1]
 gi|301077341|gb|EFK92147.1| ribosomal protein L28 [Escherichia coli MS 146-1]
 gi|308118809|gb|EFO56071.1| ribosomal protein L28 [Escherichia coli MS 145-7]
 gi|308927893|gb|EFP73361.1| ribosomal protein L28 [Shigella dysenteriae 1617]
 gi|310334455|gb|EFQ00660.1| ribosomal protein L28 [Escherichia coli 1827-70]
 gi|312287281|gb|EFR15190.1| ribosomal protein L28 [Escherichia coli 2362-75]
 gi|315254023|gb|EFU33991.1| ribosomal protein L28 [Escherichia coli MS 85-1]
 gi|315285376|gb|EFU44821.1| ribosomal protein L28 [Escherichia coli MS 110-3]
 gi|315292974|gb|EFU52326.1| ribosomal protein L28 [Escherichia coli MS 153-1]
 gi|315297032|gb|EFU56312.1| ribosomal protein L28 [Escherichia coli MS 16-3]
 gi|320176304|gb|EFW51364.1| LSU ribosomal protein L28p [Shigella dysenteriae CDC 74-1112]
 gi|320179973|gb|EFW54915.1| LSU ribosomal protein L28p [Shigella boydii ATCC 9905]
 gi|320191312|gb|EFW65962.1| LSU ribosomal protein L28p [Escherichia coli O157:H7 str. EC1212]
 gi|320193856|gb|EFW68489.1| LSU ribosomal protein L28p [Escherichia coli WV_060327]
 gi|320201338|gb|EFW75919.1| LSU ribosomal protein L28p [Escherichia coli EC4100B]
 gi|320639544|gb|EFX09152.1| 50S ribosomal protein L28 [Escherichia coli O157:H7 str. G5101]
 gi|323155288|gb|EFZ41471.1| ribosomal protein L28 [Escherichia coli EPECa14]
 gi|323160755|gb|EFZ46691.1| ribosomal protein L28 [Escherichia coli E128010]
 gi|323166880|gb|EFZ52619.1| ribosomal protein L28 [Shigella sonnei 53G]
 gi|323179393|gb|EFZ64960.1| ribosomal protein L28 [Escherichia coli 1180]
 gi|323182665|gb|EFZ68068.1| ribosomal protein L28 [Escherichia coli 1357]
 gi|323189455|gb|EFZ74736.1| ribosomal protein L28 [Escherichia coli RN587/1]
 gi|324008142|gb|EGB77361.1| ribosomal protein L28 [Escherichia coli MS 57-2]
 gi|324012729|gb|EGB81948.1| ribosomal protein L28 [Escherichia coli MS 60-1]
 gi|324019746|gb|EGB88965.1| ribosomal protein L28 [Escherichia coli MS 117-3]
 gi|325499443|gb|EGC97302.1| 50S ribosomal protein L28 [Escherichia fergusonii ECD227]
 gi|326337364|gb|EGD61199.1| LSU ribosomal protein L28p [Escherichia coli O157:H7 str. 1044]
 gi|326339889|gb|EGD63696.1| LSU ribosomal protein L28p [Escherichia coli O157:H7 str. 1125]
 gi|327250763|gb|EGE62465.1| ribosomal protein L28 [Escherichia coli STEC_7v]
 gi|328539224|gb|EGF65253.1| ribosomal protein L28 [Klebsiella sp. MS 92-3]
 gi|330909699|gb|EGH38213.1| LSU ribosomal protein L28p [Escherichia coli AA86]
 gi|332084817|gb|EGI90000.1| ribosomal protein L28 [Shigella boydii 5216-82]
 gi|332345605|gb|AEE58939.1| ribosomal protein RpmB [Escherichia coli UMNK88]
 gi|332751259|gb|EGJ81662.1| ribosomal protein L28 [Shigella flexneri 2747-71]
 gi|332764161|gb|EGJ94398.1| ribosomal protein L28 [Shigella flexneri 2930-71]
 gi|332996138|gb|EGK15765.1| ribosomal protein L28 [Shigella flexneri VA-6]
 gi|332997030|gb|EGK16646.1| ribosomal protein L28 [Shigella flexneri K-218]
 gi|332997784|gb|EGK17395.1| ribosomal protein L28 [Shigella flexneri K-272]
 gi|333012844|gb|EGK32221.1| ribosomal protein L28 [Shigella flexneri K-304]
 gi|333013318|gb|EGK32690.1| ribosomal protein L28 [Shigella flexneri K-227]
          Length = 66

 Score = 68.9 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 22/63 (34%), Positives = 36/63 (57%), Gaps = 1/63 (1%)

Query: 13 MSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFLSNS 72
          M+GN  SHA N T+RRFLPNL       +  ++   LR+S   +R ++++G +D  L+  
Sbjct: 1  MTGNNRSHALNATKRRFLPNLHSHRFWVESEKRFVTLRVSAKGMRVIDKKG-IDTVLAEL 59

Query: 73 KKE 75
          +  
Sbjct: 60 RAR 62


>gi|216264106|ref|ZP_03436100.1| ribosomal protein L28 [Borrelia afzelii ACA-1]
 gi|219684562|ref|ZP_03539505.1| ribosomal protein L28 [Borrelia garinii PBr]
 gi|215980150|gb|EEC20972.1| ribosomal protein L28 [Borrelia afzelii ACA-1]
 gi|219671924|gb|EED28978.1| ribosomal protein L28 [Borrelia garinii PBr]
          Length = 92

 Score = 68.9 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 27/85 (31%), Positives = 38/85 (44%), Gaps = 14/85 (16%)

Query: 1  MSRVCELTKKTVMSGNKVS-------------HANNKTRRRFLPNLCRITLISDIMEQKY 47
          M+R CE+T K  M GN V              H   KT+R F  NL         + +  
Sbjct: 1  MARKCEITGKKTMFGNNVPRKGLAKKKGGAGQHIGVKTKRTFKVNLINKKFFIPDLGRSI 60

Query: 48 QLRISKCALRSVERQGGLDRFLSNS 72
           +++S  ALRS+ + G LD FL  +
Sbjct: 61 NIKVSANALRSISKIG-LDAFLKKN 84


>gi|218780246|ref|YP_002431564.1| 50S ribosomal protein L28 [Desulfatibacillum alkenivorans AK-01]
 gi|226738066|sp|B8FB10|RL28_DESAA RecName: Full=50S ribosomal protein L28
 gi|218761630|gb|ACL04096.1| ribosomal protein L28 [Desulfatibacillum alkenivorans AK-01]
          Length = 63

 Score = 68.9 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 22/58 (37%), Positives = 33/58 (56%), Gaps = 1/58 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS 58
          MSR+CE+  K  M GN VSHA+N  +RRF PNL ++        Q  ++ +    ++S
Sbjct: 1  MSRMCEICGKKPMVGNNVSHAHNVNKRRFNPNLQKVR-SLQENGQVKKITVCTNCIKS 57


>gi|29831185|ref|NP_825819.1| 50S ribosomal protein L28 [Streptomyces avermitilis MA-4680]
 gi|29608299|dbj|BAC72354.1| putative ribosomal protein L28 [Streptomyces avermitilis MA-4680]
          Length = 73

 Score = 68.9 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 17/58 (29%), Positives = 30/58 (51%)

Query: 6  ELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQG 63
           LT      GN++SH++ +T RRF PN+           +  +LR+S   +++V+  G
Sbjct: 1  MLTGARPGFGNRISHSHRRTSRRFDPNIQSKRYWLASEGRHVRLRLSAKGIKTVDTLG 58


>gi|123968492|ref|YP_001009350.1| 50S ribosomal protein L28 [Prochlorococcus marinus str. AS9601]
 gi|166226602|sp|A2BR32|RL28_PROMS RecName: Full=50S ribosomal protein L28
 gi|123198602|gb|ABM70243.1| 50S ribosomal protein L28 [Prochlorococcus marinus str. AS9601]
          Length = 78

 Score = 68.9 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 24/72 (33%), Positives = 43/72 (59%), Gaps = 1/72 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR CELT     +G  VSH++ +T++    NL +  L  +  ++   ++IS  AL+S++
Sbjct: 1  MSRACELTGAKANNGMAVSHSHIRTKKLQQVNLQKRRLWWEEGKKWVNIKISTKALKSIQ 60

Query: 61 RQGGLDRFLSNS 72
          + G LD+F  ++
Sbjct: 61 KVG-LDKFAKSN 71


>gi|258514449|ref|YP_003190671.1| 50S ribosomal protein L28 [Desulfotomaculum acetoxidans DSM 771]
 gi|257778154|gb|ACV62048.1| ribosomal protein L28 [Desulfotomaculum acetoxidans DSM 771]
          Length = 63

 Score = 68.9 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 20/58 (34%), Positives = 35/58 (60%), Gaps = 2/58 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS 58
          M+R C++  K V++G KVSH++ +T+R + PNL R+  I +      ++ +    LRS
Sbjct: 1  MARKCDICGKGVVTGMKVSHSHIRTKRTWAPNLQRVKAIVN--GSPKRIMVCTRCLRS 56


>gi|225552377|ref|ZP_03773317.1| ribosomal protein L28 [Borrelia sp. SV1]
 gi|225371375|gb|EEH00805.1| ribosomal protein L28 [Borrelia sp. SV1]
          Length = 92

 Score = 68.9 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 28/85 (32%), Positives = 38/85 (44%), Gaps = 14/85 (16%)

Query: 1  MSRVCELTKKTVMSGNKVS-------------HANNKTRRRFLPNLCRITLISDIMEQKY 47
          MSR CE+T K  M GN V              H   KT+R F  NL         + +  
Sbjct: 1  MSRKCEITGKKTMFGNNVPRKGLAKKKGGAGQHIGVKTKRTFKVNLINKKFFIPNLGRSV 60

Query: 48 QLRISKCALRSVERQGGLDRFLSNS 72
           +++S  ALRS+ + G LD FL  +
Sbjct: 61 SIKVSANALRSISKIG-LDAFLKKN 84


>gi|78187460|ref|YP_375503.1| 50S ribosomal protein L28 [Chlorobium luteolum DSM 273]
 gi|123582745|sp|Q3B2H1|RL28_PELLD RecName: Full=50S ribosomal protein L28
 gi|78167362|gb|ABB24460.1| LSU ribosomal protein L28P [Chlorobium luteolum DSM 273]
          Length = 72

 Score = 68.9 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 25/63 (39%), Positives = 37/63 (58%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS+VC LT K    GN VSHANN  R RF PNL    +  D  ++  ++++S  A++ + 
Sbjct: 1  MSKVCVLTGKRPKYGNTVSHANNHRRTRFEPNLHTKRIWIDEEKRWAKVKLSAKAMKIIA 60

Query: 61 RQG 63
          + G
Sbjct: 61 KTG 63


>gi|54026167|ref|YP_120409.1| 50S ribosomal protein L28 [Nocardia farcinica IFM 10152]
 gi|67461562|sp|Q5YRZ6|RL281_NOCFA RecName: Full=50S ribosomal protein L28 1
 gi|54017675|dbj|BAD59045.1| putative ribosomal protein L28 [Nocardia farcinica IFM 10152]
          Length = 63

 Score = 68.5 bits (167), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 14/57 (24%), Positives = 27/57 (47%), Gaps = 1/57 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALR 57
          M+ VC++  K    G  VSH++ +T RR+ PN+  +           ++ +    L+
Sbjct: 1  MAAVCDVCAKGPGFGKSVSHSHRRTNRRWNPNIQTVRAQV-APGNTRRMNVCTSCLK 56


>gi|21223920|ref|NP_629699.1| 50S ribosomal protein L28 [Streptomyces coelicolor A3(2)]
 gi|256784981|ref|ZP_05523412.1| 50S ribosomal protein L28 [Streptomyces lividans TK24]
 gi|289768873|ref|ZP_06528251.1| 50S ribosomal protein L28 [Streptomyces lividans TK24]
 gi|7674178|sp|Q9ZBR5|RL28A_STRCO RecName: Full=50S ribosomal protein L28-1
 gi|4007723|emb|CAA22407.1| putative 50S ribosomal protein L28 [Streptomyces coelicolor
          A3(2)]
 gi|289699072|gb|EFD66501.1| 50S ribosomal protein L28 [Streptomyces lividans TK24]
          Length = 61

 Score = 68.5 bits (167), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 13/57 (22%), Positives = 29/57 (50%), Gaps = 2/57 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALR 57
          M+  C++  K    GN +SH++ +T RR+ PN+ R+  +     +  ++      ++
Sbjct: 1  MAANCDVCGKGPGFGNNISHSHRRTSRRWNPNIQRVRTVVSGTPK--RVNACTSCIK 55


>gi|270006114|gb|EFA02562.1| hypothetical protein TcasGA2_TC008271 [Tribolium castaneum]
          Length = 258

 Score = 68.5 bits (167), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 14/91 (15%), Positives = 44/91 (48%), Gaps = 2/91 (2%)

Query: 6   ELTKKTVMSGNKVS-HANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGG 64
               + ++ G ++      +    ++P+L R  + S+++ +   + +++  +  +    G
Sbjct: 83  MWGGEGIVQGFQIRDWRRRRVPHFWMPHLKRSVVYSEVLNKYISVVVTERTISLINSNYG 142

Query: 65  LDRFLSNSKKENLSARM-RTLRSQILKKMSE 94
            D +L  +   +L A +  TL+ +IL+++ +
Sbjct: 143 FDHYLLKTPACDLKALLPLTLKRKILQELEK 173


>gi|73959217|ref|XP_865461.1| PREDICTED: similar to mitochondrial ribosomal protein L28 isoform 2
           [Canis familiaris]
          Length = 268

 Score = 68.5 bits (167), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 16/104 (15%), Positives = 43/104 (41%), Gaps = 15/104 (14%)

Query: 7   LTKKTVMSGNKV--SHAN-NKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQG 63
              +  + G +    H    + ++ + P L +  L S+I++ K+ + ++   L  ++   
Sbjct: 81  WGGEGWVVGYRYVGDHQLSKRVKKVWKPQLLQRELYSEILDTKFAVTVTARTLDLIDAAY 140

Query: 64  GLDRFLSNS-----------KKENL-SARMRTLRSQILKKMSEK 95
           G D ++  +             E+L S     L+  +L +++ +
Sbjct: 141 GFDFYILKASRGLCGRRAGSPGEDLCSKFGMDLKRGMLLRLARQ 184


>gi|317051922|ref|YP_004113038.1| 50S ribosomal protein L28 [Desulfurispirillum indicum S5]
 gi|316947006|gb|ADU66482.1| ribosomal protein L28 [Desulfurispirillum indicum S5]
          Length = 61

 Score = 68.5 bits (167), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 22/61 (36%), Positives = 36/61 (59%), Gaps = 2/61 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+R CE+  K     N VSHANNKT++R LPNL    L  + + +  +++I    +R++ 
Sbjct: 1  MARRCEICGKQPQVNNNVSHANNKTKKRSLPNLKSQELTVNGLTK--RVKICTSCIRTLN 58

Query: 61 R 61
          +
Sbjct: 59 K 59


>gi|331698534|ref|YP_004334773.1| 50S ribosomal protein L28 [Pseudonocardia dioxanivorans CB1190]
 gi|326953223|gb|AEA26920.1| 50S ribosomal protein L28 [Pseudonocardia dioxanivorans CB1190]
          Length = 63

 Score = 68.5 bits (167), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 16/57 (28%), Positives = 28/57 (49%), Gaps = 1/57 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALR 57
          M+ VC++  K    G  VSH++ +T RR+ PN+  +    D    K +  +    L+
Sbjct: 1  MAAVCDVCGKGPGFGMSVSHSHRRTHRRWNPNIQTVRTR-DAGNNKRRQNVCTSCLK 56


>gi|322797333|gb|EFZ19445.1| hypothetical protein SINV_00972 [Solenopsis invicta]
          Length = 280

 Score = 68.5 bits (167), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 19/95 (20%), Positives = 42/95 (44%), Gaps = 16/95 (16%)

Query: 10  KTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFL 69
           K  +   +V H        ++P L +  + S++++   ++ +++ ALR +    G D +L
Sbjct: 92  KKGIFKRRVPHF-------WIPTLKKSVVYSEVLDTYMRVIVTERALRLIHENYGFDHYL 144

Query: 70  SN--------SKKENL-SARMRTLRSQILKKMSEK 95
                     +   +L S     L+ QIL  +++K
Sbjct: 145 LKLLTDHHLQTPACDLRSLLALRLKRQILIALADK 179


>gi|300939236|ref|ZP_07153916.1| ribosomal protein L28 [Escherichia coli MS 21-1]
 gi|300455878|gb|EFK19371.1| ribosomal protein L28 [Escherichia coli MS 21-1]
          Length = 66

 Score = 68.5 bits (167), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 22/63 (34%), Positives = 35/63 (55%), Gaps = 1/63 (1%)

Query: 13 MSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFLSNS 72
          M+GN  SHA N T+RRFLPNL       +  ++   LR+S   +R ++++G +D  L   
Sbjct: 1  MTGNNRSHALNATKRRFLPNLHSHRFWVESEKRFVTLRVSAKGMRVIDKKG-IDTVLVEL 59

Query: 73 KKE 75
          +  
Sbjct: 60 RAR 62


>gi|172035053|ref|YP_001801554.1| 50S ribosomal protein L28 [Cyanothece sp. ATCC 51142]
 gi|171696507|gb|ACB49488.1| 50S ribosomal protein L28 [Cyanothece sp. ATCC 51142]
          Length = 80

 Score = 68.5 bits (167), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 19/63 (30%), Positives = 36/63 (57%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR C+LT K   +   VSH++ +T++    NL    +      +  +LR+S  A++++E
Sbjct: 3  MSRKCQLTGKKANNAFAVSHSHRRTKKLQEANLQWKRVWWAEGNRWVRLRLSTKAIKTLE 62

Query: 61 RQG 63
          ++G
Sbjct: 63 KKG 65


>gi|326381568|ref|ZP_08203262.1| 50S ribosomal protein L28 [Gordonia neofelifaecis NRRL B-59395]
 gi|326199815|gb|EGD56995.1| 50S ribosomal protein L28 [Gordonia neofelifaecis NRRL B-59395]
          Length = 63

 Score = 68.5 bits (167), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 15/57 (26%), Positives = 29/57 (50%), Gaps = 1/57 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALR 57
          M+ VC++  K    G  VSH++ +T RR+ PN+  + +      +K +  +    L+
Sbjct: 1  MAAVCDVCGKGPGFGKSVSHSHRRTNRRWNPNIQSVRVEVAPGNKK-RQNVCTSCLK 56


>gi|219850478|ref|YP_002464911.1| 50S ribosomal protein L28 [Chloroflexus aggregans DSM 9485]
 gi|219544737|gb|ACL26475.1| ribosomal protein L28 [Chloroflexus aggregans DSM 9485]
          Length = 61

 Score = 68.5 bits (167), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 18/61 (29%), Positives = 34/61 (55%), Gaps = 2/61 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M++ CEL  K    G+ VS +  +T R + PN+ + TL++    +  Q+RI    +R++ 
Sbjct: 1  MAK-CELCGKKPSFGHNVSFSKRRTNRVWQPNIQKTTLMAPG-GKPVQVRICTQCMRTLA 58

