Query gi|254780590|ref|YP_003065003.1| hypothetical protein CLIBASIA_02385 [Candidatus Liberibacter asiaticus str. psy62] Match_columns 91 No_of_seqs 38 out of 40 Neff 3.4 Searched_HMMs 39220 Date Sun May 29 21:34:10 2011 Command /home/congqian_1/programs/hhpred/hhsearch -i 254780590.hhm -d /home/congqian_1/database/cdd/Cdd.hhm No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM 1 pfam11800 RP-C_C Replication p 80.0 4.3 0.00011 21.9 4.9 70 15-90 128-198 (208) 2 PRK13824 replication initiatio 75.5 6.1 0.00016 20.9 4.6 68 17-90 321-389 (404) 3 pfam08006 DUF1700 Protein of u 70.3 9.8 0.00025 19.7 4.7 33 12-45 12-44 (181) 4 pfam06992 Phage_lambda_P Repli 49.3 14 0.00036 18.8 2.4 62 30-91 127-201 (233) 5 COG3140 Uncharacterized protei 49.1 17 0.00045 18.2 2.9 29 19-50 9-37 (60) 6 pfam09744 Jnk-SapK_ap_N JNK_SA 46.4 25 0.00063 17.3 3.3 25 50-74 6-30 (158) 7 TIGR01928 menC_lowGC/arch o-su 43.6 9.7 0.00025 19.7 0.8 46 38-83 82-128 (326) 8 pfam04317 DUF463 YcjX-like fam 34.9 8.2 0.00021 20.2 -0.6 39 28-66 333-371 (443) 9 PRK12606 GTP cyclohydrolase I; 33.0 24 0.00061 17.3 1.5 33 49-81 2-34 (185) 10 pfam12434 Malate_DH Malate deh 30.3 44 0.0011 15.8 2.5 25 7-31 2-26 (28) 11 TIGR03287 methan_mark_16 putat 29.1 42 0.0011 15.9 2.2 21 66-86 371-391 (391) 12 PRK09347 folE GTP cyclohydrola 27.2 55 0.0014 15.2 2.5 32 50-81 6-37 (186) 13 pfam07500 TFIIS_M Transcriptio 25.6 48 0.0012 15.5 2.0 17 74-90 70-86 (115) 14 COG0302 FolE GTP cyclohydrolas 25.3 55 0.0014 15.2 2.3 30 52-81 15-44 (195) 15 smart00510 TFS2M Domain in the 25.0 61 0.0016 14.9 6.3 59 32-90 9-84 (102) 16 COG4709 Predicted membrane pro 23.7 65 0.0017 14.7 4.3 34 14-48 14-47 (195) 17 pfam00382 TFIIB Transcription 22.6 68 0.0017 14.6 4.0 37 22-58 14-50 (71) 18 pfam10568 Tom37 Outer mitochon 22.5 60 0.0015 14.9 2.0 14 41-54 12-25 (71) 19 cd00642 GTP_cyclohydro1 GTP cy 22.4 46 0.0012 15.6 1.4 31 51-81 5-35 (185) 20 pfam03701 UPF0181 Uncharacteri 22.3 62 0.0016 14.9 2.0 24 19-42 9-32 (52) 21 COG3106 Predicted ATPase [Gene 21.9 7.9 0.0002 20.3 -2.6 39 28-66 358-396 (467) 22 PRK05114 hypothetical protein; 21.8 71 0.0018 14.5 2.3 24 19-42 9-32 (60) 23 pfam08185 BB1 BB1 family. This 21.5 72 0.0018 14.5 2.4 32 15-46 5-36 (64) 24 pfam07307 HEPPP_synt_1 Heptapr 21.3 63 0.0016 14.8 1.9 69 16-87 11-81 (212) No 1 >pfam11800 RP-C_C Replication protein C C-terminal region. Replication protein C is involved in the early stages of viral DNA replication. Probab=80.02 E-value=4.3 Score=21.87 Aligned_cols=70 Identities=23% Similarity=0.314 Sum_probs=44.8 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHC-CCCHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHCCCCHHHHC Q ss_conf 56679999999999999999999972-88899999999999999999995838999999999999970577887725 Q gi|254780590|r 15 DALLLHEKMQVAIEYQNEAWAEGMAE-GIEPEIIANAAITQAIRETVRIHGEEKMESLLKSLMSRMLAGEFSPERVI 90 (91) Q Consensus 15 d~l~~~Eq~~~Ale~~~eAWaEal~~-GIepe~lA~AAlfaAl~elv~~~GEe~~a~l~e~l~~Rv~~GeFt~~r~~ 90 (91) |-+..