RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780589|ref|YP_003065002.1| hypothetical protein CLIBASIA_02380 [Candidatus Liberibacter asiaticus str. psy62] (239 letters) >gnl|CDD|129652 TIGR00561, pntA, NAD(P) transhydrogenase, alpha subunit. In some species, such as Rhodospirillum rubrum, the alpha chain is replaced by two shorter chains, both with some homology to the full-length alpha chain modeled here. These score below the trusted cutoff. Length = 511 Score = 28.4 bits (63), Expect = 1.5 Identities = 10/27 (37%), Positives = 15/27 (55%), Gaps = 4/27 (14%) Query: 184 FPFRMTSKNMQLYQNNPNYSFWNMLKL 210 P R+ +++ QLY N N+LKL Sbjct: 314 LPSRLPTQSSQLYGTN----LVNLLKL 336 >gnl|CDD|161728 TIGR00132, gatA, glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, A subunit. This orthology group is more narrowly defined here than in Proc Natl Acad Aci USA 94, 11819-11826 (1997). In particular, a Rhodococcus homolog found in association with nitrile hydratase genes and described as an enantiomer-selective amidase active on several 2-aryl propionamides, is excluded here. It is likely, however, that the amidase subunit GatA is not exclusively a part of the Glu-tRNA(Gln) amidotransferase heterotrimer and restricted to that function in all species. Length = 460 Score = 27.3 bits (61), Expect = 3.4 Identities = 10/26 (38%), Positives = 12/26 (46%) Query: 46 TSPFHPTVIRIFKNENILEIWKRNVD 71 P+ TVI K L I K N+D Sbjct: 85 IPPYDATVIERLKQAGALIIGKTNMD 110 >gnl|CDD|184082 PRK13488, PRK13488, chemoreceptor glutamine deamidase CheD; Provisional. Length = 157 Score = 26.8 bits (60), Expect = 5.5 Identities = 13/54 (24%), Positives = 20/54 (37%), Gaps = 6/54 (11%) Query: 35 ENLIISMQKKRTSPFHPTVI-----RIFK-NENILEIWKRNVDAEYVLLKEYKI 82 LI M K +F + N L I +RN+++ LK+ I Sbjct: 68 PLLIEEMVKLGARKSKLEAKLAGGAAMFDFSSNNLNIGERNIESAKETLKKLGI 121 >gnl|CDD|166584 PLN02943, PLN02943, aminoacyl-tRNA ligase. Length = 958 Score = 26.4 bits (58), Expect = 6.5 Identities = 16/50 (32%), Positives = 23/50 (46%) Query: 35 ENLIISMQKKRTSPFHPTVIRIFKNENILEIWKRNVDAEYVLLKEYKICA 84 E LI+S + + P I+ F+N L RN AEY + +I A Sbjct: 774 EALIVSPWPQTSLPKDLKSIKRFENLQSLTRAIRNARAEYSVEPAKRISA 823 >gnl|CDD|152554 pfam12119, DUF3581, Protein of unknown function (DUF3581). This protein is found in bacteria. Proteins in this family are about 240 amino acids in length. Length = 218 Score = 26.4 bits (59), Expect = 7.1 Identities = 9/23 (39%), Positives = 11/23 (47%) Query: 216 EKNHQEPFIQIINKQYVFFKGQT 238 E H E I+ K YV F G+ Sbjct: 106 EVTHDEVLIESFIKNYVAFSGKN 128 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.323 0.138 0.431 Gapped Lambda K H 0.267 0.0587 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 3,904,567 Number of extensions: 236735 Number of successful extensions: 435 Number of sequences better than 10.0: 1 Number of HSP's gapped: 435 Number of HSP's successfully gapped: 11 Length of query: 239 Length of database: 5,994,473 Length adjustment: 91 Effective length of query: 148 Effective length of database: 4,028,145 Effective search space: 596165460 Effective search space used: 596165460 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 56 (25.7 bits)