Query: 61 R 61
          +
Sbjct: 59 K 59


>gi|15594695|ref|NP_212484.1| 50S ribosomal protein L28 [Borrelia burgdorferi B31]
 gi|218249319|ref|YP_002374870.1| ribosomal protein L28 [Borrelia burgdorferi ZS7]
 gi|221217814|ref|ZP_03589282.1| ribosomal protein L28 [Borrelia burgdorferi 72a]
 gi|223889036|ref|ZP_03623627.1| ribosomal protein L28 [Borrelia burgdorferi 64b]
 gi|224533135|ref|ZP_03673735.1| ribosomal protein L28 [Borrelia burgdorferi WI91-23]
 gi|225549021|ref|ZP_03769996.1| ribosomal protein L28 [Borrelia burgdorferi 94a]
 gi|225550155|ref|ZP_03771115.1| ribosomal protein L28 [Borrelia burgdorferi 118a]
 gi|226320431|ref|ZP_03795998.1| ribosomal protein L28 [Borrelia burgdorferi 29805]
 gi|226321667|ref|ZP_03797193.1| ribosomal protein L28 [Borrelia burgdorferi Bol26]
 gi|3914732|sp|O51325|RL28_BORBU RecName: Full=50S ribosomal protein L28
 gi|226738035|sp|B7J1S5|RL28_BORBZ RecName: Full=50S ribosomal protein L28
 gi|2688254|gb|AAC66732.1| ribosomal protein L28 (rpmB) [Borrelia burgdorferi B31]
 gi|218164507|gb|ACK74568.1| ribosomal protein L28 [Borrelia burgdorferi ZS7]
 gi|221192491|gb|EEE18710.1| ribosomal protein L28 [Borrelia burgdorferi 72a]
 gi|223885852|gb|EEF56951.1| ribosomal protein L28 [Borrelia burgdorferi 64b]
 gi|224511862|gb|EEF82263.1| ribosomal protein L28 [Borrelia burgdorferi WI91-23]
 gi|225369267|gb|EEG98720.1| ribosomal protein L28 [Borrelia burgdorferi 118a]
 gi|225370247|gb|EEG99685.1| ribosomal protein L28 [Borrelia burgdorferi 94a]
 gi|226232856|gb|EEH31609.1| ribosomal protein L28 [Borrelia burgdorferi Bol26]
 gi|226234184|gb|EEH32898.1| ribosomal protein L28 [Borrelia burgdorferi 29805]
 gi|312148522|gb|ADQ31181.1| ribosomal protein L28 [Borrelia burgdorferi JD1]
 gi|312149317|gb|ADQ29388.1| ribosomal protein L28 [Borrelia burgdorferi N40]
          Length = 92

 Score = 68.5 bits (167), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 27/85 (31%), Positives = 38/85 (44%), Gaps = 14/85 (16%)

Query: 1  MSRVCELTKKTVMSGNKVS-------------HANNKTRRRFLPNLCRITLISDIMEQKY 47
          M+R CE+T K  M GN V              H   KT+R F  NL         + +  
Sbjct: 1  MARKCEITGKKTMFGNNVPRKGLAKKKGGAGQHIGVKTKRTFKVNLINKKFFIPNLGRSV 60

Query: 48 QLRISKCALRSVERQGGLDRFLSNS 72
           +++S  ALRS+ + G LD FL  +
Sbjct: 61 SIKVSANALRSISKIG-LDAFLKKN 84


>gi|194766073|ref|XP_001965149.1| GF23657 [Drosophila ananassae]
 gi|190617759|gb|EDV33283.1| GF23657 [Drosophila ananassae]
          Length = 301

 Score = 68.5 bits (167), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 19/93 (20%), Positives = 45/93 (48%), Gaps = 8/93 (8%)

Query: 7   LTKKTVMSGNKVSHANNKTRRR----FLPNLCRITLISDIMEQKYQLRISKCALRSVERQ 62
              + V+ G +      +T+RR    ++PNL R  + S +++    + +++  L  +   
Sbjct: 87  WGGEAVIKGFQ---KRQQTKRRVPHFWVPNLRRSVVHSHVLDAYMSVVVTERTLEQIHEC 143

Query: 63  GGLDRFLSNSKKENL-SARMRTLRSQILKKMSE 94
            G D +L  ++  +L SA    L+ ++L+ + +
Sbjct: 144 HGFDHYLLKNRACDLRSALALKLKREVLQALQK 176


>gi|291278738|ref|YP_003495573.1| 50S ribosomal protein L28 [Deferribacter desulfuricans SSM1]
 gi|290753440|dbj|BAI79817.1| 50S ribosomal protein L28 [Deferribacter desulfuricans SSM1]
          Length = 62

 Score = 68.5 bits (167), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 17/57 (29%), Positives = 33/57 (57%), Gaps = 2/57 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALR 57
          M+R C++  K  M G+ +SHA+N +RR F PN+ ++ +I     +  + ++    L+
Sbjct: 1  MARRCDICGKGPMFGHTISHAHNVSRRVFYPNVHKVRVI--ENGKVVRKKVCTKCLK 55


>gi|256824927|ref|YP_003148887.1| 50S ribosomal protein L28P [Kytococcus sedentarius DSM 20547]
 gi|256688320|gb|ACV06122.1| LSU ribosomal protein L28P [Kytococcus sedentarius DSM 20547]
          Length = 64

 Score = 68.5 bits (167), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 15/58 (25%), Positives = 30/58 (51%), Gaps = 1/58 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLIS-DIMEQKYQLRISKCALR 57
          M+  C++  K    G+ +SH+N +T+RR+ PN+ R+     D +    ++      L+
Sbjct: 1  MAATCDVCGKGPSFGHNISHSNRRTKRRWNPNIQRVRARVGDKLATVKRINACTSCLK 58


>gi|317121765|ref|YP_004101768.1| 50S ribosomal protein L28P [Thermaerobacter marianensis DSM
          12885]
 gi|315591745|gb|ADU51041.1| LSU ribosomal protein L28P [Thermaerobacter marianensis DSM
          12885]
          Length = 65

 Score = 68.5 bits (167), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 21/58 (36%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS 58
          M+R C +  K V  GN+VSH+N K+RR ++PNL R+  ++    +  ++R+    L+S
Sbjct: 3  MARRCAICGKGVDYGNQVSHSNRKSRRIWVPNLQRVRAVTPQGVR--RIRVCTTCLKS 58


>gi|225712272|gb|ACO11982.1| 39S ribosomal protein L28, mitochondrial precursor [Lepeophtheirus
           salmonis]
          Length = 295

 Score = 68.5 bits (167), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 13/94 (13%), Positives = 38/94 (40%), Gaps = 8/94 (8%)

Query: 7   LTKKTVMSGNKVSHANNKTRR-------RFLPNLCRITLISDIMEQKYQLRISKCALRSV 59
              + V+ G                    + P L    + S ++++  ++ +++  L+ V
Sbjct: 95  WGGEGVIKGLNEPEKQRHYPNPRIPQCNYWWPKLHLAVVYSRVLDKYIEMPVTRRGLKLV 154

Query: 60  ERQGGLDRFLSNSKKENL-SARMRTLRSQILKKM 92
           ++  G D +L  +    + +  +  ++ +IL K+
Sbjct: 155 DKAHGFDNYLLRTPVNEIYAWTLLKIKREILLKL 188


>gi|229820091|ref|YP_002881617.1| ribosomal protein L28 [Beutenbergia cavernae DSM 12333]
 gi|259646728|sp|C5C3F6|RL28_BEUC1 RecName: Full=50S ribosomal protein L28
 gi|229566004|gb|ACQ79855.1| ribosomal protein L28 [Beutenbergia cavernae DSM 12333]
          Length = 63

 Score = 68.5 bits (167), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 14/57 (24%), Positives = 31/57 (54%), Gaps = 2/57 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALR 57
          M+  C++  K    G  VSH++ +T+RR+ PN+ ++  + +   +  +L +    L+
Sbjct: 1  MAATCDVCAKHPSFGYSVSHSHVRTKRRWNPNIQKVRTVVNGTPK--RLNVCTSCLK 55


>gi|166235356|pdb|2JZ6|A Chain A, Solution Structure Of 50s Ribosomal Protein L28 From
          Thermotoga Maritima. Northeast Structural Genomics
          Consortium Target Vr97
          Length = 77

 Score = 68.5 bits (167), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 19/58 (32%), Positives = 33/58 (56%), Gaps = 1/58 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS 58
          M++ CE+  K   SGN VSH++ K+ R F PNL ++ ++        ++R+    L+S
Sbjct: 6  MAKRCEVCGKAPRSGNTVSHSDKKSERWFRPNLQKVRVVLPD-GTIKRMRVCTSCLKS 62


>gi|312380838|gb|EFR26727.1| hypothetical protein AND_06985 [Anopheles darlingi]
          Length = 278

 Score = 68.5 bits (167), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 18/93 (19%), Positives = 41/93 (44%), Gaps = 8/93 (8%)

Query: 7   LTKKTVMSGNKVSHANNKTRRR----FLPNLCRITLISDIMEQKYQLRISKCALRSVERQ 62
              + V+ G +     N+ +RR    ++P L R  + S ++     + ++   L  +   
Sbjct: 80  WGGEAVIKGFQ---KRNQYKRRVPHFWVPVLRRSVVHSRVLNDYMAVTVTDRTLEQIHDH 136

Query: 63  GGLDRFLSNSKKENL-SARMRTLRSQILKKMSE 94
            G D +L  +   +L S     L+ +IL++++ 
Sbjct: 137 HGFDHYLLKTPACDLRSMLAIKLKKKILEELAA 169


>gi|290462043|gb|ADD24069.1| 39S ribosomal protein L28, mitochondrial [Lepeophtheirus salmonis]
          Length = 295

 Score = 68.5 bits (167), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 13/94 (13%), Positives = 38/94 (40%), Gaps = 8/94 (8%)

Query: 7   LTKKTVMSGNKVSHANNKTRR-------RFLPNLCRITLISDIMEQKYQLRISKCALRSV 59
              + V+ G                    + P L    + S ++++  ++ +++  L+ V
Sbjct: 95  WGGEGVIKGLNEPEKQRHYPNPRIPQCNYWWPKLHLAVVYSRVLDKYIEMPVTRRGLKLV 154

Query: 60  ERQGGLDRFLSNSKKENL-SARMRTLRSQILKKM 92
           ++  G D +L  +    + +  +  ++ +IL K+
Sbjct: 155 DKAHGFDNYLLRTPVNEIYAWTLLKIKREILLKL 188


>gi|320186823|gb|EFW61543.1| LSU ribosomal protein L28p [Shigella flexneri CDC 796-83]
          Length = 66

 Score = 68.1 bits (166), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 22/63 (34%), Positives = 36/63 (57%), Gaps = 1/63 (1%)

Query: 13 MSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFLSNS 72
          M+GN  SHA N T+RRFLPNL       +  ++   LR+S   +R ++++G +D  L+  
Sbjct: 1  MTGNNRSHALNATKRRFLPNLHSHRFWVESEKRFVTLRVSAKGMRVIDKKG-IDTVLAEL 59

Query: 73 KKE 75
          +  
Sbjct: 60 RAR 62


>gi|302037986|ref|YP_003798308.1| 50S ribosomal protein L28 [Candidatus Nitrospira defluvii]
 gi|300606050|emb|CBK42383.1| 50S ribosomal protein L28 [Candidatus Nitrospira defluvii]
          Length = 63

 Score = 68.1 bits (166), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 24/58 (41%), Positives = 34/58 (58%), Gaps = 2/58 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS 58
          M+  C+L  K   +GN VSHANNKT+R F PNL R+  + +      ++R+    LRS
Sbjct: 1  MAFACDLCGKKHQTGNNVSHANNKTKRVFNPNLQRVKALVN--GSALRIRVCTRCLRS 56


>gi|121586296|ref|ZP_01676085.1| ribosomal protein L28 [Vibrio cholerae 2740-80]
 gi|121549416|gb|EAX59444.1| ribosomal protein L28 [Vibrio cholerae 2740-80]
          Length = 50

 Score = 68.1 bits (166), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 21/47 (44%), Positives = 27/47 (57%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKY 47
          MSRVC++T K    GN  SHA N T+RRFLPNL       +  ++  
Sbjct: 1  MSRVCQVTGKRPAVGNNRSHAKNATKRRFLPNLQTHRFWVESEKRFV 47


>gi|90414933|ref|ZP_01222897.1| putative ribosomal protein L28 [Photobacterium profundum 3TCK]
 gi|90323989|gb|EAS40585.1| putative ribosomal protein L28 [Photobacterium profundum 3TCK]
          Length = 68

 Score = 68.1 bits (166), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 20/65 (30%), Positives = 37/65 (56%), Gaps = 1/65 (1%)

Query: 11 TVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFLS 70
            ++GN  SHA N T+RRFLPNL       +  ++  +LR++   +R ++++G +D  L+
Sbjct: 1  RPVTGNNRSHARNATKRRFLPNLQTHRFWVESEKRFVKLRLTAKGMRIIDKKG-IDIVLA 59

Query: 71 NSKKE 75
            +  
Sbjct: 60 EMRVR 64


>gi|195576654|ref|XP_002078190.1| GD23314 [Drosophila simulans]
 gi|194190199|gb|EDX03775.1| GD23314 [Drosophila simulans]
          Length = 302

 Score = 68.1 bits (166), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 19/92 (20%), Positives = 44/92 (47%), Gaps = 8/92 (8%)

Query: 7   LTKKTVMSGNKVSHANNKTRRR----FLPNLCRITLISDIMEQKYQLRISKCALRSVERQ 62
              + V+ G +      +T+RR    ++PNL R  + S +++    + +++  L  +   
Sbjct: 87  WGGEAVIKGFQ---KRQQTKRRVPHFWVPNLRRSVVHSHVLDSYMSVVVTERTLEQIHEC 143

Query: 63  GGLDRFLSNSKKENL-SARMRTLRSQILKKMS 93
            G D +L  ++  +L SA    L+ ++L+ + 
Sbjct: 144 HGFDHYLLKNRACDLRSALALKLKREVLQALQ 175


>gi|269137425|ref|YP_003294125.1| ribosomal protein L28 [Edwardsiella tarda EIB202]
 gi|267983085|gb|ACY82914.1| ribosomal protein L28 [Edwardsiella tarda EIB202]
 gi|304557499|gb|ADM40163.1| LSU ribosomal protein L28p [Edwardsiella tarda FL6-60]
          Length = 66

 Score = 68.1 bits (166), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 21/63 (33%), Positives = 37/63 (58%), Gaps = 1/63 (1%)

Query: 13 MSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFLSNS 72
          M+GN  SHA N T+RRFLPNL       +  ++   LR+S   +R ++++G ++  L++ 
Sbjct: 1  MTGNNRSHALNATKRRFLPNLHSHRFWVEGEKRFVTLRVSAKGMRVIDKKG-IEAVLADL 59

Query: 73 KKE 75
          +  
Sbjct: 60 RAR 62


>gi|326505850|dbj|BAJ91164.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gi|326527411|dbj|BAK07980.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 136

 Score = 68.1 bits (166), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 22/70 (31%), Positives = 39/70 (55%), Gaps = 1/70 (1%)

Query: 3   RVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQ 62
           R+C   +K     NKVS +N+KT+++   NL    L  +  ++  +LR+S  AL+++E+ 
Sbjct: 61  RICPFLEKKTNRANKVSFSNHKTKKQQFVNLQYKKLWWEAGKRYVKLRLSTKALKTIEKH 120

Query: 63  GGLDRFLSNS 72
           G LD     +
Sbjct: 121 G-LDAVAKKA 129


>gi|195941297|ref|ZP_03086679.1| 50S ribosomal protein L28 [Borrelia burgdorferi 80a]
          Length = 92

 Score = 68.1 bits (166), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 28/85 (32%), Positives = 38/85 (44%), Gaps = 14/85 (16%)

Query: 1  MSRVCELTKKTVMSGNKVS-------------HANNKTRRRFLPNLCRITLISDIMEQKY 47
          M+R CE+T K  M GN V              H   KT+R F  NL         + +  
Sbjct: 1  MARKCEITGKKTMFGNNVPRKGLAKKKGGAGQHIGVKTKRTFKVNLINKKFFIPNLGRSV 60

Query: 48 QLRISKCALRSVERQGGLDRFLSNS 72
           +R+S  ALRS+ + G LD FL  +
Sbjct: 61 SIRVSANALRSISKIG-LDTFLKKN 84


>gi|332296145|ref|YP_004438068.1| 50S ribosomal protein L28 [Thermodesulfobium narugense DSM 14796]
 gi|332179248|gb|AEE14937.1| 50S ribosomal protein L28 [Thermodesulfobium narugense DSM 14796]
          Length = 62

 Score = 68.1 bits (166), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 21/58 (36%), Positives = 33/58 (56%), Gaps = 2/58 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS 58
          MS+ C +  K   +GN VSH+N KTRRRFLPNL +  +  ++      + +    ++S
Sbjct: 1  MSKFCAICGKGPSTGNNVSHSNRKTRRRFLPNLQK--IKVNLEGSIKNVYVCTSCIKS 56


>gi|294631612|ref|ZP_06710172.1| 50S ribosomal protein L28 [Streptomyces sp. e14]
 gi|292834945|gb|EFF93294.1| 50S ribosomal protein L28 [Streptomyces sp. e14]
          Length = 61

 Score = 68.1 bits (166), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 12/57 (21%), Positives = 28/57 (49%), Gaps = 2/57 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALR 57
          M+  C++  K    GN +S ++ +T RR+ PN+ R+  +     +  ++      ++
Sbjct: 1  MAANCDVCGKGPGFGNNISFSHRRTSRRWNPNIQRVRTVVGGTPK--RVNACTSCIK 55


>gi|223041138|ref|ZP_03611392.1| ribosomal protein L28 [Campylobacter rectus RM3267]
 gi|222877574|gb|EEF12701.1| ribosomal protein L28 [Campylobacter rectus RM3267]
          Length = 63

 Score = 68.1 bits (166), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 26/61 (42%), Positives = 39/61 (63%), Gaps = 1/61 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVC +T K  M GN VSHA N+T+RRFLPNL  I +  +      +++++   LR++ 
Sbjct: 1  MSRVCAITGKGPMVGNNVSHAKNRTKRRFLPNLRTIRVTLED-GTTRKIKVAASTLRTMR 59

Query: 61 R 61
          +
Sbjct: 60 K 60


>gi|224531933|ref|ZP_03672565.1| ribosomal protein L28 [Borrelia valaisiana VS116]
 gi|224511398|gb|EEF81804.1| ribosomal protein L28 [Borrelia valaisiana VS116]
          Length = 92

 Score = 68.1 bits (166), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 27/85 (31%), Positives = 38/85 (44%), Gaps = 14/85 (16%)

Query: 1  MSRVCELTKKTVMSGNKVS-------------HANNKTRRRFLPNLCRITLISDIMEQKY 47
          M+R CE+T K  M GN V              H   KT+R F  NL         + +  
Sbjct: 1  MARKCEITGKKTMFGNNVPRKGLAKKKGGAGQHIGVKTKRTFKVNLINKKFFIPNLGRSI 60

Query: 48 QLRISKCALRSVERQGGLDRFLSNS 72
           +++S  ALRS+ + G LD FL  +
Sbjct: 61 NIKVSANALRSISKMG-LDAFLKKN 84


>gi|123966217|ref|YP_001011298.1| 50S ribosomal protein L28 [Prochlorococcus marinus str. MIT 9515]
 gi|166226601|sp|A2BWN0|RL28_PROM5 RecName: Full=50S ribosomal protein L28
 gi|123200583|gb|ABM72191.1| 50S ribosomal protein L28 [Prochlorococcus marinus str. MIT 9515]
          Length = 78

 Score = 68.1 bits (166), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 22/63 (34%), Positives = 37/63 (58%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVCELT     +G  VSH++ +T++    NL +  L     ++   ++IS  AL+S++
Sbjct: 1  MSRVCELTGARANNGMAVSHSHIRTKKLQQVNLQKRRLWWQEGKKWINIKISTKALKSIQ 60

Query: 61 RQG 63
          + G
Sbjct: 61 KVG 63


>gi|224368343|ref|YP_002602506.1| 50S ribosomal protein L28 [Desulfobacterium autotrophicum HRM2]
 gi|259646733|sp|C0QM36|RL28_DESAH RecName: Full=50S ribosomal protein L28
 gi|223691059|gb|ACN14342.1| RpmB [Desulfobacterium autotrophicum HRM2]
          Length = 74

 Score = 68.1 bits (166), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 33/57 (57%), Gaps = 2/57 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALR 57
          MS+ C++  K  M GN VSHA+N  +RRF PNL R+  + D   Q  ++ +    ++
Sbjct: 1  MSKECKICGKKPMVGNNVSHAHNVNKRRFNPNLQRVKALFD--GQVRRIDVCTSCIK 55


>gi|281341549|gb|EFB17133.1| hypothetical protein PANDA_008919 [Ailuropoda melanoleuca]
          Length = 266

 Score = 68.1 bits (166), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 16/105 (15%), Positives = 47/105 (44%), Gaps = 16/105 (15%)