-++-+.-+..-..||.||+.. |-+.-.++-+.|..- ..-|+.- -.|+.+|-+|-+.|+|++.+.+ T Consensus 128 dl~~aa~~lr~mlGIs~~a~~~A~~~mG~~~Aa~~va~iler-~~~I~sp-----GgYlR~lt~ra~~G~f~l~~~l 198 (208) T pfam11800 128 DLMAAAVVVRPMLGISPSAWQEACEVMGPENAAVAVACILER-AGHINSP-----GGYLRDLTERAARGEFSLGPML 198 (208) T ss_pred HHHHHHHHHHHHCCCCHHHHHHHHHHHCHHHHHHHHHHHHHH-HHHCCCC-----CHHHHHHHHHHHCCCCCCHHHH T ss_conf 999999999887187899999999987959999999999976-5316796-----4799999999967995842899 No 2 >PRK13824 replication initiation protein RepC; Provisional Probab=75.50 E-value=6.1 Score=20.94 Aligned_cols=68 Identities=22% Similarity=0.255 Sum_probs=41.6 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHC-CCCHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHCCCCHHHHC Q ss_conf 679999999999999999999972-88899999999999999999995838999999999999970577887725 Q gi|254780590|r 17 LLLHEKMQVAIEYQNEAWAEGMAE-GIEPEIIANAAITQAIRETVRIHGEEKMESLLKSLMSRMLAGEFSPERVI 90 (91) Q Consensus 17 l~~~Eq~~~Ale~~~eAWaEal~~-GIepe~lA~AAlfaAl~elv~~~GEe~~a~l~e~l~~Rv~~GeFt~~r~~ 90 (91) +..-++.+.-|..-..||.||+.. |-+.-.++-|.++.-. +.|+ ..-.|+-+|-+|-+.|+|++.+.+ T Consensus 321 ~~aA~~lr~mlGIS~saw~eA~~~mG~~~AAvaiA~iler~-~~I~-----SPGGYLR~Lt~rA~~G~fsl~pml 389 (404) T PRK13824 321 MAAAVVVRSMLGVSPSAYQEACEVMGPENAAIVIACILQRA-GHIN-----SAGGYLRDLTRRAERGEFSLGPML 389 (404) T ss_pred HHHHHHHHHHHCCCHHHHHHHHHHHCHHHHHHHHHHHHHHH-CCCC-----CCCHHHHHHHHHHHCCCCCHHHHH T ss_conf 99999999870989999999999869688999999999865-4278-----952799999999967983816899 No 3 >pfam08006 DUF1700 Protein of unknown function (DUF1700). This family contains many hypothetical bacterial proteins and two putative membrane proteins. Probab=70.26 E-value=9.8 Score=19.70 Aligned_cols=33 Identities=24% Similarity=0.222 Sum_probs=26.4 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHH Q ss_conf 5325667999999999999999999997288899 Q gi|254780590|r 12 QEFDALLLHEKMQVAIEYQNEAWAEGMAEGIEPE 45 (91) Q Consensus 12 ~eid~l~~~Eq~~~Ale~~~eAWaEal~~GIepe 45 (91) ..++.|+.+| |+-++.|+.|.++|+..+|-..+ T Consensus 12 ~~L~~lp~~e-~~~il~~y~e~f~~~~~~G~se~ 44 (181) T pfam08006 12 SSLKKLPEEE-RKDILYDYEEHFYEGEEEGKSEE 44 (181) T ss_pred HHHHCCCHHH-HHHHHHHHHHHHHHHHHCCCCHH T ss_conf 9886599999-99999999999998766899999 No 4 >pfam06992 Phage_lambda_P Replication protein P. This family consists of several Bacteriophage lambda replication protein P like proteins. The bacteriophage lambda P protein promoters replication of the phage chromosome by recruiting a key component of the cellular replication machinery to the viral origin. Specifically, P protein delivers one or more molecules of Escherichia coli DnaB helicase to a nucleoprotein structure formed by the lambda O initiator at the lambda replication origin. Probab=49.31 E-value=14 Score=18.78 Aligned_cols=62 Identities=21% Similarity=0.258 Sum_probs=35.7 Q ss_pred HHHHHHHHHHCCCCHHH----HHHHHHHHHHHHH---HHHHC------HHHHHHHHHHHHHHHHHCCCCHHHHCC Q ss_conf 99999999972888999----9999999999999---99958------389999999999999705778877259 Q gi|254780590|r 30 QNEAWAEGMAEGIEPEI----IANAAITQAIRET---VRIHG------EEKMESLLKSLMSRMLAGEFSPERVIQ 91 (91) Q Consensus 30 ~~eAWaEal~~GIepe~----lA~AAlfaAl~el---v~~~G------Ee~~a~l~e~l~~Rv~~GeFt~~r~~Q 91 (91) +.