RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780586|ref|YP_003064999.1| BolA family protein [Candidatus Liberibacter asiaticus str. psy62] (101 letters) >gnl|CDD|183243 PRK11628, PRK11628, transcriptional regulator BolA; Provisional. Length = 105 Score = 58.3 bits (141), Expect = 4e-10 Identities = 31/92 (33%), Positives = 49/92 (53%), Gaps = 11/92 (11%) Query: 12 ITEKIRIALSPDDLQVINESHLH---VGHQPQFNGLGETHIRIKIVSPTFTGISKTFRHR 68 I EK+R A P L+V++ES+ H G E+H ++ +VS FTG RHR Sbjct: 7 IEEKLRAAFQPVFLEVVDESYRHNVPAG--------SESHFKVVLVSDRFTGERFLNRHR 58 Query: 69 KIYDLLHKEIKEELHALSIEAFSPDEKHTLKN 100 IY L +E+ +HAL++ ++ E L++ Sbjct: 59 MIYSTLAEELSTTVHALALHTYTIKEWEGLQD 90 >gnl|CDD|180202 PRK05687, fliH, flagellar assembly protein H; Validated. Length = 246 Score = 26.4 bits (59), Expect = 1.9 Identities = 7/20 (35%), Positives = 14/20 (70%), Gaps = 1/20 (5%) Query: 15 KIRIALSPDDLQVINESHLH 34 K ++ ++PDDL+++ E L Sbjct: 177 KPQLRVNPDDLELV-EQLLG 195 >gnl|CDD|162830 TIGR02386, rpoC_TIGR, DNA-directed RNA polymerase, beta' subunit, predominant form. Bacteria have a single DNA-directed RNA polymerase, with required subunits that include alpha, beta, and beta-prime. This model describes the predominant architecture of the beta-prime subunit in most bacteria. This model excludes from among the bacterial mostly sequences from the cyanobacteria, where RpoC is replaced by two tandem genes homologous to it but also encoding an additional domain. Length = 1140 Score = 25.0 bits (55), Expect = 4.6 Identities = 12/33 (36%), Positives = 17/33 (51%), Gaps = 9/33 (27%) Query: 69 KIYDLLHKEIKEE---------LHALSIEAFSP 92 +++D+L IKE LH L I+AF P Sbjct: 389 EVWDVLEDVIKEHPVLLNRAPTLHRLGIQAFEP 421 >gnl|CDD|132590 TIGR03551, F420_cofH, 7,8-didemethyl-8-hydroxy-5-deazariboflavin synthase, CofH subunit. This enzyme, together with CofG, complete the biosynthesis of 7,8-didemethyl-8-hydroxy-5-deazariboflavin synthase, the chromophore of coenzyme F420. The chromophore is also used in cyanobacteria DNA photolyases. Length = 343 Score = 24.2 bits (53), Expect = 7.0 Identities = 9/19 (47%), Positives = 13/19 (68%) Query: 76 KEIKEELHALSIEAFSPDE 94 + +KEE+ + I AFSP E Sbjct: 110 RAVKEEVPGMHIHAFSPME 128 >gnl|CDD|184837 PRK14824, PRK14824, putative deoxyribonucleotide triphosphate pyrophosphatase; Provisional. Length = 201 Score = 24.3 bits (53), Expect = 7.2 Identities = 11/20 (55%), Positives = 13/20 (65%) Query: 76 KEIKEELHALSIEAFSPDEK 95 +EIK L L IE SPD+K Sbjct: 14 REIKRLLSDLGIEVLSPDKK 33 >gnl|CDD|183713 PRK12740, PRK12740, elongation factor G; Reviewed. Length = 668 Score = 24.3 bits (54), Expect = 7.6 Identities = 6/26 (23%), Positives = 11/26 (42%), Gaps = 5/26 (19%) Query: 33 LHVGHQPQFN-----GLGETHIRIKI 53 L V + G+GE H+ + + Sbjct: 417 LRVERDEETGQTILSGMGELHLDVAL 442 >gnl|CDD|129254 TIGR00150, HI0065_YjeE, ATPase, YjeE family. Members of this family have a conserved nucleotide-binding motif GXXGXGKT and a nucleotide-binding fold. Member protein YjeE of Haemophilus influenzae (HI0065) was shown to have ATPase activity. Length = 133 Score = 23.9 bits (52), Expect = 8.5 Identities = 16/49 (32%), Positives = 25/49 (51%), Gaps = 6/49 (12%) Query: 43 GLGETHIRIKIVSPTFTGISK-TFRHRKIY--DLLHKEIKEELHALSIE 88 GLG I+ + SPTFT +++ + +Y DL EEL + +E Sbjct: 45 GLG---IQGNVTSPTFTLVNEYNEGNLMVYHFDLYRLADPEELELMGLE 90 >gnl|CDD|184899 PRK14906, PRK14906, DNA-directed RNA polymerase subunit beta'/alpha domain fusion protein; Provisional. Length = 1460 Score = 24.1 bits (52), Expect = 9.0 Identities = 10/32 (31%), Positives = 17/32 (53%), Gaps = 9/32 (28%) Query: 70 IYDLLHKEIKEE---------LHALSIEAFSP 92 ++D+L + I++ LH L I+AF P Sbjct: 486 VWDVLEEVIQDHPVLLNRAPTLHRLGIQAFEP 517 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.321 0.137 0.398 Gapped Lambda K H 0.267 0.0771 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 1,676,098 Number of extensions: 95679 Number of successful extensions: 214 Number of sequences better than 10.0: 1 Number of HSP's gapped: 213 Number of HSP's successfully gapped: 22 Length of query: 101 Length of database: 5,994,473 Length adjustment: 68 Effective length of query: 33 Effective length of database: 4,525,129 Effective search space: 149329257 Effective search space used: 149329257 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.0 bits)