Query: 7   LTKKTVMSGNKVSHANN---KTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQG 63
              +  + G++  + +    + ++ + P L +  L S+I++ K+ + +++  L  ++   
Sbjct: 80  WGGEGWILGHRYINNDKLSKRVKKVWKPQLFQRELYSEILDTKFTVTVTQRTLDLIDEAY 139

Query: 64  GLDRFLSN------------SKKENL-SARMRTLRSQILKKMSEK 95
           G D ++              + KE+L S     L+  +L +++ +
Sbjct: 140 GFDLYILKASRGPAHSTSWQTPKEDLCSKFGMDLKRGMLLRLARQ 184


>gi|153005375|ref|YP_001379700.1| 50S ribosomal protein L28 [Anaeromyxobacter sp. Fw109-5]
 gi|166226537|sp|A7HDC0|RL28_ANADF RecName: Full=50S ribosomal protein L28
 gi|152028948|gb|ABS26716.1| ribosomal protein L28 [Anaeromyxobacter sp. Fw109-5]
          Length = 73

 Score = 68.1 bits (166), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 2/57 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALR 57
          M+R C++  K  + GN VSHANNK++ R LPNL  +    D   +  +  +    L+
Sbjct: 1  MARRCDICGKGPLVGNNVSHANNKSKTRSLPNLRSVRATVDGTVKHVR--VCTRCLK 55


>gi|33861459|ref|NP_893020.1| 50S ribosomal protein L28 [Prochlorococcus marinus subsp.
          pastoris str. CCMP1986]
 gi|67461501|sp|Q7V1H0|RL28_PROMP RecName: Full=50S ribosomal protein L28
 gi|33634036|emb|CAE19361.1| 50S ribosomal protein L28 [Prochlorococcus marinus subsp.
          pastoris str. CCMP1986]
          Length = 78

 Score = 68.1 bits (166), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 22/63 (34%), Positives = 37/63 (58%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSRVCELT     +G  VSH++ +T++    NL +  L     ++   ++IS  AL+S++
Sbjct: 1  MSRVCELTGAKANNGMAVSHSHIRTKKLQQVNLQKRRLWWQEGKKWVNIKISTKALKSIQ 60

Query: 61 RQG 63
          + G
Sbjct: 61 KVG 63


>gi|332670952|ref|YP_004453960.1| 50S ribosomal protein L28 [Cellulomonas fimi ATCC 484]
 gi|332339990|gb|AEE46573.1| ribosomal protein L28 [Cellulomonas fimi ATCC 484]
          Length = 63

 Score = 68.1 bits (166), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 13/57 (22%), Positives = 31/57 (54%), Gaps = 2/57 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALR 57
          M+  C++  K    G+ +SH++ +T+RR+ PN+ R+  +     +  ++ +    L+
Sbjct: 1  MAANCDVCAKGPSFGHSISHSHVRTKRRWNPNIQRVRAVVAGTPK--RINVCTSCLK 55


>gi|288550206|ref|ZP_05969612.2| hypothetical protein ENTCAN_08233 [Enterobacter cancerogenus ATCC
          35316]
 gi|296100495|ref|YP_003610641.1| ribosomal protein L28 [Enterobacter cloacae subsp. cloacae ATCC
          13047]
 gi|288316122|gb|EFC55060.1| ribosomal protein L28 [Enterobacter cancerogenus ATCC 35316]
 gi|295054954|gb|ADF59692.1| ribosomal protein L28 [Enterobacter cloacae subsp. cloacae ATCC
          13047]
          Length = 66

 Score = 68.1 bits (166), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 23/63 (36%), Positives = 36/63 (57%), Gaps = 1/63 (1%)

Query: 13 MSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFLSNS 72
          M+GN  SHA N T+RRFLPNL       +  ++   LR+S   +R ++++G +D  LS  
Sbjct: 1  MTGNNRSHALNATKRRFLPNLHSHRFWVESEKRFVTLRVSAKGMRVIDKKG-IDTVLSEL 59

Query: 73 KKE 75
          +  
Sbjct: 60 RAR 62


>gi|302525014|ref|ZP_07277356.1| ribosomal protein L28 [Streptomyces sp. AA4]
 gi|302433909|gb|EFL05725.1| ribosomal protein L28 [Streptomyces sp. AA4]
          Length = 63

 Score = 68.1 bits (166), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 15/57 (26%), Positives = 30/57 (52%), Gaps = 1/57 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALR 57
          M+ VC++  K    G  VSH++ +T RR+ PN+  +     + ++K +L      ++
Sbjct: 1  MAAVCDVCGKGPGFGKSVSHSHRRTNRRWNPNIQVVHAKVGVSQRK-RLNACTSCIK 56


>gi|194856401|ref|XP_001968743.1| GG25036 [Drosophila erecta]
 gi|190660610|gb|EDV57802.1| GG25036 [Drosophila erecta]
          Length = 301

 Score = 68.1 bits (166), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 19/92 (20%), Positives = 44/92 (47%), Gaps = 8/92 (8%)

Query: 7   LTKKTVMSGNKVSHANNKTRRR----FLPNLCRITLISDIMEQKYQLRISKCALRSVERQ 62
              + V+ G +      +T+RR    ++PNL R  + S +++    + +++  L  +   
Sbjct: 87  WGGEAVIKGFQ---KRQQTKRRVPHFWVPNLRRSVVHSYVLDSYMSVVVTERTLEQIHEC 143

Query: 63  GGLDRFLSNSKKENL-SARMRTLRSQILKKMS 93
            G D +L  ++  +L SA    L+ ++L+ + 
Sbjct: 144 HGFDHYLLKNRACDLRSALALKLKREVLQALQ 175


>gi|108804206|ref|YP_644143.1| 50S ribosomal protein L28P [Rubrobacter xylanophilus DSM 9941]
 gi|122381810|sp|Q1AW97|RL28_RUBXD RecName: Full=50S ribosomal protein L28
 gi|108765449|gb|ABG04331.1| LSU ribosomal protein L28P [Rubrobacter xylanophilus DSM 9941]
          Length = 71

 Score = 68.1 bits (166), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 16/57 (28%), Positives = 27/57 (47%), Gaps = 2/57 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALR 57
          M++VC    K    GN  SH+   TRRR+ PNL ++ +         ++ +    L+
Sbjct: 1  MAKVCYSCGKGPSFGNARSHSLRATRRRWNPNLQKVRIR--EGGATKRVWVCASCLK 55


>gi|124809906|ref|XP_001348713.1| mitochondrial ribosomal protein L28 precursor, putative [Plasmodium
           falciparum 3D7]
 gi|23497612|gb|AAN37152.1| mitochondrial ribosomal protein L28 precursor, putative [Plasmodium
           falciparum 3D7]
          Length = 281

 Score = 67.8 bits (165), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 20/74 (27%), Positives = 40/74 (54%), Gaps = 2/74 (2%)

Query: 17  KVSHANNKTRRRFLPNLCRITLISDIMEQKY-QLRISKCALRSVERQGGLDRFLSNSKKE 75
           KVS++  KTR +  PN+ +  ++S+ +      +R++  AL +++  GG D ++  +  E
Sbjct: 60  KVSYSLKKTRIKLKPNVFKKHIVSNELNTIIPNVRLTTSALHAMDDAGGFDNYILRTPPE 119

Query: 76  NL-SARMRTLRSQI 88
            L S     LR+ +
Sbjct: 120 ELRSNLGEKLRNVM 133


>gi|23464931|ref|NP_695534.1| 50S ribosomal protein L28 [Bifidobacterium longum NCC2705]
 gi|189439951|ref|YP_001955032.1| 50S ribosomal protein L28 [Bifidobacterium longum DJO10A]
 gi|213691254|ref|YP_002321840.1| ribosomal protein L28 [Bifidobacterium longum subsp. infantis
          ATCC 15697]
 gi|227545779|ref|ZP_03975828.1| 50S ribosomal protein L28 [Bifidobacterium longum subsp. infantis
          ATCC 55813]
 gi|239622523|ref|ZP_04665554.1| 50S ribosomal protein L28 [Bifidobacterium longum subsp. infantis
          CCUG 52486]
 gi|296453486|ref|YP_003660629.1| 50S ribosomal protein L28 [Bifidobacterium longum subsp. longum
          JDM301]
 gi|312133356|ref|YP_004000695.1| rpmb [Bifidobacterium longum subsp. longum BBMN68]
 gi|317481969|ref|ZP_07940994.1| ribosomal protein L28 [Bifidobacterium sp. 12_1_47BFAA]
 gi|322688453|ref|YP_004208187.1| 50S ribosomal protein L28 [Bifidobacterium longum subsp. infantis
          157F]
 gi|322690474|ref|YP_004220044.1| 50S ribosomal protein L28 [Bifidobacterium longum subsp. longum
          JCM 1217]
 gi|67461534|sp|Q8G7D7|RL28_BIFLO RecName: Full=50S ribosomal protein L28
 gi|226738034|sp|B3DTR5|RL28_BIFLD RecName: Full=50S ribosomal protein L28
 gi|23325526|gb|AAN24170.1| 50S ribosomal protein L28 [Bifidobacterium longum NCC2705]
 gi|189428386|gb|ACD98534.1| Ribosomal protein L28 [Bifidobacterium longum DJO10A]
 gi|213522715|gb|ACJ51462.1| ribosomal protein L28 [Bifidobacterium longum subsp. infantis
          ATCC 15697]
 gi|227213895|gb|EEI81734.1| 50S ribosomal protein L28 [Bifidobacterium longum subsp. infantis
          ATCC 55813]
 gi|239514520|gb|EEQ54387.1| 50S ribosomal protein L28 [Bifidobacterium longum subsp. infantis
          CCUG 52486]
 gi|296182917|gb|ADG99798.1| ribosomal protein L28 [Bifidobacterium longum subsp. longum
          JDM301]
 gi|311772579|gb|ADQ02067.1| RpmB [Bifidobacterium longum subsp. longum BBMN68]
 gi|316916536|gb|EFV37933.1| ribosomal protein L28 [Bifidobacterium sp. 12_1_47BFAA]
 gi|320455330|dbj|BAJ65952.1| 50S ribosomal protein L28 [Bifidobacterium longum subsp. longum
          JCM 1217]
 gi|320457318|dbj|BAJ67939.1| 50S ribosomal protein L28 [Bifidobacterium longum subsp. infantis
          ATCC 15697]
 gi|320459789|dbj|BAJ70409.1| 50S ribosomal protein L28 [Bifidobacterium longum subsp. infantis
          157F]
          Length = 64

 Score = 67.8 bits (165), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 17/57 (29%), Positives = 29/57 (50%), Gaps = 2/57 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALR 57
          M+  C +  K   +G  VSH++ +T+R F PNL  +    D   +  +LR+    L+
Sbjct: 1  MAARCAVCGKGPQTGFTVSHSHRRTKRSFRPNLQSVRTTID--GENTRLRVCVKCLK 55


>gi|296130145|ref|YP_003637395.1| ribosomal protein L28 [Cellulomonas flavigena DSM 20109]
 gi|296021960|gb|ADG75196.1| ribosomal protein L28 [Cellulomonas flavigena DSM 20109]
          Length = 63

 Score = 67.8 bits (165), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 14/57 (24%), Positives = 32/57 (56%), Gaps = 2/57 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALR 57
          M+  C++  K    G+ +SH++ +T+RR+ PN+ R+ ++     +  +L +    L+
Sbjct: 1  MAANCDVCAKRPSFGHSISHSHVRTKRRWNPNIQRVRVVVAGTPK--RLNVCTSCLK 55


>gi|149278718|ref|ZP_01884854.1| 50S ribosomal protein L28 [Pedobacter sp. BAL39]
 gi|149230713|gb|EDM36096.1| 50S ribosomal protein L28 [Pedobacter sp. BAL39]
          Length = 67

 Score = 67.8 bits (165), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 17/53 (32%), Positives = 30/53 (56%)

Query: 11 TVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQG 63
            M+G  VSH+N KT+R+F PNL          ++   L++S  A++++ + G
Sbjct: 1  MAMTGFNVSHSNVKTKRKFYPNLQLQKFYIPDEDRWITLKVSTSAIKTINKIG 53


>gi|294101851|ref|YP_003553709.1| ribosomal protein L28 [Aminobacterium colombiense DSM 12261]
 gi|293616831|gb|ADE56985.1| ribosomal protein L28 [Aminobacterium colombiense DSM 12261]
          Length = 64

 Score = 67.8 bits (165), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 21/58 (36%), Positives = 34/58 (58%), Gaps = 1/58 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS 58
          M+RVCE   +  ++GN VSH+N  TRRR+L NL  + +      +  +++I    L+S
Sbjct: 1  MARVCECCGRGPVTGNAVSHSNRHTRRRWLVNLQNVKVDLGA-GETRRMKICTKCLKS 57


>gi|148269805|ref|YP_001244265.1| 50S ribosomal protein L28 [Thermotoga petrophila RKU-1]
 gi|147735349|gb|ABQ46689.1| LSU ribosomal protein L28P [Thermotoga petrophila RKU-1]
          Length = 86

 Score = 67.8 bits (165), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 19/58 (32%), Positives = 33/58 (56%), Gaps = 1/58 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS 58
          M++ CE+  K   SGN VSH++ K+ R F PNL ++ ++        ++R+    L+S
Sbjct: 17 MAKRCEVCGKAPRSGNTVSHSDKKSGRWFRPNLQKVRVVLPD-GTIKRMRVCTSCLKS 73


>gi|297571645|ref|YP_003697419.1| ribosomal protein L28 [Arcanobacterium haemolyticum DSM 20595]
 gi|296931992|gb|ADH92800.1| ribosomal protein L28 [Arcanobacterium haemolyticum DSM 20595]
          Length = 63

 Score = 67.8 bits (165), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 17/57 (29%), Positives = 29/57 (50%), Gaps = 2/57 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALR 57
          M+ VCE+  K    G  VSH++ +T RR+ PN+ R+  +        +L +    L+
Sbjct: 1  MASVCEVCGKGPNFGKSVSHSHVRTSRRWNPNIQRVRALVK--GAPKRLNVCTSCLK 55


>gi|111023473|ref|YP_706445.1| 50S ribosomal protein L28 [Rhodococcus jostii RHA1]
 gi|226365974|ref|YP_002783757.1| 50S ribosomal protein L28 [Rhodococcus opacus B4]
 gi|110823003|gb|ABG98287.1| 50S ribosomal protein L28 [Rhodococcus jostii RHA1]
 gi|226244464|dbj|BAH54812.1| 50S ribosomal protein L28 [Rhodococcus opacus B4]
          Length = 63

 Score = 67.8 bits (165), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 14/57 (24%), Positives = 27/57 (47%), Gaps = 1/57 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALR 57
          M+ VC++  K    G  VSH++ +T RR+ PN+  +           ++ +    L+
Sbjct: 1  MAAVCDVCAKGPGFGKSVSHSHRRTNRRWNPNIQTVRAEV-APGNTRKVNVCTSCLK 56


>gi|291457128|ref|ZP_06596518.1| ribosomal protein L28 [Bifidobacterium breve DSM 20213]
 gi|291380963|gb|EFE88481.1| ribosomal protein L28 [Bifidobacterium breve DSM 20213]
          Length = 64

 Score = 67.8 bits (165), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 17/57 (29%), Positives = 29/57 (50%), Gaps = 2/57 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALR 57
          M+  C +  K   +G  VSH++ +T+R F PNL  +    D   +  +LR+    L+
Sbjct: 1  MAARCAVCGKGPQTGFTVSHSHRRTKRSFRPNLQSVRTTID--GENTRLRVCGKCLK 55


>gi|224534189|ref|ZP_03674767.1| ribosomal protein L28 [Borrelia spielmanii A14S]
 gi|224514291|gb|EEF84607.1| ribosomal protein L28 [Borrelia spielmanii A14S]
          Length = 92

 Score = 67.8 bits (165), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 26/85 (30%), Positives = 38/85 (44%), Gaps = 14/85 (16%)

Query: 1  MSRVCELTKKTVMSGNKVS-------------HANNKTRRRFLPNLCRITLISDIMEQKY 47
          M+R CE+T K  M G+ V              H   KT+R F  NL         + +  
Sbjct: 1  MARKCEITGKKTMFGSNVPRKGLAKKKGGAGQHIGVKTKRTFKVNLINKKFFIPDLGRSI 60

Query: 48 QLRISKCALRSVERQGGLDRFLSNS 72
           +++S  ALRS+ + G LD FL  +
Sbjct: 61 NIKVSASALRSISKLG-LDAFLKKN 84


>gi|195342602|ref|XP_002037889.1| GM18510 [Drosophila sechellia]
 gi|194132739|gb|EDW54307.1| GM18510 [Drosophila sechellia]
          Length = 302

 Score = 67.8 bits (165), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 19/92 (20%), Positives = 44/92 (47%), Gaps = 8/92 (8%)

Query: 7   LTKKTVMSGNKVSHANNKTRRR----FLPNLCRITLISDIMEQKYQLRISKCALRSVERQ 62
              + V+ G +      +T+RR    ++PNL R  + S +++    + +++  L  +   
Sbjct: 87  WGGEAVIKGFQ---KRQQTKRRVPHFWVPNLRRSVVHSHVLDSYMSVVVTERTLEQIHEC 143

Query: 63  GGLDRFLSNSKKENL-SARMRTLRSQILKKMS 93
            G D +L  ++  +L SA    L+ ++L+ + 
Sbjct: 144 HGFDHYLLKNRACDLRSALALKLKREVLQALQ 175


>gi|157364509|ref|YP_001471276.1| ribosomal protein L28 [Thermotoga lettingae TMO]
 gi|166987917|sp|A8F7S8|RL28_THELT RecName: Full=50S ribosomal protein L28
 gi|157315113|gb|ABV34212.1| ribosomal protein L28 [Thermotoga lettingae TMO]
          Length = 65

 Score = 67.8 bits (165), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 33/57 (57%), Gaps = 1/57 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALR 57
          M++ CE+  K  ++G  VSH+N  TRR F PNL +I +I++       +R+    L+
Sbjct: 1  MAKRCEICGKGPVAGKNVSHSNRHTRRMFRPNLQKIRVITED-GTVRTMRVCTRCLK 56


>gi|111115174|ref|YP_709792.1| 50S ribosomal protein L28 [Borrelia afzelii PKo]
 gi|122956384|sp|Q0SNG2|RL28_BORAP RecName: Full=50S ribosomal protein L28
 gi|110890448|gb|ABH01616.1| ribosomal protein L28 [Borrelia afzelii PKo]
          Length = 92

 Score = 67.8 bits (165), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 27/85 (31%), Positives = 38/85 (44%), Gaps = 14/85 (16%)

Query: 1  MSRVCELTKKTVMSGNKVS-------------HANNKTRRRFLPNLCRITLISDIMEQKY 47
          M+R CE+T K  M GN V              H   KT+R F  NL         + +  
Sbjct: 1  MARKCEITGKKTMFGNNVPRKGLAKKKGGARQHIGVKTKRTFKVNLINKKFFIPDLGRSI 60

Query: 48 QLRISKCALRSVERQGGLDRFLSNS 72
           +++S  ALRS+ + G LD FL  +
Sbjct: 61 NIKVSANALRSISKIG-LDAFLKKN 84


>gi|296106029|ref|YP_003617729.1| large subunit ribosomal protein L28 [Legionella pneumophila
          2300/99 Alcoy]
 gi|295647930|gb|ADG23777.1| large subunit ribosomal protein L28 [Legionella pneumophila
          2300/99 Alcoy]
 gi|307609285|emb|CBW98760.1| 50S ribosomal protein L28 [Legionella pneumophila 130b]
          Length = 66

 Score = 67.8 bits (165), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 23/63 (36%), Positives = 36/63 (57%), Gaps = 1/63 (1%)

Query: 13 MSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFLSNS 72
          M G+KVSHANNKT+RRFLPN+       +   +   LR+S   +R +++ G +   L   
Sbjct: 1  MVGHKVSHANNKTKRRFLPNIQNHKFWVEEENRFVTLRLSTKGMRIIDKLG-IKAVLDKI 59

Query: 73 KKE 75
          + +
Sbjct: 60 RAK 62


>gi|32266788|ref|NP_860820.1| 50S ribosomal protein L28 [Helicobacter hepaticus ATCC 51449]
 gi|67461504|sp|Q7VGN1|RL28_HELHP RecName: Full=50S ribosomal protein L28
 gi|32262840|gb|AAP77886.1| ribosomal protein L28 [Helicobacter hepaticus ATCC 51449]
          Length = 62