+.|.-.-..|.-|++ -.+-+..-..++| .+.++ ...+...+..|..||.+||-.|.+++| T Consensus 127 ~~~~~~Y~~~rg~y~~~e~Fpw~s~a~YWlvtdLy~~mr~~~Lsd~El~k~a~~~L~~makRi~sGE~IPeP~~q 201 (233) T pfam06992 127 VDMVYEYCRKRGLYPDAESYPWKSNAHYWLVTNLYQNMRANALTDAELRRKAADELTCMTARINRGEAIPEPVKQ 201 (233) T ss_pred HHHHHHHHHHCCCCCCHHHCCCCCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHH T ss_conf 999999998605799464378899622354899998998857989999999999999999998679959956886 No 5 >COG3140 Uncharacterized protein conserved in bacteria [Function unknown] Probab=49.10 E-value=17 Score=18.19 Aligned_cols=29 Identities=48% Similarity=0.557 Sum_probs=23.1 Q ss_pred HHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHH Q ss_conf 99999999999999999999728889999999 Q gi|254780590|r 19 LHEKMQVAIEYQNEAWAEGMAEGIEPEIIANA 50 (91) Q Consensus 19 ~~Eq~~~Ale~~~eAWaEal~~GIepe~lA~A 50 (91) -+||.|.|++-+.+--+||++-| |.++.. T Consensus 9 tHeqQQ~AVE~Iq~lMaeGmSsG---EAIa~V 37 (60) T COG3140 9 THEQQQKAVERIQELMAEGMSSG---EAIALV 37 (60) T ss_pred CHHHHHHHHHHHHHHHHCCCCCH---HHHHHH T ss_conf 67999999999999998114400---699999 No 6 >pfam09744 Jnk-SapK_ap_N JNK_SAPK-associated protein-1. This is the N-terminal 200 residues of a set of proteins conserved from yeasts to humans. Most of the proteins in this entry have an RhoGEF pfam00621 domain at their C-terminal end. Probab=46.38 E-value=25 Score=17.26 Aligned_cols=25 Identities=24% Similarity=0.319 Sum_probs=20.1 Q ss_pred HHHHHHHHHHHHHHCHHHHHHHHHH Q ss_conf 9999999999999583899999999 Q gi|254780590|r 50 AAITQAIRETVRIHGEEKMESLLKS 74 (91) Q Consensus 50 AAlfaAl~elv~~~GEe~~a~l~e~ 74 (91) ++|..-|-.||..||+++|..|+-. T Consensus 6 ~~Ig~EfErlId~yG~d~V~~LmPk 30 (158) T pfam09744 6 NSIYQEFERLIDNYGEEVVKNLMPL 30 (158) T ss_pred HHHHHHHHHHHHHCCHHHHHHHHHH T ss_conf 9888999999998186689988889 No 7 >TIGR01928 menC_lowGC/arch o-succinylbenzoic acid (OSB) synthetase; InterPro: IPR010197 This entry describes the enzyme o-succinylbenzoic acid synthetase (menC) that is involved in one of the steps of the menaquinone biosynthesis pathway. It takes SHCHC and makes it into 2-succinylbenzoate. Also included are enzymes with the common name of N-acylamino acid racemase (or the more general term, racemase / racemase family), which refers to the enzyme's industrial application as racemases, and not to its biological function as o-succinylbenzoic acid synthetase . Members are restricted to the are low GC Gram-positive bacteria and archaea. . Probab=43.55 E-value=9.7 Score=19.74 Aligned_cols=46 Identities=15% Similarity=0.264 Sum_probs=42.0 Q ss_pred HHCCCCHHHHHHHHHHHHHHHHHHHHCHHHHHH-HHHHHHHHHHHCC Q ss_conf 972888999999999999999999958389999-9999999997057 Q gi|254780590|r 38 MAEGIEPEIIANAAITQAIRETVRIHGEEKMES-LLKSLMSRMLAGE 83 (91) Q Consensus 38 l~~GIepe~lA~AAlfaAl~elv~~~GEe~~a~-l~e~l~~Rv~~Ge 83 (91) ..