RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780589|ref|YP_003065002.1| hypothetical protein CLIBASIA_02380 [Candidatus Liberibacter asiaticus str. psy62] (239 letters) >gnl|CDD|32849 COG3034, COG3034, Uncharacterized protein conserved in bacteria [Function unknown]. Length = 298 Score = 217 bits (553), Expect = 3e-57 Identities = 96/234 (41%), Positives = 133/234 (56%), Gaps = 3/234 (1%) Query: 1 MTNRYNILLFALFIFLNGCHHSRSLI-DKAEHPLSENLIISMQKKRTSPFHPTVIRIFKN 59 M L L C L+ K ++ S L + + K ++RIFK Sbjct: 1 MLFVLLKAALILAELLALCLSQGLLLVGKDKYFWSSELPVKNEAKGLYREKVVLVRIFKE 60 Query: 60 ENILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGWNNLNPNSKYF 119 E LE+++++ Y LL+ YKIC WSG GPK GD + PEGFY + LNP+S Y+ Sbjct: 61 ERKLELYEKD-GNIYKLLRSYKICLWSGKLGPKQREGDLKTPEGFYRLTRKQLNPDSYYY 119 Query: 120 LSINIGFPNEFDKAHNRTGADLMIHGECASAGCYAMNNKQMQEIYAIVRDSLRGNMQSHI 179 LSINIG+PN +DKA RTG +MIHG C S GCY+M + Q+ EIY V +L+G Q + Sbjct: 120 LSINIGYPNAYDKALGRTGGGIMIHGACLSDGCYSMTDAQIDEIYGCVAKALQG-GQESV 178 Query: 180 QIQAFPFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFEKNHQEPFIQIINKQYVF 233 Q+ A PFRMT +NM ++ +P +SFW LK G+D FE P + + + +YVF Sbjct: 179 QVVADPFRMTIENMVRHRLSPLFSFWKALKPGYDNFEVTFYPPTVSVCDGRYVF 232 >gnl|CDD|146395 pfam03734, YkuD, L,D-transpeptidase catalytic domain. This family of proteins are found in a range of bacteria. It has been shown that this domain can act as an L,D-transpeptidase that gives rise to an alternative pathway for peptidoglycan cross-linking. This gives bacteria resistance to beta-lactam antibiotics that inhibit PBPs which usually carry out the cross-linking reaction. The conserved region contains a conserved histidine and cysteine, with the cysteine thought to be an active site residue. Several members of this family contain peptidoglycan binding domains. The molecular structure of YkuD protein shows this domain has a novel tertiary fold consisting of a beta-sandwich with two mixed sheets, one containing five strands and the other, six strands. The two beta-sheets form a cradle capped by an alpha-helix. This family was formerly called the ErfK/YbiS/YcfS/YnhG family, but is now named after the first protein of known structure. Length = 122 Score = 58.7 bits (142), Expect = 1e-09 Identities = 27/129 (20%), Positives = 44/129 (34%), Gaps = 25/129 (19%) Query: 51 PTVIRIFKNE-NILEIWKRNVDAEYVLLKEYKICAWSGTFGPKIETGDEQAPEGFYYIGW 109 VI + +E +L +++ L+ Y + G GD P G + I Sbjct: 1 DRVIVVDLSEQRLLLLYENGK-----LVLTYPVS--VGR-------GDTPTPLGTFTITE 46 Query: 110 NNLNPNSKYFLSINIGFPNEFDKAHNRTGADLMIH----------GECASAGCYAMNNKQ 159 NP +G+ D G + IH G S GC ++N+ Sbjct: 47 KVENPTWAPGPGNGLGYVKFLDPWAFPNGGGIYIHGTGTPDLFSGGAPRSHGCIRLSNED 106 Query: 160 MQEIYAIVR 168 +E+Y V Sbjct: 107 AKELYDWVL 115 >gnl|CDD|33259 COG3456, COG3456, Uncharacterized conserved protein, contains FHA domain [Signal transduction mechanisms]. Length = 430 Score = 28.4 bits (63), Expect = 1.6 Identities = 11/58 (18%), Positives = 22/58 (37%), Gaps = 7/58 (12%) Query: 159 QMQEIYAIVRDSLRGNMQSHIQIQAFPFRMTSKNMQLYQNNPNYSFWNMLKLGHDYFE 216 ++E +R + G + Q R+ ++ ++NP L+ DY E Sbjct: 264 FLEEAGRTLRACIEGLLDLLRQRAKGSARLLQTMLRPSEDNP-------LRFAPDYDE 314 >gnl|CDD|31566 COG1376, ErfK, Uncharacterized protein conserved in bacteria [Function unknown]. Length = 232 Score = 28.3 bits (62), Expect = 1.9 Identities = 7/25 (28%), Positives = 14/25 (56%) Query: 145 GECASAGCYAMNNKQMQEIYAIVRD 169 G+ S GC ++N+ +++Y V Sbjct: 198 GKAVSHGCIRLSNQDAKDLYNRVPV 222 >gnl|CDD|36800 KOG1587, KOG1587, KOG1587, Cytoplasmic dynein intermediate chain [Cytoskeleton]. Length = 555 Score = 27.3 bits (60), Expect = 4.0 Identities = 20/90 (22%), Positives = 30/90 (33%), Gaps = 9/90 (10%) Query: 47 SPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICA-------WSGTFGPKIETGDEQ 99 SP P V + L+IW D E +L + K+C+ WS G + GD Sbjct: 450 SPTRPAVFATVDGDGNLDIWDLLQDDEEPVLSQ-KVCSPALTRVRWSPN-GKLLAVGDAN 507 Query: 100 APEGFYYIGWNNLNPNSKYFLSINIGFPNE 129 + + P+ F E Sbjct: 508 GTTHILKLSESLAVPSPNEKALFAHMFERE 537 >gnl|CDD|36310 KOG1094, KOG1094, KOG1094, Discoidin domain receptor DDR1 [Signal transduction mechanisms]. Length = 807 Score = 26.9 bits (59), Expect = 5.0 Identities = 13/42 (30%), Positives = 22/42 (52%), Gaps = 7/42 (16%) Query: 103 GFYYIGWNNLNPNSKYFLSINIGFPNEFDKAHNRTGADLMIH 144 G+ Y+GW N + + Y + I F EFD+ N + + +H Sbjct: 246 GYDYVGWRNDSFTNGY---VEIEF--EFDELRNFS--AMQVH 280 >gnl|CDD|36882 KOG1669, KOG1669, KOG1669, Predicted mRNA cap-binding protein related to eIF-4E [Translation, ribosomal structure and biogenesis]. Length = 208 Score = 26.5 bits (58), Expect = 6.3 Identities = 11/40 (27%), Positives = 20/40 (50%), Gaps = 3/40 (7%) Query: 35 ENLIISMQKKRTSPFHPT---VIRIFKNENILEIWKRNVD 71 ENL++++ ++ V + NE+I+ IW RN Sbjct: 123 ENLLLALCGEQFKVGEEICGAVGSVRFNEDIISIWNRNAS 162 >gnl|CDD|32326 COG2143, COG2143, Thioredoxin-related protein [Posttranslational modification, protein turnover, chaperones]. Length = 182 Score = 26.1 bits (57), Expect = 8.4 Identities = 12/83 (14%), Positives = 26/83 (31%), Gaps = 8/83 (9%) Query: 7 ILLFALFIFLNGCHHSRSLIDKAEHPLSENLIISMQKK-------RTSPFHPTVIR-IFK 58 I+L + +FL+ C + + I K + + + Sbjct: 7 IVLLIISLFLSACKSNNEKRSNIDVFDDNKSISPNDKYLLLMFESNGCSYCERFKKDLKN 66 Query: 59 NENILEIWKRNVDAEYVLLKEYK 81 + + E K + A Y+ + K Sbjct: 67 VKRLREYLKEHFSAYYLNISYSK 89 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.323 0.138 0.431 Gapped Lambda K H 0.267 0.0630 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 3,047,300 Number of extensions: 157735 Number of successful extensions: 347 Number of sequences better than 10.0: 1 Number of HSP's gapped: 343 Number of HSP's successfully gapped: 17 Length of query: 239 Length of database: 6,263,737 Length adjustment: 91 Effective length of query: 148 Effective length of database: 4,297,318 Effective search space: 636003064 Effective search space used: 636003064 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 56 (25.6 bits)