 Score = 67.8 bits (165), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 25/62 (40%), Positives = 38/62 (61%), Gaps = 1/62 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+R C  T K  M GN VSHANNKT++R LPNL  I L  +      +++++   LR+++
Sbjct: 1  MARKCFFTGKGPMVGNNVSHANNKTKKRSLPNLRSIRLKLED-GTSVRVKVAASTLRTIK 59

Query: 61 RQ 62
          + 
Sbjct: 60 KY 61


>gi|139439773|ref|ZP_01773164.1| Hypothetical protein COLAER_02195 [Collinsella aerofaciens ATCC
          25986]
 gi|133774923|gb|EBA38743.1| Hypothetical protein COLAER_02195 [Collinsella aerofaciens ATCC
          25986]
          Length = 78

 Score = 67.8 bits (165), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 18/58 (31%), Positives = 35/58 (60%), Gaps = 2/58 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS 58
          MS+VCE+  K  ++G  +SH++  T R+F PN+ R+ ++ D   +  ++ +    L+S
Sbjct: 17 MSKVCEVCGKHPVAGRSISHSHRVTNRKFRPNIQRVYVVVDGHRR--KMNVCSTCLKS 72


>gi|95931488|ref|ZP_01314186.1| ribosomal protein L28 [Desulfuromonas acetoxidans DSM 684]
 gi|95132458|gb|EAT14159.1| ribosomal protein L28 [Desulfuromonas acetoxidans DSM 684]
          Length = 61

 Score = 67.8 bits (165), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 33/57 (57%), Gaps = 2/57 (3%)

Query: 2  SRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS 58
          SR CE+  K  ++GN VSHA+NKTR+ + PNL ++  +         +++    +RS
Sbjct: 1  SRTCEICGKKPVTGNNVSHAHNKTRKVWYPNLQKVRAV--KNGSVQTMKVCTRCIRS 55


>gi|226305909|ref|YP_002765869.1| 50S ribosomal protein L28 [Rhodococcus erythropolis PR4]
 gi|229491332|ref|ZP_04385156.1| ribosomal protein L28 [Rhodococcus erythropolis SK121]
 gi|226185026|dbj|BAH33130.1| probable 50S ribosomal protein L28 [Rhodococcus erythropolis PR4]
 gi|229321617|gb|EEN87414.1| ribosomal protein L28 [Rhodococcus erythropolis SK121]
          Length = 63

 Score = 67.4 bits (164), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 14/57 (24%), Positives = 27/57 (47%), Gaps = 1/57 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALR 57
          M+ VC++  K    G  VSH++ +T RR+ PN+  +           ++ +    L+
Sbjct: 1  MAAVCDVCAKGPGFGKSVSHSHRRTNRRWNPNIQSVRTEV-APGNTRKVNVCTSCLK 56


>gi|332703485|ref|ZP_08423573.1| 50S ribosomal protein L28 [Desulfovibrio africanus str. Walvis
          Bay]
 gi|332553634|gb|EGJ50678.1| 50S ribosomal protein L28 [Desulfovibrio africanus str. Walvis
          Bay]
          Length = 67

 Score = 67.4 bits (164), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 23/58 (39%), Positives = 35/58 (60%), Gaps = 1/58 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS 58
          MSR CE+ +K    GN VSHANNKT+R F PNL ++ ++     +   +++    +RS
Sbjct: 1  MSRKCEICEKHRSVGNNVSHANNKTKRVFQPNLQKVRVLLPS-GEVKHMKVCTRCIRS 57


>gi|269794443|ref|YP_003313898.1| 50S ribosomal protein L28P [Sanguibacter keddieii DSM 10542]
 gi|269096628|gb|ACZ21064.1| LSU ribosomal protein L28P [Sanguibacter keddieii DSM 10542]
          Length = 63

 Score = 67.4 bits (164), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 16/57 (28%), Positives = 32/57 (56%), Gaps = 2/57 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALR 57
          M+  CE+  K+   G+ +SH++ +T+RR+ PN+ R+  I +      +L +    L+
Sbjct: 1  MAANCEVCAKSPSFGHSISHSHVRTKRRWNPNIQRVRAIVN--GAPKRLNVCTSCLK 55


>gi|195472823|ref|XP_002088698.1| GE11277 [Drosophila yakuba]
 gi|194174799|gb|EDW88410.1| GE11277 [Drosophila yakuba]
          Length = 301

 Score = 67.4 bits (164), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 19/93 (20%), Positives = 45/93 (48%), Gaps = 8/93 (8%)

Query: 7   LTKKTVMSGNKVSHANNKTRRR----FLPNLCRITLISDIMEQKYQLRISKCALRSVERQ 62
              + V+ G +      +T+RR    ++PNL R  + S +++    + +++  L  +   
Sbjct: 87  WGGEAVIKGFQ---KRQQTKRRVPHFWVPNLRRSVVHSHVLDSYMSVVVTERTLEQIHEC 143

Query: 63  GGLDRFLSNSKKENL-SARMRTLRSQILKKMSE 94
            G D +L  ++  +L SA    L+ ++L+ + +
Sbjct: 144 HGFDHYLLKNRACDLRSALALKLKREVLQALQK 176


>gi|20129239|ref|NP_608887.1| mitochondrial ribosomal protein L28 [Drosophila melanogaster]
 gi|34925528|sp|Q9VMX0|RM28_DROME RecName: Full=39S ribosomal protein L28, mitochondrial;
           Short=L28mt; Short=MRP-L28; Flags: Precursor
 gi|7296915|gb|AAF52188.1| mitochondrial ribosomal protein L28 [Drosophila melanogaster]
 gi|157816666|gb|ABV82326.1| IP19992p [Drosophila melanogaster]
          Length = 302

 Score = 67.4 bits (164), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 17/75 (22%), Positives = 39/75 (52%), Gaps = 5/75 (6%)

Query: 24  KTRRR----FLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFLSNSKKENL-S 78
           +T+RR    ++PNL R  + S +++    + +++  L  +    G D +L  ++  +L S
Sbjct: 101 QTKRRVPHFWVPNLRRSVVHSHVLDCYMSVVVTERTLEQIHECHGFDHYLLKNRACDLRS 160

Query: 79  ARMRTLRSQILKKMS 93
           A    L+ ++L+ + 
Sbjct: 161 ALALKLKREVLQALQ 175


>gi|253581407|ref|ZP_04858633.1| ribosomal protein L28 [Fusobacterium varium ATCC 27725]
 gi|257470806|ref|ZP_05634896.1| 50S ribosomal protein L28P [Fusobacterium ulcerans ATCC 49185]
 gi|317065010|ref|ZP_07929495.1| LSU ribosomal protein L28P [Fusobacterium ulcerans ATCC 49185]
 gi|251836771|gb|EES65305.1| ribosomal protein L28 [Fusobacterium varium ATCC 27725]
 gi|313690686|gb|EFS27521.1| LSU ribosomal protein L28P [Fusobacterium ulcerans ATCC 49185]
          Length = 85

 Score = 67.4 bits (164), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 20/82 (24%), Positives = 44/82 (53%), Gaps = 3/82 (3%)

Query: 3  RVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQ 62
          + CE+T   ++SGN++SH++  TRR + PNL   T++ +      ++++    L+++   
Sbjct: 2  QRCEITGTGIISGNQISHSHRLTRRVWKPNLQVTTIVVN--GSPVKVKVCSRTLKTLRGA 59

Query: 63 GGLDRF-LSNSKKENLSARMRT 83
            ++   +  +    LSAR+  
Sbjct: 60 SEVEVMNILKANASTLSARLAK 81


>gi|237833967|ref|XP_002366281.1| hypothetical protein, conserved [Toxoplasma gondii ME49]
 gi|211963945|gb|EEA99140.1| hypothetical protein, conserved [Toxoplasma gondii ME49]
 gi|221486504|gb|EEE24765.1| conserved hypothetical protein [Toxoplasma gondii GT1]
 gi|221508273|gb|EEE33860.1| conserved hypothetical protein [Toxoplasma gondii VEG]
          Length = 282

 Score = 67.4 bits (164), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 18/74 (24%), Positives = 38/74 (51%), Gaps = 1/74 (1%)

Query: 17  KVSHANNKTRRRFLPNLCRITLISDIMEQKY-QLRISKCALRSVERQGGLDRFLSNSKKE 75
           K + +  +TRR+  PN+ R T  S ++      +R++  AL +++  GG D ++  +  +
Sbjct: 60  KRTFSMRRTRRKIKPNVFRRTFTSSLLNVTIPNVRVTTSALHAMDDMGGFDAYILRTPPQ 119

Query: 76  NLSARMRTLRSQIL 89
            L + M     Q++
Sbjct: 120 ELRSHMGERMRQVM 133


>gi|170581866|ref|XP_001895873.1| hypothetical protein [Brugia malayi]
 gi|158597041|gb|EDP35277.1| conserved hypothetical protein [Brugia malayi]
          Length = 593

 Score = 67.4 bits (164), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 17/88 (19%), Positives = 47/88 (53%), Gaps = 8/88 (9%)

Query: 8   TKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDR 67
           T+K ++  + V H        F P+L ++   S+++++  ++ +++   R +++  GLD 
Sbjct: 121 TRKKILPRHWVPHF-------FFPSLKKVVAYSEVLDKHMKITMTERTCRLIDQHFGLDL 173

Query: 68  FLSNSKKENL-SARMRTLRSQILKKMSE 94
           +L  + + ++ S     L+ +IL  +++
Sbjct: 174 YLLETPEIDIASKLGNKLKREILLVLAK 201


>gi|18447483|gb|AAL68304.1| RE47667p [Drosophila melanogaster]
          Length = 302

 Score = 67.4 bits (164), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 17/75 (22%), Positives = 39/75 (52%), Gaps = 5/75 (6%)

Query: 24  KTRRR----FLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFLSNSKKENL-S 78
           +T+RR    ++PNL R  + S +++    + +++  L  +    G D +L  ++  +L S
Sbjct: 101 QTKRRVPHFWVPNLRRSVVHSHVLDCYMSVVVTERTLEQIHECHGFDHYLLKNRACDLRS 160

Query: 79  ARMRTLRSQILKKMS 93
           A    L+ ++L+ + 
Sbjct: 161 ALALKLKREVLQALQ 175


>gi|206900831|ref|YP_002251217.1| ribosomal protein L28 [Dictyoglomus thermophilum H-6-12]
 gi|217967890|ref|YP_002353396.1| ribosomal protein L28 [Dictyoglomus turgidum DSM 6724]
 gi|226732827|sp|B5YFA9|RL28_DICT6 RecName: Full=50S ribosomal protein L28
 gi|226732828|sp|B8E2D8|RL28_DICTD RecName: Full=50S ribosomal protein L28
 gi|206739934|gb|ACI18992.1| ribosomal protein L28 [Dictyoglomus thermophilum H-6-12]
 gi|217336989|gb|ACK42782.1| ribosomal protein L28 [Dictyoglomus turgidum DSM 6724]
          Length = 63

 Score = 67.4 bits (164), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 17/57 (29%), Positives = 34/57 (59%), Gaps = 2/57 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALR 57
          MSR CE+  K   +G +VSH++ +T+ R+LPNL ++  + +   +   +++    L+
Sbjct: 1  MSRRCEICGKGPWTGLQVSHSHRRTKTRWLPNLHKVRALVN--GKVKTIKVCTRCLK 55


>gi|86606853|ref|YP_475616.1| 50S ribosomal protein L28 [Synechococcus sp. JA-3-3Ab]
 gi|86608530|ref|YP_477292.1| 50S ribosomal protein L28 [Synechococcus sp. JA-2-3B'a(2-13)]
 gi|123502886|sp|Q2JMK8|RL28_SYNJB RecName: Full=50S ribosomal protein L28
 gi|123504396|sp|Q2JQF8|RL28_SYNJA RecName: Full=50S ribosomal protein L28
 gi|86555395|gb|ABD00353.1| ribosomal protein L28 [Synechococcus sp. JA-3-3Ab]
 gi|86557072|gb|ABD02029.1| ribosomal protein L28 [Synechococcus sp. JA-2-3B'a(2-13)]
          Length = 78

 Score = 67.4 bits (164), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 18/63 (28%), Positives = 37/63 (58%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+R C+LT K   +   +SH++ +T+R    NL    +  +  ++  +LR+S  AL++++
Sbjct: 1  MARRCQLTNKKRNNAFAISHSHRRTKRLQEVNLQWKRIWWEEGKRFVRLRLSTKALKTLK 60

Query: 61 RQG 63
           +G
Sbjct: 61 AKG 63


>gi|325118683|emb|CBZ54234.1| conserved hypothetical protein [Neospora caninum Liverpool]
          Length = 282

 Score = 67.0 bits (163), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 18/74 (24%), Positives = 38/74 (51%), Gaps = 1/74 (1%)

Query: 17  KVSHANNKTRRRFLPNLCRITLISDIMEQKY-QLRISKCALRSVERQGGLDRFLSNSKKE 75
           K + +  +TRR+  PN+ R T  S ++      +R++  AL +++  GG D ++  +  +
Sbjct: 60  KRTFSMRRTRRKLKPNVFRRTFTSSLLNVSIPNVRVTTSALHAMDDMGGFDAYILRTPPQ 119

Query: 76  NLSARMRTLRSQIL 89
            L + M     Q++
Sbjct: 120 ELRSHMGERMRQVM 133


>gi|294784947|ref|ZP_06750235.1| 50S ribosomal protein L28 [Fusobacterium sp. 3_1_27]
 gi|294486661|gb|EFG34023.1| 50S ribosomal protein L28 [Fusobacterium sp. 3_1_27]
          Length = 85

 Score = 67.0 bits (163), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 20/82 (24%), Positives = 44/82 (53%), Gaps = 3/82 (3%)

Query: 3  RVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQ 62
          + CE+T   ++SGN++SH++  TRR + PNL   TL+ +      ++++    L++++  
Sbjct: 2  QRCEITGTGLISGNQISHSHRLTRRVWKPNLQVTTLVVN--GSPIKVKVCARTLKTLKGA 59

Query: 63 GGLDRF-LSNSKKENLSARMRT 83
            ++   +  +    LS R+  
Sbjct: 60 SEIEVMRILKANIATLSERLLK 81


>gi|258645746|ref|ZP_05733215.1| ribosomal protein L28 [Dialister invisus DSM 15470]
 gi|260403115|gb|EEW96662.1| ribosomal protein L28 [Dialister invisus DSM 15470]
          Length = 63

 Score = 67.0 bits (163), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 19/58 (32%), Positives = 33/58 (56%), Gaps = 2/58 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS 58
          M+  CE+  K   +G  VSH++ KT+R + PN+ R+ + +D   Q  ++ +    LRS
Sbjct: 1  MANYCEICGKHTATGFNVSHSHLKTKRTWKPNIQRVRVKAD--GQVKRMNVCTRCLRS 56


>gi|161616808|ref|YP_001590773.1| hypothetical protein SPAB_04627 [Salmonella enterica subsp.
          enterica serovar Paratyphi B str. SPB7]
 gi|161366172|gb|ABX69940.1| hypothetical protein SPAB_04627 [Salmonella enterica subsp.
          enterica serovar Paratyphi B str. SPB7]
 gi|321226781|gb|EFX51831.1| LSU ribosomal protein L28p [Salmonella enterica subsp. enterica
          serovar Typhimurium str. TN061786]
 gi|322680941|gb|EFY76975.1| 50S ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Montevideo str. 413180]
 gi|323210479|gb|EFZ95365.1| 50S ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Montevideo str. 556152]
 gi|323257302|gb|EGA41001.1| 50S ribosomal protein L28 [Salmonella enterica subsp. enterica
          serovar Montevideo str. IA_2010008283]
          Length = 66

 Score = 67.0 bits (163), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 23/71 (32%), Positives = 35/71 (49%), Gaps = 6/71 (8%)

Query: 13 MSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFLSNS 72
          M+GN  SHA N T+RRFLPNL       +  ++   LR+S   +R ++++G        +
Sbjct: 1  MTGNNRSHALNATKRRFLPNLHSHRFWVESEKRFVTLRVSAKGMRIIDKKG------IET 54

Query: 73 KKENLSARMRT 83
              L AR   
Sbjct: 55 VLSELRARGEK 65


>gi|158296736|ref|XP_317077.4| AGAP008376-PA [Anopheles gambiae str. PEST]
 gi|157014855|gb|EAA12310.5| AGAP008376-PA [Anopheles gambiae str. PEST]
          Length = 289

 Score = 67.0 bits (163), Expect = 9e-10,   Method: Composition-based stats.
 Identities = 14/86 (16%), Positives = 36/86 (41%), Gaps = 4/86 (4%)

Query: 10  KTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFL 69
           K     N+      +    ++P L R  + S ++ +   + ++   L  +    G D +L
Sbjct: 94  KGFQKRNQY---KRRVPHFWVPVLRRSVVHSRVLNEYMAVTVTDRTLAQIHDHHGFDHYL 150

Query: 70  SNSKKENL-SARMRTLRSQILKKMSE 94
             +   +L S     L+ ++L++++ 
Sbjct: 151 LKTPACDLRSLLAIKLKKKVLEELAA 176


>gi|15643026|ref|NP_228069.1| 50S ribosomal protein L28 [Thermotoga maritima MSB8]
 gi|4980752|gb|AAD35344.1|AE001708_12 ribosomal protein L28 [Thermotoga maritima MSB8]
          Length = 72

 Score = 67.0 bits (163), Expect = 9e-10,   Method: Composition-based stats.
 Identities = 19/58 (32%), Positives = 33/58 (56%), Gaps = 1/58 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS 58
          M++ CE+  K   SGN VSH++ K+ R F PNL ++ ++        ++R+    L+S
Sbjct: 3  MAKRCEVCGKAPRSGNTVSHSDKKSGRWFRPNLQKVRVVLPD-GTIKRMRVCTSCLKS 59


>gi|320527289|ref|ZP_08028474.1| ribosomal protein L28 [Solobacterium moorei F0204]
 gi|320132313|gb|EFW24858.1| ribosomal protein L28 [Solobacterium moorei F0204]
          Length = 88

 Score = 67.0 bits (163), Expect = 9e-10,   Method: Composition-based stats.
 Identities = 23/59 (38%), Positives = 38/59 (64%), Gaps = 2/59 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSV 59
          MSRVC ++ K  MSGN+ SH+   TRR++  NL ++ +I D   +   ++IS  AL+++
Sbjct: 22 MSRVCAVSGKKAMSGNRRSHSLRATRRKWNVNLQKVHMIVD--GKPQTVKISARALKTL 78


>gi|239618031|ref|YP_002941353.1| ribosomal protein L28 [Kosmotoga olearia TBF 19.5.1]
 gi|259646742|sp|C5CFE0|RL28_KOSOT RecName: Full=50S ribosomal protein L28
 gi|239506862|gb|ACR80349.1| ribosomal protein L28 [Kosmotoga olearia TBF 19.5.1]
          Length = 63

 Score = 67.0 bits (163), Expect = 9e-10,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 35/57 (61%), Gaps = 2/57 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALR 57
          MS+VCE+  K   +GN VSH+N K +R + PN+ ++ +I D   +  ++R+    L+
Sbjct: 1  MSKVCEICGKRPTTGNTVSHSNKKNKRWWKPNVQKVKVIVD--GEVKKMRVCTKCLK 55


>gi|320536367|ref|ZP_08036408.1| ribosomal protein L28 [Treponema phagedenis F0421]
 gi|320146779|gb|EFW38354.1| ribosomal protein L28 [Treponema phagedenis F0421]
          Length = 63

 Score = 66.6 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 16/58 (27%), Positives = 34/58 (58%), Gaps = 2/58 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS 58
          M+R CE+  K  ++G+ VS + N T+R + PNL  + + +++  +   +++    L+S
Sbjct: 1  MARKCEICGKGTVAGHNVSKSMNHTKRVWKPNL--VEVKTEVGGRTLTVKMCTRCLKS 56