++++|.-||-|+|-.||=++-.---.-.++. +++++++.+-.|- T Consensus 82 ~~~~~~~~~mA~A~Le~al~d~y~k~~~~~l~~G~~gk~rdk~~~G~ 128 (326) T TIGR01928 82 LVRSLKGTRMAKAGLEMALWDLYAKKKDKSLAEGFLGKLRDKAPAGV 128 (326) T ss_pred HHHCCCCCHHHHHHHHHHHHHHHHHCCCCCHHHHHHCCCCCEEECCE T ss_conf 97255887779999999999887642797311321112357132017 No 8 >pfam04317 DUF463 YcjX-like family, DUF463. Some members of this family are thought to possess an ATP-binding domain towards their N-terminus. Probab=34.94 E-value=8.2 Score=20.16 Aligned_cols=39 Identities=33% Similarity=0.376 Sum_probs=34.0 Q ss_pred HHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHCHH Q ss_conf 999999999997288899999999999999999995838 Q gi|254780590|r 28 EYQNEAWAEGMAEGIEPEIIANAAITQAIRETVRIHGEE 66 (91) Q Consensus 28 e~~~eAWaEal~~GIepe~lA~AAlfaAl~elv~~~GEe 66 (91) ..+.+||..+-.+||+-++||-||+-++-..+|+.-|+. T Consensus 333 ~lv~~a~~~a~f~G~~~~~~AiAavraT~~~~v~~~G~~ 371 (443) T pfam04317 333 QLVQEARQRAAFEGAETEVMAIAAIRATREGMVTHDGQE 371 (443) T ss_pred HHHHHHHHHHCCCCCCEEEEEEEHHHHCHHHHEECCCCE T ss_conf 999999976311687513433000201522421007801 No 9 >PRK12606 GTP cyclohydrolase I; Reviewed Probab=32.99 E-value=24 Score=17.35 Aligned_cols=33 Identities=24% Similarity=0.204 Sum_probs=26.3 Q ss_pred HHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHH Q ss_conf 999999999999995838999999999999970 Q gi|254780590|r 49 NAAITQAIRETVRIHGEEKMESLLKSLMSRMLA 81 (91) Q Consensus 49 ~AAlfaAl~elv~~~GEe~~a~l~e~l~~Rv~~ 81 (91) .+++-.|++++.+.-|||...+=+..+|+||.. T Consensus 2 ~~~ie~av~~lL~~lGeD~~regL~~TP~Rvak 34 (185) T PRK12606 2 PPALEAAYREILEALGEDPDREGLLDTPQRAAK 34 (185) T ss_pred HHHHHHHHHHHHHHHCCCCCCCCHHHCHHHHHH T ss_conf 789999999999996799996310358999999 No 10 >pfam12434 Malate_DH Malate dehydrogenase enzyme. This domain family is found in bacteria, and is approximately 30 amino acids in length. The family is found in association with pfam00390, pfam03949, pfam01515. There is a conserved AAL sequence motif. There is a single completely conserved residue R that may be functionally important. Malate dehydrogenase is one of the enzymes involved in the citric acid cycle in mitochondria. It converts malate to oxaloacetate using NAD as a cofactor. Probab=30.31 E-value=44 Score=15.77 Aligned_cols=25 Identities=12% Similarity=0.203 Sum_probs=17.0 Q ss_pred CCCCHHHHHHHHHHHHHHHHHHHHH Q ss_conf 5679553256679999999999999 Q gi|254780590|r 7 VEKKTQEFDALLLHEKMQVAIEYQN 31 (91) Q Consensus 7 ~~~~~~eid~l~~~Eq~~~Ale~~~ 31 (91) +..+.+|+-+.-...-|.+||+|+. T Consensus 2 ~t~s~~dlk~qqraalRkAALeYHE 26 (28) T pfam12434 2 PTASKEDLKEQQRAALRKAALEYHE 26 (28) T ss_pred CCCCCCHHHHHHHHHHHHHHHHHCC T ss_conf 8665510689999999999888613 No 11 >TIGR03287 methan_mark_16 putative methanogenesis marker 16 metalloprotein. Members of this protein family, to date, are found in a completed prokaryotic genome if and only if the species is one of the archaeal methanogens. The exact function is unknown, but likely is linked to methanogenesis or a process closely connected to it. This protein is a predicted to bind FeS clusters, based on the presence of two copies of the Fer4 domain (pfam00037), with each copy having four Cys residues invariant across all members. Probab=29.09 E-value=42 Score=15.90 Aligned_cols=21 Identities=24% Similarity=0.393 Sum_probs=18.0 Q ss_pred HHHHHHHHHHHHHHHHCCCCH Q ss_conf 899999999999997057788 Q gi|254780590|r 66 EKMESLLKSLMSRMLAGEFSP 86 (91) Q Consensus 66 e~~a~l~e~l~~Rv~~GeFt~ 86 (91) --+.++.+.|.+||..|+|.+ T Consensus 371 ~rA~kla~eLK~~I~~G~F~l 391 (391) T TIGR03287 371 KRAKKLAEELKEAIERGEFKI 391 (391) T ss_pred HHHHHHHHHHHHHHHCCCCCC T ss_conf 999999999999997096359 No 12 >PRK09347 folE GTP cyclohydrolase I; Provisional Probab=27.17 E-value=55 Score=15.17 Aligned_cols=32 Identities=25% Similarity=0.282 Sum_probs=21.1 Q ss_pred HHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHH Q ss_conf 99999999999995838999999999999970 Q gi|254780590|r 50 AAITQAIRETVRIHGEEKMESLLKSLMSRMLA 81 (91) Q Consensus 50 AAlfaAl~elv~~~GEe~~a~l~e~l~~Rv~~ 81 (91) ..+..|++++.+.-|||.-.+=+..+|+||.. T Consensus 6 ~~~e~av~~iL~~lGeD~~r~gL~~TP~Rvak 37 (186) T PRK09347 6 EKIEEAVREILEALGEDPDREGLLDTPKRVAK 37 (186) T ss_pred HHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHH T ss_conf 99999999999996789994123457999999 No 13 >pfam07500 TFIIS_M Transcription factor S-II (TFIIS), central domain. Transcription elongation by RNA polymerase II is regulated by the general elongation factor TFIIS. This factor stimulates RNA polymerase II to transcribe through regions of DNA that promote the formation of stalled ternary complexes. TFIIS is composed of three structural domains, termed I, II, and III. The two C-terminal domains (II and III), this domain and pfam01096 are required for transcription activity. Probab=25.63 E-value=48 Score=15.54 Aligned_cols=17 Identities=47% Similarity=0.878 Sum_probs=14.7 Q ss_pred HHHHHHHHCCCCHHHHC Q ss_conf 99999970577887725 Q gi|254780590|r 74 SLMSRMLAGEFSPERVI 90 (91) Q Consensus 74 ~l~~Rv~~GeFt~~r~~ 90 (91) .|+.||.+|+++|.+.. T Consensus 70 ~L~~~vl~g~i~p~~l~ 86 (115) T pfam07500 70 DLRRKVLNGEISPERLV 86 (115) T ss_pred HHHHHHHCCCCCHHHHH T ss_conf 99999885999989986 No 14 >COG0302 FolE GTP cyclohydrolase I [Coenzyme metabolism] Probab=25.31 E-value=55 Score=15.17 Aligned_cols=30 Identities=27% Similarity=0.273 Sum_probs=24.6 Q ss_pred HHHHHHHHHHHHCHHHHHHHHHHHHHHHHH Q ss_conf 999999999995838999999999999970 Q gi|254780590|r 52 ITQAIRETVRIHGEEKMESLLKSLMSRMLA 81 (91) Q Consensus 52 lfaAl~elv~~~GEe~~a~l~e~l~~Rv~~ 81 (91) +..|.+++...-|||.-.+=+..