>gi|254383281|ref|ZP_04998634.1| 50S ribosomal protein L28 [Streptomyces sp. Mg1]
 gi|302537157|ref|ZP_07289499.1| ribosomal protein L28 [Streptomyces sp. C]
 gi|194342179|gb|EDX23145.1| 50S ribosomal protein L28 [Streptomyces sp. Mg1]
 gi|302446052|gb|EFL17868.1| ribosomal protein L28 [Streptomyces sp. C]
          Length = 61

 Score = 66.6 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 14/57 (24%), Positives = 30/57 (52%), Gaps = 2/57 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALR 57
          M+  C++  K    GN +SH++ +T RR+ PN+ R+  + +   +  +L      ++
Sbjct: 1  MAANCDVCAKGPSFGNNISHSHRRTSRRWNPNIQRVRAVVNGTPK--RLNACTSCIK 55


>gi|170288491|ref|YP_001738729.1| ribosomal protein L28 [Thermotoga sp. RQ2]
 gi|281412311|ref|YP_003346390.1| ribosomal protein L28 [Thermotoga naphthophila RKU-10]
 gi|14195689|sp|Q9WY96|RL28_THEMA RecName: Full=50S ribosomal protein L28
 gi|226699179|sp|B1L9P8|RL28_THESQ RecName: Full=50S ribosomal protein L28
 gi|170175994|gb|ACB09046.1| ribosomal protein L28 [Thermotoga sp. RQ2]
 gi|281373414|gb|ADA66976.1| ribosomal protein L28 [Thermotoga naphthophila RKU-10]
          Length = 70

 Score = 66.6 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 19/58 (32%), Positives = 33/58 (56%), Gaps = 1/58 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS 58
          M++ CE+  K   SGN VSH++ K+ R F PNL ++ ++        ++R+    L+S
Sbjct: 1  MAKRCEVCGKAPRSGNTVSHSDKKSGRWFRPNLQKVRVVLPD-GTIKRMRVCTSCLKS 57


>gi|162452706|ref|YP_001615073.1| 50S ribosomal protein L28 [Sorangium cellulosum 'So ce 56']
 gi|161163288|emb|CAN94593.1| 50S ribosomal protein L28 [Sorangium cellulosum 'So ce 56']
          Length = 74

 Score = 66.6 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 15/63 (23%), Positives = 34/63 (53%), Gaps = 1/63 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M++  ++T K  +    VSH+N KT+R  L N+    +    + +  +L ++   +R+++
Sbjct: 1  MAKS-DITGKRKLLAQNVSHSNIKTKRWQLVNIQTRRVWVPELNRFVKLNLTTRDIRTID 59

Query: 61 RQG 63
          + G
Sbjct: 60 KIG 62


>gi|11467375|ref|NP_043232.1| ribosomal protein L28 [Cyanophora paradoxa]
 gi|1350638|sp|P48129|RK28_CYAPA RecName: Full=50S ribosomal protein L28, cyanelle
 gi|1016176|gb|AAA81263.1| ribosomal protein L28 [Cyanophora paradoxa]
          Length = 70

 Score = 66.6 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 19/70 (27%), Positives = 38/70 (54%), Gaps = 1/70 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+R CELT K   +G  VSH++ +T+     NL    + S  +++  +L++S   ++ + 
Sbjct: 1  MARQCELTGKKANNGYTVSHSHRRTKCLQKANLQTKRIWSPTLKRWLKLQVSTKVIKDL- 59

Query: 61 RQGGLDRFLS 70
          ++  +D  L 
Sbjct: 60 KRKSIDALLK 69


>gi|291086415|ref|ZP_06355757.2| hypothetical protein CIT292_10430 [Citrobacter youngae ATCC
          29220]
 gi|291068198|gb|EFE06307.1| ribosomal protein L28 [Citrobacter youngae ATCC 29220]
          Length = 66

 Score = 66.6 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 23/71 (32%), Positives = 35/71 (49%), Gaps = 6/71 (8%)

Query: 13 MSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFLSNS 72
          M+GN  SHA N T+RRFLPNL       +  ++   LR+S   +R ++++G        +
Sbjct: 1  MTGNNRSHALNATKRRFLPNLHSHRFWVESEKRFVTLRVSAKGMRVIDKKG------IET 54

Query: 73 KKENLSARMRT 83
              L AR   
Sbjct: 55 VLSELRARGEK 65


>gi|226326897|ref|ZP_03802415.1| hypothetical protein PROPEN_00757 [Proteus penneri ATCC 35198]
 gi|225204734|gb|EEG87088.1| hypothetical protein PROPEN_00757 [Proteus penneri ATCC 35198]
          Length = 66

 Score = 66.6 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 22/63 (34%), Positives = 37/63 (58%), Gaps = 1/63 (1%)

Query: 13 MSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFLSNS 72
          MSGN  SHA N T+RRFLPNL       +  ++   LR+S   +R ++++G ++  L++ 
Sbjct: 1  MSGNNRSHALNATKRRFLPNLHSHRFWVESEKRFVTLRVSAKGMRVIDKKG-IESVLADL 59

Query: 73 KKE 75
          +  
Sbjct: 60 RAR 62


>gi|119953145|ref|YP_945354.1| 50S ribosomal protein L28 [Borrelia turicatae 91E135]
 gi|254801503|sp|A1QZE2|RL28_BORT9 RecName: Full=50S ribosomal protein L28
 gi|119861916|gb|AAX17684.1| LSU ribosomal protein L28P [Borrelia turicatae 91E135]
          Length = 92

 Score = 66.6 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 27/88 (30%), Positives = 37/88 (42%), Gaps = 14/88 (15%)

Query: 1  MSRVCELTKKTVMSGNKVS-------------HANNKTRRRFLPNLCRITLISDIMEQKY 47
          M R CE+T K  M GN V              H   KTRR F  NL         + +  
Sbjct: 1  MGRECEITGKKTMFGNNVPRKGLSRKKGGGGQHIGVKTRRTFKVNLINKKFFVPELGKSI 60

Query: 48 QLRISKCALRSVERQGGLDRFLSNSKKE 75
           +++S   LRS+ + G L  FL  + K+
Sbjct: 61 NIKVSASTLRSISKLG-LSVFLKKNSKK 87


>gi|215411756|ref|ZP_03420552.1| 50S ribosomal protein L28 [Mycobacterium tuberculosis 94_M4241A]
 gi|298525561|ref|ZP_07012970.1| 50S ribosomal protein L28 rpmB2 [Mycobacterium tuberculosis
          94_M4241A]
 gi|298495355|gb|EFI30649.1| 50S ribosomal protein L28 rpmB2 [Mycobacterium tuberculosis
          94_M4241A]
          Length = 78

 Score = 66.6 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 19/63 (30%), Positives = 38/63 (60%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS  C++T +    G+ VSH++ ++RRR+ PN+ + T       ++ +LR+S   ++ ++
Sbjct: 1  MSAHCQVTGRKPGFGHTVSHSHRRSRRRWSPNIQQRTYYLPSEGRRIRLRVSTKGIKVID 60

Query: 61 RQG 63
          R G
Sbjct: 61 RDG 63


>gi|15609195|ref|NP_216574.1| 50S ribosomal protein L28 [Mycobacterium tuberculosis H37Rv]
 gi|15841547|ref|NP_336584.1| 50S ribosomal protein L28 [Mycobacterium tuberculosis CDC1551]
 gi|31793241|ref|NP_855734.1| 50S ribosomal protein L28 [Mycobacterium bovis AF2122/97]
 gi|121637944|ref|YP_978167.1| 50S ribosomal protein L28 [Mycobacterium bovis BCG str. Pasteur
          1173P2]
 gi|148661872|ref|YP_001283395.1| 50S ribosomal protein L28 [Mycobacterium tuberculosis H37Ra]
 gi|148823274|ref|YP_001288028.1| 50S ribosomal protein L28 [Mycobacterium tuberculosis F11]
 gi|167966863|ref|ZP_02549140.1| 50S ribosomal protein L28 [Mycobacterium tuberculosis H37Ra]
 gi|215404130|ref|ZP_03416311.1| 50S ribosomal protein L28 [Mycobacterium tuberculosis 02_1987]
 gi|215430981|ref|ZP_03428900.1| 50S ribosomal protein L28 [Mycobacterium tuberculosis EAS054]
 gi|215446276|ref|ZP_03433028.1| 50S ribosomal protein L28 [Mycobacterium tuberculosis T85]
 gi|219558026|ref|ZP_03537102.1| 50S ribosomal protein L28 [Mycobacterium tuberculosis T17]
 gi|224990438|ref|YP_002645125.1| 50S ribosomal protein L28 [Mycobacterium bovis BCG str. Tokyo
          172]
 gi|253798885|ref|YP_003031886.1| 50S ribosomal protein L28 rpmB2 [Mycobacterium tuberculosis KZN
          1435]
 gi|254232228|ref|ZP_04925555.1| 50S ribosomal protein L28 rpmB2 [Mycobacterium tuberculosis C]
 gi|254364874|ref|ZP_04980920.1| 50S ribosomal protein L28 rpmB2 [Mycobacterium tuberculosis str.
          Haarlem]
 gi|254551085|ref|ZP_05141532.1| 50S ribosomal protein L28 [Mycobacterium tuberculosis '98-R604
          INH-RIF-EM']
 gi|260187035|ref|ZP_05764509.1| 50S ribosomal protein L28 [Mycobacterium tuberculosis CPHL_A]
 gi|260201168|ref|ZP_05768659.1| 50S ribosomal protein L28 [Mycobacterium tuberculosis T46]
 gi|260205343|ref|ZP_05772834.1| 50S ribosomal protein L28 [Mycobacterium tuberculosis K85]
 gi|289443561|ref|ZP_06433305.1| 50S ribosomal protein L28 rpmB2 [Mycobacterium tuberculosis T46]
 gi|289447678|ref|ZP_06437422.1| 50S ribosomal protein L28 rpmB2 [Mycobacterium tuberculosis
          CPHL_A]
 gi|289554158|ref|ZP_06443368.1| 50S ribosomal protein L28 rpmB2 [Mycobacterium tuberculosis KZN
          605]
 gi|289570169|ref|ZP_06450396.1| 50S ribosomal protein L28 rpmB2 [Mycobacterium tuberculosis T17]
 gi|289574737|ref|ZP_06454964.1| 50S ribosomal protein L28 rpmB2 [Mycobacterium tuberculosis K85]
 gi|289745333|ref|ZP_06504711.1| 50S ribosomal protein L28 [Mycobacterium tuberculosis 02_1987]
 gi|289745989|ref|ZP_06505367.1| 50S ribosomal protein L28 rpmB2 [Mycobacterium tuberculosis
          02_1987]
 gi|289750652|ref|ZP_06510030.1| 50S ribosomal protein L28 rpmB2 [Mycobacterium tuberculosis T92]
 gi|289754168|ref|ZP_06513546.1| ribosomal protein L28 [Mycobacterium tuberculosis EAS054]
 gi|289758178|ref|ZP_06517556.1| ribosomal protein L28 [Mycobacterium tuberculosis T85]
 gi|289762215|ref|ZP_06521593.1| 50S ribosomal protein L28 rpmB2 [Mycobacterium tuberculosis GM
          1503]
 gi|294996997|ref|ZP_06802688.1| 50S ribosomal protein L28 [Mycobacterium tuberculosis 210]
 gi|297634635|ref|ZP_06952415.1| 50S ribosomal protein L28 [Mycobacterium tuberculosis KZN 4207]
 gi|297731622|ref|ZP_06960740.1| 50S ribosomal protein L28 [Mycobacterium tuberculosis KZN R506]
 gi|306776296|ref|ZP_07414633.1| 50S ribosomal protein L28 rpmB2 [Mycobacterium tuberculosis
          SUMu001]
 gi|306780083|ref|ZP_07418420.1| 50S ribosomal protein L28 rpmB2 [Mycobacterium tuberculosis
          SUMu002]
 gi|306784829|ref|ZP_07423151.1| 50S ribosomal protein L28 rpmB2 [Mycobacterium tuberculosis
          SUMu003]
 gi|306789192|ref|ZP_07427514.1| 50S ribosomal protein L28 rpmB2 [Mycobacterium tuberculosis
          SUMu004]
 gi|306793525|ref|ZP_07431827.1| 50S ribosomal protein L28 rpmB2 [Mycobacterium tuberculosis
          SUMu005]
 gi|306797910|ref|ZP_07436212.1| 50S ribosomal protein L28 rpmB2 [Mycobacterium tuberculosis
          SUMu006]
 gi|306803787|ref|ZP_07440455.1| 50S ribosomal protein L28 rpmB2 [Mycobacterium tuberculosis
          SUMu008]
 gi|306808361|ref|ZP_07445029.1| 50S ribosomal protein L28 rpmB2 [Mycobacterium tuberculosis
          SUMu007]
 gi|306968184|ref|ZP_07480845.1| 50S ribosomal protein L28 rpmB2 [Mycobacterium tuberculosis
          SUMu009]
 gi|306972411|ref|ZP_07485072.1| 50S ribosomal protein L28 rpmB2 [Mycobacterium tuberculosis
          SUMu010]
 gi|307080118|ref|ZP_07489288.1| 50S ribosomal protein L28 rpmB2 [Mycobacterium tuberculosis
          SUMu011]
 gi|307084697|ref|ZP_07493810.1| 50S ribosomal protein L28 rpmB2 [Mycobacterium tuberculosis
          SUMu012]
 gi|313658956|ref|ZP_07815836.1| 50S ribosomal protein L28 [Mycobacterium tuberculosis KZN V2475]
 gi|54039005|sp|P66149|RL28B_MYCBO RecName: Full=50S ribosomal protein L28-2
 gi|54041849|sp|P66148|RL28B_MYCTU RecName: Full=50S ribosomal protein L28-2
 gi|3242288|emb|CAA17272.1| Probable 50S ribosomal protein L28 RpmB2 [Mycobacterium
          tuberculosis H37Rv]
 gi|13881793|gb|AAK46398.1| ribosomal protein L28 [Mycobacterium tuberculosis CDC1551]
 gi|31618833|emb|CAD96937.1| ribosomal protein L28 [Mycobacterium bovis AF2122/97]
 gi|121493591|emb|CAL72065.1| ribosomal protein L28 [Mycobacterium bovis BCG str. Pasteur
          1173P2]
 gi|124601287|gb|EAY60297.1| 50S ribosomal protein L28 rpmB2 [Mycobacterium tuberculosis C]
 gi|134150388|gb|EBA42433.1| 50S ribosomal protein L28 rpmB2 [Mycobacterium tuberculosis str.
          Haarlem]
 gi|148506024|gb|ABQ73833.1| 50S ribosomal protein L28 [Mycobacterium tuberculosis H37Ra]
 gi|148721801|gb|ABR06426.1| 50S ribosomal protein L28 rpmB2 [Mycobacterium tuberculosis F11]
 gi|224773551|dbj|BAH26357.1| 50S ribosomal protein L28 [Mycobacterium bovis BCG str. Tokyo
          172]
 gi|253320388|gb|ACT24991.1| 50S ribosomal protein L28 rpmB2 [Mycobacterium tuberculosis KZN
          1435]
 gi|289416480|gb|EFD13720.1| 50S ribosomal protein L28 rpmB2 [Mycobacterium tuberculosis T46]
 gi|289420636|gb|EFD17837.1| 50S ribosomal protein L28 rpmB2 [Mycobacterium tuberculosis
          CPHL_A]
 gi|289438790|gb|EFD21283.1| 50S ribosomal protein L28 rpmB2 [Mycobacterium tuberculosis KZN
          605]
 gi|289539168|gb|EFD43746.1| 50S ribosomal protein L28 rpmB2 [Mycobacterium tuberculosis K85]
 gi|289543923|gb|EFD47571.1| 50S ribosomal protein L28 rpmB2 [Mycobacterium tuberculosis T17]
 gi|289685861|gb|EFD53349.1| 50S ribosomal protein L28 [Mycobacterium tuberculosis 02_1987]
 gi|289686517|gb|EFD54005.1| 50S ribosomal protein L28 rpmB2 [Mycobacterium tuberculosis
          02_1987]
 gi|289691239|gb|EFD58668.1| 50S ribosomal protein L28 rpmB2 [Mycobacterium tuberculosis T92]
 gi|289694755|gb|EFD62184.1| ribosomal protein L28 [Mycobacterium tuberculosis EAS054]
 gi|289709721|gb|EFD73737.1| 50S ribosomal protein L28 rpmB2 [Mycobacterium tuberculosis GM
          1503]
 gi|289713742|gb|EFD77754.1| ribosomal protein L28 [Mycobacterium tuberculosis T85]
 gi|308215251|gb|EFO74650.1| 50S ribosomal protein L28 rpmB2 [Mycobacterium tuberculosis
          SUMu001]
 gi|308326988|gb|EFP15839.1| 50S ribosomal protein L28 rpmB2 [Mycobacterium tuberculosis
          SUMu002]
 gi|308330423|gb|EFP19274.1| 50S ribosomal protein L28 rpmB2 [Mycobacterium tuberculosis
          SUMu003]
 gi|308334257|gb|EFP23108.1| 50S ribosomal protein L28 rpmB2 [Mycobacterium tuberculosis
          SUMu004]
 gi|308338058|gb|EFP26909.1| 50S ribosomal protein L28 rpmB2 [Mycobacterium tuberculosis
          SUMu005]
 gi|308341749|gb|EFP30600.1| 50S ribosomal protein L28 rpmB2 [Mycobacterium tuberculosis
          SUMu006]
 gi|308345235|gb|EFP34086.1| 50S ribosomal protein L28 rpmB2 [Mycobacterium tuberculosis
          SUMu007]
 gi|308349536|gb|EFP38387.1| 50S ribosomal protein L28 rpmB2 [Mycobacterium tuberculosis
          SUMu008]
 gi|308354167|gb|EFP43018.1| 50S ribosomal protein L28 rpmB2 [Mycobacterium tuberculosis
          SUMu009]
 gi|308358120|gb|EFP46971.1| 50S ribosomal protein L28 rpmB2 [Mycobacterium tuberculosis
          SUMu010]
 gi|308362046|gb|EFP50897.1| 50S ribosomal protein L28 rpmB2 [Mycobacterium tuberculosis
          SUMu011]
 gi|308365724|gb|EFP54575.1| 50S ribosomal protein L28 rpmB2 [Mycobacterium tuberculosis
          SUMu012]
 gi|323719353|gb|EGB28492.1| 50S ribosomal protein L28 rpmB2 [Mycobacterium tuberculosis
          CDC1551A]
 gi|326903671|gb|EGE50604.1| 50S ribosomal protein L28 rpmB2 [Mycobacterium tuberculosis
          W-148]
 gi|328458642|gb|AEB04065.1| 50S ribosomal protein L28 rpmB2 [Mycobacterium tuberculosis KZN
          4207]
          Length = 78

 Score = 66.6 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 20/63 (31%), Positives = 38/63 (60%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS  C++T +    GN VSH++ ++RRR+ PN+ + T       ++ +LR+S   ++ ++
Sbjct: 1  MSAHCQVTGRKPGFGNTVSHSHRRSRRRWSPNIQQRTYYLPSEGRRIRLRVSTKGIKVID 60

Query: 61 RQG 63
          R G
Sbjct: 61 RDG 63


>gi|260887368|ref|ZP_05898631.1| ribosomal protein L28 [Selenomonas sputigena ATCC 35185]
 gi|330838657|ref|YP_004413237.1| ribosomal protein L28 [Selenomonas sputigena ATCC 35185]
 gi|260862906|gb|EEX77406.1| ribosomal protein L28 [Selenomonas sputigena ATCC 35185]
 gi|329746421|gb|AEB99777.1| ribosomal protein L28 [Selenomonas sputigena ATCC 35185]
          Length = 63

 Score = 66.2 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 21/58 (36%), Positives = 33/58 (56%), Gaps = 2/58 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS 58
          M+ VCE+  K  MSG  VSH++ KT+R++ PN+ R+  I +   +     +    LRS
Sbjct: 1  MASVCEICAKGEMSGMNVSHSHLKTKRKWKPNIQRVRAIVNGETKHV--NVCTRCLRS 56


>gi|227494672|ref|ZP_03924988.1| 50S ribosomal protein L28 [Actinomyces coleocanis DSM 15436]
 gi|226831854|gb|EEH64237.1| 50S ribosomal protein L28 [Actinomyces coleocanis DSM 15436]
          Length = 63