+|+||.. T Consensus 15 ~e~avr~lL~~~Gedp~reGL~~TP~RVak 44 (195) T COG0302 15 IEAAVRELLEALGEDPDREGLLETPKRVAK 44 (195) T ss_pred HHHHHHHHHHHHCCCCCCHHHHHHHHHHHH T ss_conf 999999999982799770033454899999 No 15 >smart00510 TFS2M Domain in the central regions of transcription elongation factor S-II (and elsewhere). Probab=24.99 E-value=61 Score=14.89 Aligned_cols=59 Identities=19% Similarity=0.247 Sum_probs=30.2 Q ss_pred HHHHHHHHCCC-------CHHHHH---HHHHHHHHHHHHHHHCHHHHHHH-------HHHHHHHHHHCCCCHHHHC Q ss_conf 99999997288-------899999---99999999999999583899999-------9999999970577887725 Q gi|254780590|r 32 EAWAEGMAEGI-------EPEIIA---NAAITQAIRETVRIHGEEKMESL-------LKSLMSRMLAGEFSPERVI 90 (91) Q Consensus 32 eAWaEal~~GI-------epe~lA---~AAlfaAl~elv~~~GEe~~a~l-------~e~l~~Rv~~GeFt~~r~~ 90 (91) +.+-+|+..|. +|.-+| ++++|..+...-..|-.---..+ =..|+.||.+|+++|.+.. T Consensus 9 ~~L~~aL~~~~~~~~~~~~~~~~A~~IE~~l~~~~~~~~~~Yk~K~Rsl~~NLkd~~N~~L~~~vl~g~i~p~~l~ 84 (102) T smart00510 9 EMLYKALQKISDPEEIELDPTELAVQIEAEMFSEFGTTDKKYKNKYRSLYFNLKDKKNPDLRRKVLNGEITPEKLA 84 (102) T ss_pred HHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCCCHHHHH T ss_conf 9999998708988842046999999999999998477729999988888872378888899999874888889984 No 16 >COG4709 Predicted membrane protein [Function unknown] Probab=23.68 E-value=65 Score=14.74 Aligned_cols=34 Identities=24% Similarity=0.221 Sum_probs=26.4 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHH Q ss_conf 25667999999999999999999997288899999 Q gi|254780590|r 14 FDALLLHEKMQVAIEYQNEAWAEGMAEGIEPEIIA 48 (91) Q Consensus 14 id~l~~~Eq~~~Ale~~~eAWaEal~~GIepe~lA 48 (91) ++-|+.+| |+-++.++.|-+.||-.+|.+.+-++ T Consensus 14 L~~Lp~~~-r~e~m~dyeehF~~a~~~GksE~EI~ 47 (195) T COG4709 14 LEGLPREE-RREIMYDYEEHFREAQEAGKSEEEIA 47 (195) T ss_pred HHHCCHHH-HHHHHHHHHHHHHHHHHCCCCHHHHH T ss_conf 87199888-99999999999986503489889999 No 17 >pfam00382 TFIIB Transcription factor TFIIB repeat. Probab=22.59 E-value=68 Score=14.60 Aligned_cols=37 Identities=30% Similarity=0.289 Sum_probs=33.2 Q ss_pred HHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHH Q ss_conf 9999999999999999972888999999999999999 Q gi|254780590|r 22 KMQVAIEYQNEAWAEGMAEGIEPEIIANAAITQAIRE 58 (91) Q Consensus 22 q~~~Ale~~~eAWaEal~~GIepe~lA~AAlfaAl~e 58 (91) -+..|..++..+=..++..|-.|+-++-|+|+.|-+. T Consensus 14 i~~~A~~i~~~~~~~~~~~Grs~~~iaaA~iY~Acr~ 50 (71) T pfam00382 14 VADAANELAKLALDDNLLKGRSPESIAAACLYIACRL 50 (71) T ss_pred HHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHH T ss_conf 9999999999998858746998999999999999998 No 18 >pfam10568 Tom37 Outer mitochondrial membrane transport complex protein. The TOM37 protein is one of the outer membrane proteins that make up the TOM complex for guiding cytosolic mitochondrial beta-barrel proteins from the cytosol across the outer mitochondrial membrane into the intramembrane space. In conjunction with TOM70 it guides peptides without an MTS into TOM40, the protein that forms the passage through the outer membrane. It has homology with Metaxin-1, also part of the outer mitochondrial membrane beta-barrel protein transport complex. Probab=22.49 E-value=60 Score=14.93 Aligned_cols=14 Identities=29% Similarity=0.287 Sum_probs=11.5 Q ss_pred CCCHHHHHHHHHHH Q ss_conf 88899999999999 Q gi|254780590|r 41 GIEPEIIANAAITQ 54 (91) Q Consensus 41 GIepe~lA~AAlfa 54 (91) -|+|||+|-.+.+. T Consensus 12 sIdpeCLA~~~y~~ 25 (71) T pfam10568 12 SISPECLALIWYLK 25 (71) T ss_pred CCCHHHHHHHHHHH T ss_conf 13999999999998 No 19 >cd00642 GTP_cyclohydro1 GTP cyclohydrolase I (GTP-CH-I) catalyzes the conversion of GTP into dihydroneopterin triphosphate. The enzyme product is the precursor of tetrahydrofolate in eubacteria, fungi, and plants and of the folate analogs in methanogenic bacteria. In vertebrates and insects it is the biosynthtic precursor of tetrahydrobiopterin (BH4) which is involved in the formation of catacholamines, nitric oxide, and the stimulation of T lymphocytes. The biosynthetic reaction of BH4 is controlled by a regulatory protein GFRP which mediates feedback inhibition of GTP-CH-I by BH4. This inhibition is reversed by phenylalanine. The decameric GTP-CH-I forms a complex with two pentameric GFRP in the presence of phenylalanine or a combination of GTP and BH4, respectively. Probab=22.38 E-value=46 Score=15.63 Aligned_cols=31 Identities=26% Similarity=0.323 Sum_probs=23.5 Q ss_pred HHHHHHHHHHHHHCHHHHHHHHHHHHHHHHH Q ss_conf 9999999999995838999999999999970 Q gi|254780590|r 51 AITQAIRETVRIHGEEKMESLLKSLMSRMLA 81 (91) Q Consensus 51 AlfaAl~elv~~~GEe~~a~l~e~l~~Rv~~ 81 (91) .+-.|++++.+.-|||.-.+=+.++|+||.. T Consensus 5 ~ie~av~~iL~~lGeD~~r~gL~~TP~Rvak 35 (185) T cd00642 5 KIAAAVREILELLGEDPNREGLLETPERVAK 35 (185) T ss_pred HHHHHHHHHHHHHCCCCCCCHHHHCHHHHHH T ss_conf 9999999999996799995001357999999 No 20 >pfam03701 UPF0181 Uncharacterized protein family (UPF0181). This family contains small proteins of about 50 amino acids of unknown function. The family includes YoaH. Probab=22.34 E-value=62 Score=14.88 Aligned_cols=24 Identities=42% Similarity=0.515 Sum_probs=20.0 Q ss_pred HHHHHHHHHHHHHHHHHHHHHCCC Q ss_conf 999999999999999999997288 Q gi|254780590|r 19 LHEKMQVAIEYQNEAWAEGMAEGI 42 (91) Q Consensus 19 ~~Eq~~~Ale~~~eAWaEal~~GI 42 (91) -+|+.|.|+|-+.+--++|++-|= T Consensus 9 tHeeQQ~AvErIq~LMaqGmSsge 32 (52) T pfam03701 9 THEEQQEAVERIQELMAQGMSSGE 32 (52) T ss_pred CHHHHHHHHHHHHHHHHCCCCHHH T ss_conf 879999999999999980455889 No 21 >COG3106 Predicted ATPase [General function prediction only] Probab=21.87 E-value=7.9 Score=20.28 Aligned_cols=39 Identities=28% Similarity=0.420 Sum_probs=33.4 Q ss_pred HHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHCHH Q ss_conf 999999999997288899999999999999999995838 Q gi|254780590|r 28 EYQNEAWAEGMAEGIEPEIIANAAITQAIRETVRIHGEE 66 (91) Q Consensus 28 e~~~eAWaEal~~GIepe~lA~AAlfaAl~elv~~~GEe 66 (91) ..+.+||.-+--+||+-||+|.|+.-++-.