 Score = 66.2 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 17/58 (29%), Positives = 29/58 (50%), Gaps = 2/58 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS 58
          M+  C++  K    G  VSH++ +T RR+ PN+ RI  I        +L +    ++S
Sbjct: 1  MASKCDVCGKGPGFGKSVSHSHVRTNRRWNPNIQRIRAIVK--GAPKRLNVCTTCIKS 56


>gi|161702940|ref|NP_926784.2| 50S ribosomal protein L28 [Gloeobacter violaceus PCC 7421]
 gi|67461494|sp|Q7NEP1|RL28_GLOVI RecName: Full=50S ribosomal protein L28
          Length = 81

 Score = 66.2 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 17/62 (27%), Positives = 32/62 (51%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR C LT K   +   VS ++ + +R  + NL    +  D      +L++S  A++++E
Sbjct: 1  MSRKCMLTGKKANNAYSVSFSHRRNKRLQMANLQWKRIWDDQQGCFVRLKLSTKAIKTLE 60

Query: 61 RQ 62
           +
Sbjct: 61 HR 62


>gi|148654768|ref|YP_001274973.1| 50S ribosomal protein L28 [Roseiflexus sp. RS-1]
 gi|148566878|gb|ABQ89023.1| ribosomal protein L28 [Roseiflexus sp. RS-1]
          Length = 91

 Score = 66.2 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 25/89 (28%), Positives = 43/89 (48%), Gaps = 13/89 (14%)

Query: 1  MSRVCELTKKTVMSGNKVSHANN--------KTRRRFLPNLCRITLISDIMEQKYQLRIS 52
          M+R C+LT K V  G  + H  +        KT R F PN+ R T+    + +   L +S
Sbjct: 1  MAR-CDLTGKKVAFGRNIRHKASGGWARRAPKTNRTFRPNVHRHTIYVPEIGRSITLNLS 59

Query: 53 KCALRSVERQGGLDRFLSNSKKENLSARM 81
            ALR++ ++G     ++  + + LS + 
Sbjct: 60 TKALRTINKKG----LIAAVRDQGLSVKA 84


>gi|34556763|ref|NP_906578.1| 50S ribosomal protein L28 [Wolinella succinogenes DSM 1740]
 gi|67461486|sp|Q7MAD1|RL28_WOLSU RecName: Full=50S ribosomal protein L28
 gi|34482477|emb|CAE09478.1| 50S RIBOSOMAL PROTEIN L28 [Wolinella succinogenes]
          Length = 62

 Score = 66.2 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 25/62 (40%), Positives = 39/62 (62%), Gaps = 1/62 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+R C  T K  M GN VSHANNKT++R LPNL  + +  +      +LR++   LR+++
Sbjct: 1  MARKCFFTGKGPMVGNNVSHANNKTKKRSLPNLRTVRVKLED-GTTVKLRVAASTLRTMK 59

Query: 61 RQ 62
          ++
Sbjct: 60 KR 61


>gi|297617074|ref|YP_003702233.1| ribosomal protein L28 [Syntrophothermus lipocalidus DSM 12680]
 gi|297144911|gb|ADI01668.1| ribosomal protein L28 [Syntrophothermus lipocalidus DSM 12680]
          Length = 62

 Score = 66.2 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 16/58 (27%), Positives = 34/58 (58%), Gaps = 3/58 (5%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS 58
          M++ CE+  K ++ G + SH++ +T R++ PN+ ++ ++ D   Q  +  +    LRS
Sbjct: 1  MAK-CEICGKGIVFGKQYSHSHIRTNRKWKPNVQKVRILVD--GQPQKTYVCTRCLRS 55


>gi|152990068|ref|YP_001355790.1| 50S ribosomal protein L28 [Nitratiruptor sp. SB155-2]
 gi|166226590|sp|A6Q1S4|RL28_NITSB RecName: Full=50S ribosomal protein L28
 gi|151421929|dbj|BAF69433.1| 50S ribosomal protein L28 [Nitratiruptor sp. SB155-2]
          Length = 67

 Score = 66.2 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 24/62 (38%), Positives = 42/62 (67%), Gaps = 1/62 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS+ C++T K  ++G+ VSHANNKT+RRFLPN+  + +       K ++++S   LR ++
Sbjct: 1  MSKKCQVTGKKPITGHNVSHANNKTKRRFLPNIRTVRVTLPD-GTKKKIKVSAKGLRILK 59

Query: 61 RQ 62
          ++
Sbjct: 60 KK 61


>gi|291286451|ref|YP_003503267.1| 50S ribosomal protein L28 [Denitrovibrio acetiphilus DSM 12809]
 gi|290883611|gb|ADD67311.1| ribosomal protein L28 [Denitrovibrio acetiphilus DSM 12809]
          Length = 62

 Score = 66.2 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 18/57 (31%), Positives = 33/57 (57%), Gaps = 2/57 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALR 57
          M++ CE+  K  M G+++SHA+N +RR F PN+ RI +I        + ++    ++
Sbjct: 1  MAKRCEICGKGPMFGHQISHAHNVSRRVFYPNVHRIRVI--ESGAVVRKKVCTKCMK 55


>gi|327399092|ref|YP_004339961.1| 50S ribosomal protein L28 [Hippea maritima DSM 10411]
 gi|327181721|gb|AEA33902.1| 50S ribosomal protein L28 [Hippea maritima DSM 10411]
          Length = 64

 Score = 66.2 bits (161), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 16/57 (28%), Positives = 33/57 (57%), Gaps = 2/57 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALR 57
          M+R CE+  K    G KVSH++ +T++++ PN+ R+ +  D   +  ++ +    L+
Sbjct: 1  MARRCEICGKRAQVGYKVSHSHIRTKKKWNPNIQRVKVYVD--GKVKRMNVCTQCLK 55


>gi|291533320|emb|CBL06433.1| LSU ribosomal protein L28P [Megamonas hypermegale ART12/1]
          Length = 62

 Score = 66.2 bits (161), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 18/58 (31%), Positives = 33/58 (56%), Gaps = 2/58 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS 58
          M+ VCE+  K   +G  VSH++ KT+R + PN+ R+  + D   +  ++ +    +RS
Sbjct: 1  MANVCEICAKGERAGMNVSHSHLKTKRTWKPNIQRVRAVVD--GEVKRVNVCTSCMRS 56


>gi|262341283|ref|YP_003284138.1| 50S ribosomal protein L28 [Blattabacterium sp. (Blattella
          germanica) str. Bge]
 gi|262272620|gb|ACY40528.1| 50S ribosomal protein L28 [Blattabacterium sp. (Blattella
          germanica) str. Bge]
          Length = 76

 Score = 66.2 bits (161), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 29/63 (46%), Positives = 40/63 (63%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS+VCELT K  M GNKVSHANNK +RRF  NLC+     +  ++   L+I   A++ + 
Sbjct: 1  MSKVCELTGKKAMIGNKVSHANNKKKRRFNINLCKKRFFFNKRKKWITLKICAYAVKIIN 60

Query: 61 RQG 63
          + G
Sbjct: 61 KIG 63


>gi|307297644|ref|ZP_07577450.1| ribosomal protein L28 [Thermotogales bacterium mesG1.Ag.4.2]
 gi|306916904|gb|EFN47286.1| ribosomal protein L28 [Thermotogales bacterium mesG1.Ag.4.2]
          Length = 63

 Score = 66.2 bits (161), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 19/57 (33%), Positives = 35/57 (61%), Gaps = 2/57 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALR 57
          MS+VCE+  K+  +GN VSH+N K +R + PN+ ++  + D   +  ++R+    L+
Sbjct: 1  MSKVCEICGKSPTTGNMVSHSNKKAKRWWKPNVHKVRAVVD--GEVKRIRVCAKCLK 55


>gi|19704769|ref|NP_604331.1| 50S ribosomal protein L28P [Fusobacterium nucleatum subsp.
          nucleatum ATCC 25586]
 gi|254303981|ref|ZP_04971339.1| ribosomal protein L28 [Fusobacterium nucleatum subsp. polymorphum
          ATCC 10953]
 gi|296327748|ref|ZP_06870287.1| 50S ribosomal protein L28 [Fusobacterium nucleatum subsp.
          nucleatum ATCC 23726]
 gi|22096047|sp|Q8RDR9|RL28_FUSNN RecName: Full=50S ribosomal protein L28
 gi|19715099|gb|AAL95630.1| LSU ribosomal protein L28P [Fusobacterium nucleatum subsp.
          nucleatum ATCC 25586]
 gi|148324173|gb|EDK89423.1| ribosomal protein L28 [Fusobacterium nucleatum subsp. polymorphum
          ATCC 10953]
 gi|296155095|gb|EFG95873.1| 50S ribosomal protein L28 [Fusobacterium nucleatum subsp.
          nucleatum ATCC 23726]
          Length = 85

 Score = 66.2 bits (161), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 20/82 (24%), Positives = 44/82 (53%), Gaps = 3/82 (3%)

Query: 3  RVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQ 62
          + CE+T   ++SGN++SH++  TRR + PNL   TL+ +      ++++    L++++  
Sbjct: 2  QRCEITGTGLISGNQISHSHRLTRRVWKPNLQVTTLVVN--GSPIKVKVCARTLKTLKGA 59

Query: 63 GGLDRF-LSNSKKENLSARMRT 83
            ++   +  +    LS R+  
Sbjct: 60 SEVEVMRILKANIATLSERLLK 81


>gi|257458127|ref|ZP_05623281.1| ribosomal protein L28 [Treponema vincentii ATCC 35580]
 gi|257444421|gb|EEV19510.1| ribosomal protein L28 [Treponema vincentii ATCC 35580]
          Length = 63

 Score = 65.8 bits (160), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 20/58 (34%), Positives = 31/58 (53%), Gaps = 2/58 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS 58
          M+R C++  K  MSGN VS + N  RR + PNL  +    +I  +   L++    L+S
Sbjct: 1  MARRCDICGKGPMSGNTVSKSMNHQRRVWRPNLIDVKT--EIDGRTLTLKLCSRCLKS 56


>gi|237739403|ref|ZP_04569884.1| LSU ribosomal protein L28P [Fusobacterium sp. 2_1_31]
 gi|262066263|ref|ZP_06025875.1| 50S ribosomal protein L28 [Fusobacterium periodonticum ATCC
          33693]
 gi|294783599|ref|ZP_06748923.1| 50S ribosomal protein L28 [Fusobacterium sp. 1_1_41FAA]
 gi|229423011|gb|EEO38058.1| LSU ribosomal protein L28P [Fusobacterium sp. 2_1_31]
 gi|291380033|gb|EFE87551.1| 50S ribosomal protein L28 [Fusobacterium periodonticum ATCC
          33693]
 gi|294480477|gb|EFG28254.1| 50S ribosomal protein L28 [Fusobacterium sp. 1_1_41FAA]
          Length = 85

 Score = 65.8 bits (160), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 20/82 (24%), Positives = 43/82 (52%), Gaps = 3/82 (3%)

Query: 3  RVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQ 62
          + CE+T   ++SGN++SH++  TRR + PNL   TL  +      ++++    L++++  
Sbjct: 2  QRCEITGTGLISGNQISHSHRLTRRVWKPNLQVTTLNVN--GSPIKVKVCARTLKTLKGA 59

Query: 63 GGLDRF-LSNSKKENLSARMRT 83
            ++   +  +    LS R+  
Sbjct: 60 SEVEVMRILKANIATLSERLLK 81


>gi|35214411|dbj|BAC91779.1| 50S ribosomal protein L28 [Gloeobacter violaceus PCC 7421]
          Length = 84

 Score = 65.8 bits (160), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 17/62 (27%), Positives = 32/62 (51%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR C LT K   +   VS ++ + +R  + NL    +  D      +L++S  A++++E
Sbjct: 4  MSRKCMLTGKKANNAYSVSFSHRRNKRLQMANLQWKRIWDDQQGCFVRLKLSTKAIKTLE 63

Query: 61 RQ 62
           +
Sbjct: 64 HR 65


>gi|15839485|ref|NP_334522.1| 50S ribosomal protein L28 [Mycobacterium tuberculosis CDC1551]
 gi|31791283|ref|NP_853776.1| 50S ribosomal protein L28 [Mycobacterium bovis AF2122/97]
 gi|57116690|ref|YP_177691.1| 50S ribosomal protein L28 [Mycobacterium tuberculosis H37Rv]
 gi|121636018|ref|YP_976241.1| 50S ribosomal protein L28 [Mycobacterium bovis BCG str. Pasteur
          1173P2]
 gi|148659868|ref|YP_001281391.1| 50S ribosomal protein L28 [Mycobacterium tuberculosis H37Ra]
 gi|148821297|ref|YP_001286051.1| 50S ribosomal protein L28 [Mycobacterium tuberculosis F11]
 gi|167968262|ref|ZP_02550539.1| 50S ribosomal protein L28 [Mycobacterium tuberculosis H37Ra]
 gi|215406093|ref|ZP_03418274.1| 50S ribosomal protein L28 [Mycobacterium tuberculosis 02_1987]
 gi|215413961|ref|ZP_03422623.1| 50S ribosomal protein L28 [Mycobacterium tuberculosis 94_M4241A]
 gi|215425303|ref|ZP_03423222.1| 50S ribosomal protein L28 [Mycobacterium tuberculosis T92]
 gi|215433022|ref|ZP_03430941.1| 50S ribosomal protein L28 [Mycobacterium tuberculosis EAS054]
 gi|215448381|ref|ZP_03435133.1| 50S ribosomal protein L28 [Mycobacterium tuberculosis T85]
 gi|218755832|ref|ZP_03534628.1| 50S ribosomal protein L28 [Mycobacterium tuberculosis GM 1503]
 gi|219555890|ref|ZP_03534966.1| 50S ribosomal protein L28 [Mycobacterium tuberculosis T17]
 gi|224988491|ref|YP_002643178.1| 50S ribosomal protein L28 [Mycobacterium bovis BCG str. Tokyo
          172]
 gi|253797023|ref|YP_003030024.1| 50S ribosomal protein rpmB1 [Mycobacterium tuberculosis KZN 1435]
 gi|254233499|ref|ZP_04926825.1| 50S ribosomal protein L28-1 rpmB1 [Mycobacterium tuberculosis C]
 gi|254366561|ref|ZP_04982605.1| 50S ribosomal protein L28-1 rpmB1 [Mycobacterium tuberculosis
          str. Haarlem]
 gi|254549039|ref|ZP_05139486.1| 50S ribosomal protein L28 [Mycobacterium tuberculosis '98-R604
          INH-RIF-EM']
 gi|260184961|ref|ZP_05762435.1| 50S ribosomal protein L28 [Mycobacterium tuberculosis CPHL_A]
 gi|260199100|ref|ZP_05766591.1| 50S ribosomal protein L28 [Mycobacterium tuberculosis T46]
 gi|260203249|ref|ZP_05770740.1| 50S ribosomal protein L28 [Mycobacterium tuberculosis K85]
 gi|289441474|ref|ZP_06431218.1| 50S ribosomal protein rpmB1 [Mycobacterium tuberculosis T46]
 gi|289445635|ref|ZP_06435379.1| 50S ribosomal protein rpmB1 [Mycobacterium tuberculosis CPHL_A]
 gi|289552356|ref|ZP_06441566.1| 50S ribosomal protein rpmB1 [Mycobacterium tuberculosis KZN 605]
 gi|289567997|ref|ZP_06448224.1| 50S ribosomal protein rpmB1 [Mycobacterium tuberculosis T17]
 gi|289572685|ref|ZP_06452912.1| 50S ribosomal protein rpmB1 [Mycobacterium tuberculosis K85]
 gi|289747872|ref|ZP_06507250.1| 50S ribosomal protein rpmB1 [Mycobacterium tuberculosis 02_1987]
 gi|289748575|ref|ZP_06507953.1| 50S ribosomal protein L28 rpmB1 [Mycobacterium tuberculosis T92]
 gi|289756167|ref|ZP_06515545.1| 50S ribosomal protein rpmB1 [Mycobacterium tuberculosis EAS054]
 gi|289760205|ref|ZP_06519583.1| ribosomal protein L28 [Mycobacterium tuberculosis T85]
 gi|289764222|ref|ZP_06523600.1| 50S ribosomal protein rpmB1 [Mycobacterium tuberculosis GM 1503]
 gi|294992949|ref|ZP_06798640.1| 50S ribosomal protein L28 [Mycobacterium tuberculosis 210]
 gi|297632578|ref|ZP_06950358.1| 50S ribosomal protein L28 [Mycobacterium tuberculosis KZN 4207]
 gi|297729552|ref|ZP_06958670.1| 50S ribosomal protein L28 [Mycobacterium tuberculosis KZN R506]
 gi|298527496|ref|ZP_07014905.1| 50S ribosomal protein rpmB1 [Mycobacterium tuberculosis
          94_M4241A]
 gi|306774187|ref|ZP_07412524.1| 50S ribosomal protein L28 rpmB1 [Mycobacterium tuberculosis
          SUMu001]
 gi|306778932|ref|ZP_07417269.1| 50S ribosomal protein L28 rpmB1 [Mycobacterium tuberculosis
          SUMu002]
 gi|306782721|ref|ZP_07421043.1| 50S ribosomal protein L28 rpmB1 [Mycobacterium tuberculosis
          SUMu003]
 gi|306787088|ref|ZP_07425410.1| 50S ribosomal protein L28 rpmB1 [Mycobacterium tuberculosis
          SUMu004]
 gi|306791645|ref|ZP_07429947.1| 50S ribosomal protein L28 rpmB1 [Mycobacterium tuberculosis
          SUMu005]
 gi|306795707|ref|ZP_07434009.1| 50S ribosomal protein L28 rpmB1 [Mycobacterium tuberculosis
          SUMu006]
 gi|306801682|ref|ZP_07438350.1| 50S ribosomal protein L28 rpmB1 [Mycobacterium tuberculosis
          SUMu008]
 gi|306805894|ref|ZP_07442562.1| 50S ribosomal protein L28 rpmB1 [Mycobacterium tuberculosis
          SUMu007]
 gi|306970290|ref|ZP_07482951.1| 50S ribosomal protein L28 rpmB1 [Mycobacterium tuberculosis
          SUMu009]
 gi|306974523|ref|ZP_07487184.1| 50S ribosomal protein L28 rpmB1 [Mycobacterium tuberculosis
          SUMu010]
 gi|307082231|ref|ZP_07491401.1| 50S ribosomal protein L28 rpmB1 [Mycobacterium tuberculosis
          SUMu011]
 gi|307082574|ref|ZP_07491687.1| 50S ribosomal protein L28 rpmB1 [Mycobacterium tuberculosis
          SUMu012]
 gi|313656879|ref|ZP_07813759.1| 50S ribosomal protein L28 [Mycobacterium tuberculosis KZN V2475]
 gi|61232234|sp|P0A5V6|RL28A_MYCTU RecName: Full=50S ribosomal protein L28-1
 gi|61232241|sp|P0A5V7|RL28A_MYCBO RecName: Full=50S ribosomal protein L28-1
 gi|13879592|gb|AAK44336.1| ribosomal protein L28 [Mycobacterium tuberculosis CDC1551]
 gi|31616868|emb|CAD92970.1| PROBABLE 50S RIBOSOMAL PROTEIN L28-1 RPMB1 [Mycobacterium bovis
          AF2122/97]
 gi|41352731|emb|CAE55241.1| PROBABLE 50S RIBOSOMAL PROTEIN L28-1 RPMB1 [Mycobacterium
          tuberculosis H37Rv]
 gi|121491665|emb|CAL70123.1| Probable 50s ribosomal protein L28-1 rpmB1 [Mycobacterium bovis
          BCG str. Pasteur 1173P2]
 gi|124603292|gb|EAY61567.1| 50S ribosomal protein L28-1 rpmB1 [Mycobacterium tuberculosis C]
 gi|134152073|gb|EBA44118.1| 50S ribosomal protein L28-1 rpmB1 [Mycobacterium tuberculosis
          str. Haarlem]
 gi|148504020|gb|ABQ71829.1| ribosomal protein L28 [Mycobacterium tuberculosis H37Ra]
 gi|148719824|gb|ABR04449.1| 50S ribosomal protein L28-1 rpmB1 [Mycobacterium tuberculosis
          F11]
 gi|224771604|dbj|BAH24410.1| 50S ribosomal protein L28 [Mycobacterium bovis BCG str. Tokyo
          172]
 gi|253318526|gb|ACT23129.1| 50S ribosomal protein rpmB1 [Mycobacterium tuberculosis KZN 1435]
 gi|289414393|gb|EFD11633.1| 50S ribosomal protein rpmB1 [Mycobacterium tuberculosis T46]
 gi|289418593|gb|EFD15794.1| 50S ribosomal protein rpmB1 [Mycobacterium tuberculosis CPHL_A]
 gi|289436988|gb|EFD19481.1| 50S ribosomal protein rpmB1 [Mycobacterium tuberculosis KZN 605]
 gi|289537116|gb|EFD41694.1| 50S ribosomal protein rpmB1 [Mycobacterium tuberculosis K85]
 gi|289541750|gb|EFD45399.1| 50S ribosomal protein rpmB1 [Mycobacterium tuberculosis T17]
 gi|289688400|gb|EFD55888.1| 50S ribosomal protein rpmB1 [Mycobacterium tuberculosis 02_1987]
 gi|289689162|gb|EFD56591.1| 50S ribosomal protein L28 rpmB1 [Mycobacterium tuberculosis T92]
 gi|289696754|gb|EFD64183.1| 50S ribosomal protein rpmB1 [Mycobacterium tuberculosis EAS054]
 gi|289711728|gb|EFD75744.1| 50S ribosomal protein rpmB1 [Mycobacterium tuberculosis GM 1503]
 gi|289715769|gb|EFD79781.1| ribosomal protein L28 [Mycobacterium tuberculosis T85]
 gi|298497290|gb|EFI32584.1| 50S ribosomal protein rpmB1 [Mycobacterium tuberculosis
          94_M4241A]
 gi|308217225|gb|EFO76624.1| 50S ribosomal protein L28 rpmB1 [Mycobacterium tuberculosis
          SUMu001]
 gi|308328084|gb|EFP16935.1| 50S ribosomal protein L28 rpmB1 [Mycobacterium tuberculosis
          SUMu002]
 gi|308332428|gb|EFP21279.1| 50S ribosomal protein L28 rpmB1 [Mycobacterium tuberculosis
          SUMu003]
 gi|308336222|gb|EFP25073.1| 50S ribosomal protein L28 rpmB1 [Mycobacterium tuberculosis
          SUMu004]
 gi|308339823|gb|EFP28674.1| 50S ribosomal protein L28 rpmB1 [Mycobacterium tuberculosis
          SUMu005]
 gi|308343817|gb|EFP32668.1| 50S ribosomal protein L28 rpmB1 [Mycobacterium tuberculosis
          SUMu006]
 gi|308347601|gb|EFP36452.1| 50S ribosomal protein L28 rpmB1 [Mycobacterium tuberculosis
          SUMu007]
 gi|308351543|gb|EFP40394.1| 50S ribosomal protein L28 rpmB1 [Mycobacterium tuberculosis
          SUMu008]
 gi|308352227|gb|EFP41078.1| 50S ribosomal protein L28 rpmB1 [Mycobacterium tuberculosis
          SUMu009]
 gi|308356161|gb|EFP45012.1| 50S ribosomal protein L28 rpmB1 [Mycobacterium tuberculosis
          SUMu010]
 gi|308360132|gb|EFP48983.1| 50S ribosomal protein L28 rpmB1 [Mycobacterium tuberculosis
          SUMu011]
 gi|308367696|gb|EFP56547.1| 50S ribosomal protein L28 rpmB1 [Mycobacterium tuberculosis
          SUMu012]
 gi|326905864|gb|EGE52797.1| 50S ribosomal protein rpmB1 [Mycobacterium tuberculosis W-148]
 gi|328456812|gb|AEB02235.1| 50S ribosomal protein rpmB1 [Mycobacterium tuberculosis KZN 4207]
          Length = 94

 Score = 65.8 bits (160), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 18/59 (30%), Positives = 35/59 (59%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSV 59
          MS  C++T +TV  G  VSH++ +TRRR+ PN+          +++ ++R+S   ++ +
Sbjct: 1  MSARCQITGRTVGFGKAVSHSHRRTRRRWPPNIQLKAYYLPSEDRRIKVRVSAQGIKVI 59


>gi|152993734|ref|YP_001359455.1| 50S ribosomal protein L28 [Sulfurovum sp. NBC37-1]
 gi|166228165|sp|A6QC89|RL28_SULNB RecName: Full=50S ribosomal protein L28
 gi|151425595|dbj|BAF73098.1| 50S ribosomal protein L28 [Sulfurovum sp. NBC37-1]
          Length = 69

 Score = 65.8 bits (160), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 23/59 (38%), Positives = 37/59 (62%), Gaps = 1/59 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSV 59
          MSR C ++ K  + GN VSHANNKT+RR LPNL  + +  +      +++++   LR++
Sbjct: 1  MSRRCSVSGKGPLVGNNVSHANNKTKRRQLPNLRSVKITMED-GTTKRVKVAASTLRTM 58


>gi|295696048|ref|YP_003589286.1| ribosomal protein L28 [Bacillus tusciae DSM 2912]
 gi|295411650|gb|ADG06142.1| ribosomal protein L28 [Bacillus tusciae DSM 2912]
          Length = 63

 Score = 65.8 bits (160), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 14/57 (24%), Positives = 35/57 (61%), Gaps = 2/57 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALR 57
          M++ CE+  +   +G+ VSH++  T+RR++PN+ +  + +++     ++R+    L+
Sbjct: 1  MAKRCEICGRGPATGHAVSHSHILTKRRWMPNIHK--IRAEVGGSVRRIRVCARCLK 55


>gi|157738019|ref|YP_001490703.1| 50S ribosomal protein L28 [Arcobacter butzleri RM4018]
 gi|315636360|ref|ZP_07891609.1| 50S ribosomal protein L28 [Arcobacter butzleri JV22]
 gi|166987908|sp|A8EVR0|RL28_ARCB4 RecName: Full=50S ribosomal protein L28
 gi|157699873|gb|ABV68033.1| 50S ribosomal protein L28 [Arcobacter butzleri RM4018]
 gi|315479339|gb|EFU70023.1| 50S ribosomal protein L28 [Arcobacter butzleri JV22]
          Length = 62

 Score = 65.4 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 27/62 (43%), Positives = 39/62 (62%), Gaps = 1/62 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR C ++ K  M GN VSHA N+TRRRFLPN+  + +  +      +LRIS   LR+++
Sbjct: 1  MSRKCAISGKGPMVGNNVSHAKNRTRRRFLPNIRTVRVTLED-GTTTKLRISAKELRTLK 59

Query: 61 RQ 62
          + 
Sbjct: 60 KH 61


>gi|322379605|ref|ZP_08053942.1| 50S ribosomal protein L28 [Helicobacter suis HS1]
 gi|322380994|ref|ZP_08055051.1| 50S ribosomal protein L28 [Helicobacter suis HS5]
 gi|321146579|gb|EFX41422.1| 50S ribosomal protein L28 [Helicobacter suis HS5]
 gi|321147999|gb|EFX42562.1| 50S ribosomal protein L28 [Helicobacter suis HS1]
          Length = 62

 Score = 65.4 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 26/61 (42%), Positives = 41/61 (67%), Gaps = 1/61 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+R C+L+ K  M GN+VSHANNKT+RR LPNL  I +  +    K +++++   LR++ 
Sbjct: 1  MARRCDLSHKGPMVGNRVSHANNKTKRRLLPNLHTIHITLED-GTKQRIKVATSTLRTMR 59

Query: 61 R 61
          +
Sbjct: 60 K 60


>gi|269218659|ref|ZP_06162513.1| conserved domain protein [Actinomyces sp. oral taxon 848 str.
          F0332]
 gi|269211770|gb|EEZ78110.1| conserved domain protein [Actinomyces sp. oral taxon 848 str.
          F0332]
          Length = 97

 Score = 65.4 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 15/56 (26%), Positives = 31/56 (55%), Gaps = 2/56 (3%)

Query: 2  SRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALR 57
          + VCE+  K    G +VSH++ +T RR+ PN+ R+  + +    + ++ +    L+
Sbjct: 34 ASVCEICGKHPSFGKRVSHSHVRTSRRWNPNIQRVRALVN--GARKRVNVCTSCLK 87


>gi|224541308|ref|ZP_03681847.1| hypothetical protein CATMIT_00468 [Catenibacterium mitsuokai DSM
          15897]
 gi|224525745|gb|EEF94850.1| hypothetical protein CATMIT_00468 [Catenibacterium mitsuokai DSM
          15897]
          Length = 65

 Score = 65.4 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 26/61 (42%), Positives = 39/61 (63%), Gaps = 2/61 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR C+L+ K  MSGN  SHA N TRR++  NL + T+I D   +  ++R+S   LR++ 
Sbjct: 5  MSRKCQLSGKGPMSGNNRSHALNATRRKWNVNLQKATVIID--GKPTKVRVSARQLRTLR 62

Query: 61 R 61
          +
Sbjct: 63 K 63


>gi|224436839|ref|ZP_03657828.1| 50S ribosomal protein L28 [Helicobacter cinaedi CCUG 18818]
 gi|313143318|ref|ZP_07805511.1| 50S ribosomal protein L28 [Helicobacter cinaedi CCUG 18818]
 gi|313128349|gb|EFR45966.1| 50S ribosomal protein L28 [Helicobacter cinaedi CCUG 18818]
          Length = 62

 Score = 65.4 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 25/62 (40%), Positives = 38/62 (61%), Gaps = 1/62 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          M+R C  T K  M GN VSHANNKT++R LPNL  I L  +      +++++   LR+++
Sbjct: 1  MARKCFFTGKGPMVGNNVSHANNKTKKRSLPNLRSIRLKLED-GSSIRVKVAASTLRTLK 59

Query: 61 RQ 62
          + 
Sbjct: 60 KH 61


>gi|330318732|gb|AEC11026.1| 50S ribosomal protein L28 [Camellia sinensis]
          Length = 74

 Score = 65.4 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 21/68 (30%), Positives = 37/68 (54%), Gaps = 1/68 (1%)

Query: 5  CELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGG 64
          C  T K     NKVSH+N+KT++    NL    +  +  ++  +LR+S  A++++E+ G 
Sbjct: 1  CPFTGKKSNRANKVSHSNHKTKKLQFVNLQYKRIWWEAGKRYVKLRLSTKAIKTIEKNG- 59

Query: 65 LDRFLSNS 72
          LD     +
Sbjct: 60 LDAVAKKA 67


>gi|203284266|ref|YP_002222006.1| 50S ribosomal protein L28 [Borrelia duttonii Ly]
 gi|203287803|ref|YP_002222818.1| 50S ribosomal protein L28 [Borrelia recurrentis A1]
 gi|226738036|sp|B5RLT4|RL28_BORDL RecName: Full=50S ribosomal protein L28
 gi|226738039|sp|B5RRG3|RL28_BORRA RecName: Full=50S ribosomal protein L28
 gi|201083709|gb|ACH93300.1| 50S ribosomal protein L28 [Borrelia duttonii Ly]
 gi|201085023|gb|ACH94597.1| 50S ribosomal protein L28 [Borrelia recurrentis A1]
          Length = 92

 Score = 65.4 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 27/88 (30%), Positives = 38/88 (43%), Gaps = 14/88 (15%)

Query: 1  MSRVCELTKKTVMSGNKVS-------------HANNKTRRRFLPNLCRITLISDIMEQKY 47
          M R CE+T K  M GN V              H   KT+R F  NL         + +  
Sbjct: 1  MGRECEITGKRTMFGNNVPRKGLAKKKGGAGQHIGVKTKRTFKVNLINKKFFIPELGKNV 60

Query: 48 QLRISKCALRSVERQGGLDRFLSNSKKE 75
           ++IS   LRS+ + G L+ FL  + K+
Sbjct: 61 SIKISASTLRSISKVG-LNVFLKKNNKK 87


>gi|328722845|ref|XP_003247689.1| PREDICTED: 39S ribosomal protein L28, mitochondrial-like
           [Acyrthosiphon pisum]
          Length = 266

 Score = 65.4 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 16/84 (19%), Positives = 39/84 (46%), Gaps = 4/84 (4%)

Query: 13  MSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFLSNS 72
            +GNK     ++    + P L +  + S+I+ +     +++ AL  + +  GLD +L  +
Sbjct: 97  QNGNKY---KSRVPHFWTPTLKKSVVYSEILNEYVSTTVTEKALDLINKNYGLDHYLLKT 153

Query: 73  KKENLSARM-RTLRSQILKKMSEK 95
              +L   +   ++  +L  + +K
Sbjct: 154 AACDLRTTLSLKIKRHLLMALRDK 177


>gi|58267722|ref|XP_571017.1| hypothetical protein [Cryptococcus neoformans var. neoformans
           JEC21]
 gi|134112281|ref|XP_775116.1| hypothetical protein CNBE3900 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|50257768|gb|EAL20469.1| hypothetical protein CNBE3900 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|57227251|gb|AAW43710.1| expressed protein [Cryptococcus neoformans var. neoformans JEC21]
          Length = 213

 Score = 65.4 bits (159), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 23/97 (23%), Positives = 44/97 (45%), Gaps = 14/97 (14%)

Query: 12  VMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISK--------------CALR 57
             SGN    +  KT+R F PNL R+     ++     +  +K                +R
Sbjct: 74  TRSGNNKPKSLQKTKRTFQPNLTRVDWPVTVLGGPVPIDRTKEQSLPKLEGILMQVRKIR 133

Query: 58  SVERQGGLDRFLSNSKKENLSARMRTLRSQILKKMSE 94
            VE+ GG++  L + + ++L+    +LR+Q+ + + E
Sbjct: 134 DVEKAGGIEGLLLSRRSKDLTPYGASLRAQLFESLHE 170


>gi|308272038|emb|CBX28646.1| 50S ribosomal protein L28 [uncultured Desulfobacterium sp.]
          Length = 63

 Score = 65.4 bits (159), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 22/58 (37%), Positives = 31/58 (53%), Gaps = 2/58 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS 58
          MSR+CE+  K  M G  VSHA+N T RRF PNL  +  I        ++ +    ++S
Sbjct: 1  MSRMCEICGKKPMVGKNVSHAHNVTCRRFNPNLQNVRAI--RNGMVKKIVVCTSCIKS 56


>gi|158312983|ref|YP_001505491.1| 50S ribosomal protein L28 [Frankia sp. EAN1pec]
 gi|226694807|sp|A8L585|RL28_FRASN RecName: Full=50S ribosomal protein L28
 gi|158108388|gb|ABW10585.1| ribosomal protein L28 [Frankia sp. EAN1pec]
          Length = 62

 Score = 65.1 bits (158), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 17/57 (29%), Positives = 30/57 (52%), Gaps = 2/57 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALR 57
          MS VC++  K    G  VSH++ +TRRR+ PN+  +  +     +  +L +    L+
Sbjct: 1  MSSVCDVCGKGPGFGMSVSHSHRRTRRRWNPNIQTVRAMVGRTPR--RLNVCTSCLK 55


>gi|197260788|gb|ACH56894.1| mitochondrial ribosomal protein L28 [Simulium vittatum]
          Length = 282

 Score = 65.1 bits (158), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 12/90 (13%), Positives = 39/90 (43%), Gaps = 2/90 (2%)

Query: 7   LTKKTVMSG-NKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGL 65
              + ++ G  K +    +    ++P L R  + S+++ +   + ++   +  +    G 
Sbjct: 87  WGGEGIVKGFQKRTPYKRRVPHFWVPVLRRSVVYSEVLNEYLSVIVTDRTIDLIHECHGF 146

Query: 66  DRFLSNSKKENLSAR-MRTLRSQILKKMSE 94
           D +L  +   +L +R    ++ ++L  + +
Sbjct: 147 DHYLLKTPACDLRSRLALQIKRRVLANLQD 176


>gi|152965335|ref|YP_001361119.1| 50S ribosomal protein L28 [Kineococcus radiotolerans SRS30216]
 gi|151359852|gb|ABS02855.1| ribosomal protein L28 [Kineococcus radiotolerans SRS30216]
          Length = 61

 Score = 65.1 bits (158), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 16/57 (28%), Positives = 28/57 (49%), Gaps = 2/57 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALR 57
          M+  C++  K    G  VSH++ +T R +LPN+ RI    +      +L +    L+
Sbjct: 1  MAATCDVCAKGPGFGKSVSHSHRRTNRMWLPNIQRIRATVN--GSPKRLNVCTSCLK 55


>gi|296273765|ref|YP_003656396.1| 50S ribosomal protein L28 [Arcobacter nitrofigilis DSM 7299]
 gi|296097939|gb|ADG93889.1| ribosomal protein L28 [Arcobacter nitrofigilis DSM 7299]
          Length = 62

 Score = 65.1 bits (158), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 27/62 (43%), Positives = 40/62 (64%), Gaps = 1/62 (1%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MSR C ++ K  MSGN VSHA N+T+RRFLPNL  + +  D      +++IS   LR+++
Sbjct: 1  MSRRCAISGKGPMSGNNVSHAKNRTKRRFLPNLRTVRVTLDD-GTTQKIKISAKELRTLK 59

Query: 61 RQ 62
          + 
Sbjct: 60 KN 61


>gi|271969204|ref|YP_003343400.1| 50S ribosomal protein L28P [Streptosporangium roseum DSM 43021]
 gi|270512379|gb|ACZ90657.1| LSU ribosomal protein L28P [Streptosporangium roseum DSM 43021]
          Length = 61

 Score = 65.1 bits (158), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 16/57 (28%), Positives = 32/57 (56%), Gaps = 2/57 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALR 57
          M+ VC++  K    GN VSH++ +TRRR+ PN+  +  + +   +  +L +    ++
Sbjct: 1  MASVCDVCAKKPTFGNNVSHSHRRTRRRWNPNIQPVRAVVNGTPK--RLNVCTSCIK 55


>gi|195437414|ref|XP_002066635.1| GK24462 [Drosophila willistoni]
 gi|194162720|gb|EDW77621.1| GK24462 [Drosophila willistoni]
          Length = 302

 Score = 65.1 bits (158), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 19/93 (20%), Positives = 44/93 (47%), Gaps = 8/93 (8%)

Query: 7   LTKKTVMSGNKVSHANNKTRRR----FLPNLCRITLISDIMEQKYQLRISKCALRSVERQ 62
              + V+ G +  H   +T+RR    ++P L R  + S ++ +   + +++  L  +   
Sbjct: 87  WGGEAVIKGFQKRH---QTKRRVPHFWVPQLKRSVVHSQVLNEYMSVVVTERTLEQIHEC 143

Query: 63  GGLDRFLSNSKKENL-SARMRTLRSQILKKMSE 94
            G D +L  +   +L SA    ++ Q+L+ + +
Sbjct: 144 HGFDHYLLKNLACDLRSALALKMKRQVLQALQQ 176


>gi|68072487|ref|XP_678157.1| hypothetical protein [Plasmodium berghei strain ANKA]
 gi|56498535|emb|CAH93617.1| conserved hypothetical protein [Plasmodium berghei]
          Length = 280

 Score = 65.1 bits (158), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 22/74 (29%), Positives = 41/74 (55%), Gaps = 3/74 (4%)

Query: 17  KVSHANNKTRRRFLPNLCRITLISDIMEQKY-QLRISKCALRSVERQGGLDRFLSNSKKE 75
           KVS++  KTR +  PN+ +  ++S+I+      +RI+  AL +++  GG D ++  +  E
Sbjct: 60  KVSYSLKKTRIKIKPNVFKKHIVSNILNTIIPSVRITT-ALHAIDDAGGFDNYILRTPPE 118

Query: 76  NL-SARMRTLRSQI 88
            L S     LR+ +
Sbjct: 119 ELRSNFGEKLRNVM 132


>gi|114566296|ref|YP_753450.1| 50S ribosomal protein L28 [Syntrophomonas wolfei subsp. wolfei
          str. Goettingen]
 gi|122318621|sp|Q0AYX5|RL28_SYNWW RecName: Full=50S ribosomal protein L28
 gi|114337231|gb|ABI68079.1| LSU ribosomal protein L28P [Syntrophomonas wolfei subsp. wolfei
          str. Goettingen]
          Length = 62