-+|...|+. T Consensus 358 qlv~~a~~~a~feGi~~d~~alAsVraT~~~~V~q~g~~ 396 (467) T COG3106 358 QLVQRAWQNAAFEGISMDCLALASVRATRSGTVDQGGEK 396 (467) T ss_pred HHHHHHHHHHCCCCCCCCEEEEEHHECCCEEEECCCCEE T ss_conf 999999864032466620230100000113676118857 No 22 >PRK05114 hypothetical protein; Provisional Probab=21.81 E-value=71 Score=14.51 Aligned_cols=24 Identities=42% Similarity=0.522 Sum_probs=20.1 Q ss_pred HHHHHHHHHHHHHHHHHHHHHCCC Q ss_conf 999999999999999999997288 Q gi|254780590|r 19 LHEKMQVAIEYQNEAWAEGMAEGI 42 (91) Q Consensus 19 ~~Eq~~~Ale~~~eAWaEal~~GI 42 (91) -+|+.|.|++-+.+--++|++-|- T Consensus 9 tHeqQQ~AvErIq~LM~~Gmssge 32 (60) T PRK05114 9 THEQQQKAVERIQELMAQGMSSGE 32 (60) T ss_pred CHHHHHHHHHHHHHHHHCCCCHHH T ss_conf 879999999999999980446778 No 23 >pfam08185 BB1 BB1 family. This family consists of the BB1 proteins. BB1 is a growth regulating protein that is expressed by multiple tissues in humans, including the lung. BB1 has been shown to function in cell growth-related processes of fetal and early postnatal lung. Probab=21.50 E-value=72 Score=14.47 Aligned_cols=32 Identities=34% Similarity=0.439 Sum_probs=22.2 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHH Q ss_conf 56679999999999999999999972888999 Q gi|254780590|r 15 DALLLHEKMQVAIEYQNEAWAEGMAEGIEPEI 46 (91) Q Consensus 15 d~l~~~Eq~~~Ale~~~eAWaEal~~GIepe~ 46 (91) |-++.+..+|.-+||.++.=-----+||+||. T Consensus 5 ~~lia~aa~qrQ~E~~~~~~~~~dfdGv~pel 36 (64) T pfam08185 5 DVLLASAADQRQVEYFNEVASRLDFDGVPPEL 36 (64) T ss_pred HHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHH T ss_conf 79999999998888876451477768989899 No 24 >pfam07307 HEPPP_synt_1 Heptaprenyl diphosphate synthase (HEPPP synthase) subunit 1. This family contains subunit 1 of bacterial heptaprenyl diphosphate synthase (HEPPP synthase) (EC:2.5.1.30) (approximately 230 residues long). The enzyme consists of two subunits, both of which are required for catalysis of heptaprenyl diphosphate synthesis. Probab=21.30 E-value=63 Score=14.83 Aligned_cols=69 Identities=19% Similarity=0.215 Sum_probs=39.7 Q ss_pred HHHHHHHHHHHHHHHHHH--HHHHHHCCCCHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHCCCCHH Q ss_conf 667999999999999999--999997288899999999999999999995838999999999999970577887 Q gi|254780590|r 16 ALLLHEKMQVAIEYQNEA--WAEGMAEGIEPEIIANAAITQAIRETVRIHGEEKMESLLKSLMSRMLAGEFSPE 87 (91) Q Consensus 16 ~l~~~Eq~~~Ale~~~eA--WaEal~~GIepe~lA~AAlfaAl~elv~~~GEe~~a~l~e~l~~Rv~~GeFt~~ 87 (91) +.++++|-......+.++ |.+-..+=|-.-.++|+||.| .|.|...|...-... ..=-=.|++|+|-.. T Consensus 11 P~iDEdkl~ll~~~l~e~~~~~~~~~~~i~t~mLvq~aLDT--Hd~V~~~~~~~~~~~-k~RQLtVLAGDyyS~ 81 (212) T pfam07307 11 PQIDEDKLLLLYTMLTEAELTPEQAERYILTAMLVQIALDT--HDKVSNANAETQETK-KNRQLTVLAGDYYSG 81 (212) T ss_pred CCCCHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHH--HHHHCCCCCCCCHHH-HHHHHHHHHHHHHHH T ss_conf 99988999999999855899989999999999999999877--876454231210355-631032011023318 Done!