 Score = 65.1 bits (158), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 17/58 (29%), Positives = 32/58 (55%), Gaps = 3/58 (5%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS 58
          M++ C++  K V  G K SH++ +T R++ PN+  +  I D   +  ++ +    LRS
Sbjct: 1  MAK-CDICGKGVGFGKKYSHSHIRTNRQWKPNIQPVKAIVDGTPK--KIYVCTRCLRS 55


>gi|197123014|ref|YP_002134965.1| 50S ribosomal protein L28 [Anaeromyxobacter sp. K]
 gi|220917804|ref|YP_002493108.1| ribosomal protein L28 [Anaeromyxobacter dehalogenans 2CP-1]
 gi|226738026|sp|B4UGY2|RL28_ANASK RecName: Full=50S ribosomal protein L28
 gi|254801495|sp|B8JDJ3|RL28_ANAD2 RecName: Full=50S ribosomal protein L28
 gi|196172863|gb|ACG73836.1| ribosomal protein L28 [Anaeromyxobacter sp. K]
 gi|219955658|gb|ACL66042.1| ribosomal protein L28 [Anaeromyxobacter dehalogenans 2CP-1]
          Length = 73

 Score = 65.1 bits (158), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 29/57 (50%), Gaps = 2/57 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALR 57
          M+R CE+  K  + GN VSHANNK + R LPNL  +        +  +  +    L+
Sbjct: 1  MARRCEICGKGPLVGNTVSHANNKNKTRSLPNLRSVRANLAGEIRHIR--VCTRCLK 55


>gi|256372290|ref|YP_003110114.1| ribosomal protein L28 [Acidimicrobium ferrooxidans DSM 10331]
 gi|256008874|gb|ACU54441.1| ribosomal protein L28 [Acidimicrobium ferrooxidans DSM 10331]
          Length = 62

 Score = 65.1 bits (158), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 19/57 (33%), Positives = 33/57 (57%), Gaps = 2/57 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALR 57
          M+ VCE+  K    G K+SH++ +T+RRFLPN+ R+ ++     +  +  +    LR
Sbjct: 1  MASVCEICGKGPRVGMKLSHSHRRTKRRFLPNVQRVRVLEGATTR--RRFVCTSCLR 55


>gi|156743829|ref|YP_001433958.1| 50S ribosomal protein L28 [Roseiflexus castenholzii DSM 13941]
 gi|156235157|gb|ABU59940.1| ribosomal protein L28 [Roseiflexus castenholzii DSM 13941]
          Length = 91

 Score = 65.1 bits (158), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 26/89 (29%), Positives = 41/89 (46%), Gaps = 13/89 (14%)

Query: 1  MSRVCELTKKTVMSGNKVSHANN--------KTRRRFLPNLCRITLISDIMEQKYQLRIS 52
          M++ C+LT K V  G  + H  +        KT R F PN+ R T+    + Q   L +S
Sbjct: 1  MAK-CDLTGKKVAFGRNIRHKASGGWARRAPKTNRTFRPNVHRHTIYVPEIGQSVTLNLS 59

Query: 53 KCALRSVERQGGLDRFLSNSKKENLSARM 81
            ALR + ++G     L+  + + LS   
Sbjct: 60 TKALRIINKKG----LLAAVRDQRLSVEA 84


>gi|237745230|ref|ZP_04575711.1| LSU ribosomal protein L28P [Fusobacterium sp. 7_1]
 gi|256026665|ref|ZP_05440499.1| 50S ribosomal protein L28P [Fusobacterium sp. D11]
 gi|260495477|ref|ZP_05815603.1| ribosomal protein L28 [Fusobacterium sp. 3_1_33]
 gi|289764663|ref|ZP_06524041.1| LSU ribosomal protein L28P [Fusobacterium sp. D11]
 gi|229432459|gb|EEO42671.1| LSU ribosomal protein L28P [Fusobacterium sp. 7_1]
 gi|260197014|gb|EEW94535.1| ribosomal protein L28 [Fusobacterium sp. 3_1_33]
 gi|289716218|gb|EFD80230.1| LSU ribosomal protein L28P [Fusobacterium sp. D11]
          Length = 85

 Score = 65.1 bits (158), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 21/82 (25%), Positives = 44/82 (53%), Gaps = 3/82 (3%)

Query: 3  RVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQ 62
          + CE+T   ++SGNK+SH++  TRR + PNL   TL+ +      ++++    L++++  
Sbjct: 2  QRCEITGTGLISGNKISHSHRLTRRVWKPNLQVTTLLVN--GSPIKVKVCARTLKTLKGA 59

Query: 63 GGLDRF-LSNSKKENLSARMRT 83
            ++   +  +    LS R+  
Sbjct: 60 SEVEVMRILKANIATLSERLLK 81


>gi|195161266|ref|XP_002021489.1| GL26538 [Drosophila persimilis]
 gi|198472480|ref|XP_001355947.2| GA17686 [Drosophila pseudoobscura pseudoobscura]
 gi|194103289|gb|EDW25332.1| GL26538 [Drosophila persimilis]
 gi|198139032|gb|EAL33006.2| GA17686 [Drosophila pseudoobscura pseudoobscura]
          Length = 301

 Score = 65.1 bits (158), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 20/93 (21%), Positives = 42/93 (45%), Gaps = 8/93 (8%)

Query: 7   LTKKTVMSGNKVSHANNKTRRR----FLPNLCRITLISDIMEQKYQLRISKCALRSVERQ 62
              + V+ G +      +T+RR    ++P L R  + S ++ +   + +++ AL  +   
Sbjct: 87  WGGEAVIKGFQ---KRQQTKRRVPHFWVPQLRRSVVHSQVLNEYISVIVTERALEQIHEC 143

Query: 63  GGLDRFLSNSKKENL-SARMRTLRSQILKKMSE 94
            G D +L  +   +L SA    L+ Q+L  +  
Sbjct: 144 HGFDHYLLKNLACDLRSALALKLKRQLLLSLQA 176


>gi|195114360|ref|XP_002001735.1| GI15386 [Drosophila mojavensis]
 gi|193912310|gb|EDW11177.1| GI15386 [Drosophila mojavensis]
          Length = 300

 Score = 65.1 bits (158), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 20/92 (21%), Positives = 42/92 (45%), Gaps = 8/92 (8%)

Query: 7   LTKKTVMSGNKVSHANNKTRRR----FLPNLCRITLISDIMEQKYQLRISKCALRSVERQ 62
              + V+ G +   +   T+RR    ++P L R  + S ++ +   + +++  L  +   
Sbjct: 87  WGGEAVIKGFQKRES---TKRRVPHFWVPTLRRSVVHSQVLNEYMSVVVTERTLEQIHEC 143

Query: 63  GGLDRFLSNSKKENL-SARMRTLRSQILKKMS 93
            G D +L  +   +L SA    L+ +ILK + 
Sbjct: 144 HGFDHYLLKNLACDLRSALALKLKRKILKSLQ 175


>gi|227548276|ref|ZP_03978325.1| 50S ribosomal protein L28 [Corynebacterium lipophiloflavum DSM
          44291]
 gi|227079594|gb|EEI17557.1| 50S ribosomal protein L28 [Corynebacterium lipophiloflavum DSM
          44291]
          Length = 78

 Score = 65.1 bits (158), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 17/63 (26%), Positives = 31/63 (49%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
          MS  C++T +    G  VSH++ +  RR+ PN+ +         +   L +S   L+ ++
Sbjct: 1  MSAYCQVTGRQPSFGKTVSHSHRRHSRRWNPNVQKKRFYLPSEGRTITLNVSTKGLKIID 60

Query: 61 RQG 63
          R G
Sbjct: 61 RDG 63


>gi|169824369|ref|YP_001691980.1| 50S ribosomal protein L28 [Finegoldia magna ATCC 29328]
 gi|297588347|ref|ZP_06946990.1| 50S ribosomal protein L28 [Finegoldia magna ATCC 53516]
 gi|302380685|ref|ZP_07269150.1| ribosomal protein L28 [Finegoldia magna ACS-171-V-Col3]
 gi|303233883|ref|ZP_07320532.1| ribosomal protein L28 [Finegoldia magna BVS033A4]
 gi|254801361|sp|B0S150|RL28_FINM2 RecName: Full=50S ribosomal protein L28
 gi|167831174|dbj|BAG08090.1| 50S ribosomal protein L28 [Finegoldia magna ATCC 29328]
 gi|297573720|gb|EFH92441.1| 50S ribosomal protein L28 [Finegoldia magna ATCC 53516]
 gi|302311628|gb|EFK93644.1| ribosomal protein L28 [Finegoldia magna ACS-171-V-Col3]
 gi|302494808|gb|EFL54565.1| ribosomal protein L28 [Finegoldia magna BVS033A4]
          Length = 71

 Score = 64.7 bits (157), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 15/58 (25%), Positives = 29/58 (50%), Gaps = 2/58 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS 58
          MS+ CE+  K+   GN  S +   + R + PN+ ++  + D   +  ++ +    LRS
Sbjct: 1  MSKKCEICGKSRTFGNNRSFSLRSSNRSWAPNIRKVRALVD--GKPKRINVCTRCLRS 56


>gi|1903348|gb|AAB70428.1| Strong similarity to 50S ribosomal protein L28 (gb|X68078)
          [Arabidopsis thaliana]
          Length = 81

 Score = 64.7 bits (157), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 21/62 (33%), Positives = 35/62 (56%)

Query: 2  SRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVER 61
          SR+C  T K     NKVS +N+KT++    NL    +  +  ++   LR+S  AL+++E+
Sbjct: 5  SRICPFTGKKANRANKVSFSNHKTKKLQFVNLQYKRVWWEAGKRFVILRLSTKALKTIEK 64

Query: 62 QG 63
           G
Sbjct: 65 NG 66


>gi|332297429|ref|YP_004439351.1| 50S ribosomal protein L28 [Treponema brennaborense DSM 12168]
 gi|332180532|gb|AEE16220.1| 50S ribosomal protein L28 [Treponema brennaborense DSM 12168]
          Length = 63

 Score = 64.7 bits (157), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 21/58 (36%), Positives = 34/58 (58%), Gaps = 2/58 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS 58
          MSR C++  K  +SGNKVS + N TRR + PN+  + + ++I      +++    LRS
Sbjct: 1  MSRRCDICGKGSLSGNKVSKSYNHTRRTWKPNI--VEVKTEIGGTAMTIKMCTRCLRS 56


>gi|294791989|ref|ZP_06757137.1| ribosomal protein L28 [Veillonella sp. 6_1_27]
 gi|294793853|ref|ZP_06758990.1| ribosomal protein L28 [Veillonella sp. 3_1_44]
 gi|313893258|ref|ZP_07826833.1| ribosomal protein L28 [Veillonella sp. oral taxon 158 str. F0412]
 gi|294455423|gb|EFG23795.1| ribosomal protein L28 [Veillonella sp. 3_1_44]
 gi|294457219|gb|EFG25581.1| ribosomal protein L28 [Veillonella sp. 6_1_27]
 gi|313442154|gb|EFR60571.1| ribosomal protein L28 [Veillonella sp. oral taxon 158 str. F0412]
          Length = 62

 Score = 64.7 bits (157), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 18/58 (31%), Positives = 33/58 (56%), Gaps = 2/58 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS 58
          M+ +CE+  K+  SG  VSH++ +TR+ + PN+ R+  + D      ++ +    LRS
Sbjct: 1  MANLCEVCGKSTSSGMNVSHSHIRTRKTWKPNIQRVRAVVD--GATKKVNVCTRCLRS 56


>gi|237742534|ref|ZP_04573015.1| LSU ribosomal protein L28P [Fusobacterium sp. 4_1_13]
 gi|256845871|ref|ZP_05551329.1| ribosomal protein L28 [Fusobacterium sp. 3_1_36A2]
 gi|229430182|gb|EEO40394.1| LSU ribosomal protein L28P [Fusobacterium sp. 4_1_13]
 gi|256719430|gb|EEU32985.1| ribosomal protein L28 [Fusobacterium sp. 3_1_36A2]
          Length = 85

 Score = 64.7 bits (157), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 20/82 (24%), Positives = 43/82 (52%), Gaps = 3/82 (3%)

Query: 3  RVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQ 62
          + CE+T   ++SGN++SH++  TRR + PNL   TL+ +      ++++    L++++  
Sbjct: 2  QRCEITGTGLISGNQISHSHRLTRRVWKPNLQVTTLVVN--GSPIKVKVCARTLKTLKGA 59

Query: 63 GGLDRF-LSNSKKENLSARMRT 83
             +   +  +    LS R+  
Sbjct: 60 SETEVMRILKANIATLSERLLK 81


>gi|86742289|ref|YP_482689.1| 50S ribosomal protein L28 [Frankia sp. CcI3]
 gi|123737112|sp|Q2J6Y2|RL28_FRASC RecName: Full=50S ribosomal protein L28
 gi|86569151|gb|ABD12960.1| LSU ribosomal protein L28P [Frankia sp. CcI3]
          Length = 62

 Score = 64.7 bits (157), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 16/57 (28%), Positives = 30/57 (52%), Gaps = 2/57 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALR 57
          MS VC++  K    G  VSH++ +TRRR+ PN+  +  +     +  +L +    ++
Sbjct: 1  MSSVCDVCGKGPGFGMSVSHSHRRTRRRWNPNIQTVRTVVGGTPK--RLNVCASCIK 55


>gi|187918220|ref|YP_001883783.1| 50S ribosomal protein L28 [Borrelia hermsii DAH]
 gi|226738037|sp|B2S057|RL28_BORHD RecName: Full=50S ribosomal protein L28
 gi|119861068|gb|AAX16863.1| LSU ribosomal protein L28P [Borrelia hermsii DAH]
          Length = 92

 Score = 64.7 bits (157), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 27/85 (31%), Positives = 36/85 (42%), Gaps = 14/85 (16%)

Query: 1  MSRVCELTKKTVMSGNKVS-------------HANNKTRRRFLPNLCRITLISDIMEQKY 47
          M R CE+T K  M GN V              H   KT+R F  NL         + +  
Sbjct: 1  MGRECEITGKRTMFGNNVPRKGLAKKKGGAGQHIGVKTKRTFKVNLINKKFFIPELGKSV 60

Query: 48 QLRISKCALRSVERQGGLDRFLSNS 72
           ++IS  ALRS+ + G L  FL  +
Sbjct: 61 NIKISASALRSISKVG-LSVFLKKN 84


>gi|328955655|ref|YP_004372988.1| LSU ribosomal protein L28P [Coriobacterium glomerans PW2]
 gi|328455979|gb|AEB07173.1| LSU ribosomal protein L28P [Coriobacterium glomerans PW2]
          Length = 62

 Score = 64.7 bits (157), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 18/58 (31%), Positives = 35/58 (60%), Gaps = 2/58 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS 58
          MS+VCE+  K  ++G  +SH++  T R+F PN+ R+ ++ D   +  ++ +    L+S
Sbjct: 1  MSKVCEICGKHPVAGRSISHSHRVTNRKFRPNIQRVHVVMDGHRR--KMNVCTSCLKS 56


>gi|325114357|emb|CBZ49914.1| 50s ribosomal protein L28, related [Neospora caninum Liverpool]
          Length = 271

 Score = 64.7 bits (157), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 21/79 (26%), Positives = 33/79 (41%), Gaps = 4/79 (5%)

Query: 2   SRVCELTKKT-VMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVE 60
           +R C L  K      N  SH+   T +    NL    L         +LR+S   +R+++
Sbjct: 144 ARRCMLLGKMDNTKANNRSHSRVATHKVQRLNLHWKRLWWPEAGYYVRLRLSVKGIRTIK 203

Query: 61  RQG---GLDRFLSNSKKEN 76
           + G     D+F  N KK+ 
Sbjct: 204 KYGLQRAADKFGLNLKKKK 222


>gi|238019124|ref|ZP_04599550.1| hypothetical protein VEIDISOL_00986 [Veillonella dispar ATCC
          17748]
 gi|269798118|ref|YP_003312018.1| ribosomal protein L28 [Veillonella parvula DSM 2008]
 gi|237863823|gb|EEP65113.1| hypothetical protein VEIDISOL_00986 [Veillonella dispar ATCC
          17748]
 gi|269094747|gb|ACZ24738.1| ribosomal protein L28 [Veillonella parvula DSM 2008]
          Length = 62

 Score = 64.7 bits (157), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 18/58 (31%), Positives = 33/58 (56%), Gaps = 2/58 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS 58
          M+ +CE+  K+  SG  VSH++ +TR+ + PN+ R+  + D      ++ +    LRS
Sbjct: 1  MANLCEVCGKSTSSGMNVSHSHIRTRKTWKPNIQRVRAVVD--GATKKVNVCTRCLRS 56


>gi|284047836|ref|YP_003398175.1| ribosomal protein L28 [Acidaminococcus fermentans DSM 20731]
 gi|283952057|gb|ADB46860.1| ribosomal protein L28 [Acidaminococcus fermentans DSM 20731]
          Length = 63

 Score = 64.7 bits (157), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 18/58 (31%), Positives = 31/58 (53%), Gaps = 2/58 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRS 58
          M+ +CE+  K  +SGN VSH+N   +R + PN+ ++  + D   +     +    LRS
Sbjct: 1  MACICEICNKGELSGNNVSHSNRHVKRSWKPNVQKVKAVVDGEVKSI--NVCTRCLRS 56


>gi|289643148|ref|ZP_06475277.1| ribosomal protein L28 [Frankia symbiont of Datisca glomerata]
 gi|289507040|gb|EFD28010.1| ribosomal protein L28 [Frankia symbiont of Datisca glomerata]
          Length = 62

 Score = 64.7 bits (157), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 16/57 (28%), Positives = 30/57 (52%), Gaps = 2/57 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALR 57
          MS VC++  K    G  VSH++ +TRRR+ PN+  +  +     +  +L +    ++
Sbjct: 1  MSSVCDVCGKGPGFGMSVSHSHRRTRRRWNPNIQTVHALVGKTPK--RLNVCTSCIK 55


>gi|302542241|ref|ZP_07294583.1| ribosomal protein L28 [Streptomyces hygroscopicus ATCC 53653]
 gi|307329826|ref|ZP_07608981.1| ribosomal protein L28 [Streptomyces violaceusniger Tu 4113]
 gi|297156907|gb|ADI06619.1| 50S ribosomal protein L28 [Streptomyces bingchenggensis BCW-1]
 gi|302459859|gb|EFL22952.1| ribosomal protein L28 [Streptomyces himastatinicus ATCC 53653]
 gi|306884555|gb|EFN15586.1| ribosomal protein L28 [Streptomyces violaceusniger Tu 4113]
          Length = 61

 Score = 64.7 bits (157), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 14/57 (24%), Positives = 30/57 (52%), Gaps = 2/57 (3%)

Query: 1  MSRVCELTKKTVMSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALR 57
          M+  C++  K    GN +SH++ +TRRR+ PN+  +  +     +  +L +    ++
Sbjct: 1  MAANCDVCGKGPGFGNNISHSHRRTRRRWNPNIQTVRAVVGRTPK--RLNVCTSCIK 55


>gi|239790943|dbj|BAH72000.1| ACYPI007188 [Acyrthosiphon pisum]
          Length = 266

 Score = 64.3 bits (156), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 16/84 (19%), Positives = 39/84 (46%), Gaps = 4/84 (4%)

Query: 13  MSGNKVSHANNKTRRRFLPNLCRITLISDIMEQKYQLRISKCALRSVERQGGLDRFLSNS 72
            +GNK     ++    + P L +  + S+I+ +     +++ AL  + +  GLD +L  +
Sbjct: 97  QNGNKY---KSRVPHFWTPTLKKSVVYSEILNEYMSTTVTEKALDLINKNYGLDHYLLKT 153

Query: 73  KKENLSARM-RTLRSQILKKMSEK 95
              +L   +   ++  +L  + +K
Sbjct: 154 AACDLRTTLSLKIKRHLLMALRDK 177


>gi|237736146|ref|ZP_04566627.1| LSU ribosomal protein L28P [Fusobacterium mortiferum ATCC 9817]
 gi|229421699|gb|EEO36746.1| LSU ribosomal protein L28P [Fusobacterium mortiferum ATCC 9817]