RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780590|ref|YP_003065003.1| hypothetical protein CLIBASIA_02385 [Candidatus Liberibacter asiaticus str. psy62] (91 letters) >gnl|CDD|146778 pfam04317, DUF463, YcjX-like family, DUF463. Some members of this family are thought to possess an ATP-binding domain towards their N-terminus. Length = 443 Score = 26.0 bits (58), Expect = 2.4 Identities = 14/40 (35%), Positives = 23/40 (57%), Gaps = 1/40 (2%) Query: 32 EAWAEGMAEGIEPEIIANAAITQAIRETVRIHGEEKMESL 71 EA EG E E++A AAI +A RE + H +++ ++ Sbjct: 337 EARQRAAFEGAETEVMAIAAI-RATREGMVTHDGQELPAI 375 >gnl|CDD|32920 COG3106, COG3106, Predicted ATPase [General function prediction only]. Length = 467 Score = 25.3 bits (55), Expect = 3.6 Identities = 12/40 (30%), Positives = 20/40 (50%), Gaps = 1/40 (2%) Query: 32 EAWAEGMAEGIEPEIIANAAITQAIRETVRIHGEEKMESL 71 AW EGI + +A A++ +A R G EK+ ++ Sbjct: 362 RAWQNAAFEGISMDCLALASV-RATRSGTVDQGGEKIPAI 400 >gnl|CDD|107340 cd06345, PBP1_ABC_ligand_binding_like_10, Type I periplasmic ligand-binding domain of uncharacterized ABC (Atpase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions. This subgroup includes the type I periplasmic ligand-binding domain of uncharacterized ABC (Atpase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions. This subgroup has high sequence similarity to members of the family of hydrophobic amino acid transporters (HAAT), such as leucine/isoleucine/valine binding protein (LIVBP); however its ligand specificity has not been determined experimentally. Length = 344 Score = 24.2 bits (53), Expect = 7.2 Identities = 8/25 (32%), Positives = 13/25 (52%) Query: 20 HEKMQVAIEYQNEAWAEGMAEGIEP 44 H AI ++ AW +G+ GI+ Sbjct: 142 HGFKTAAIVAEDAAWGKGIDAGIKA 166 >gnl|CDD|34211 COG4573, GatZ, Predicted tagatose 6-phosphate kinase [Carbohydrate transport and metabolism]. Length = 426 Score = 24.1 bits (52), Expect = 9.1 Identities = 12/43 (27%), Positives = 20/43 (46%), Gaps = 2/43 (4%) Query: 41 GIEPEIIANAAIT--QAIRETVRIHGEEKMESLLKSLMSRMLA 81 G E + A+T +A R T+R H + L +R++A Sbjct: 179 GGAAEALDELAVTTPEAARNTLRAHRKAFEARGLAEAWTRVIA 221 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.313 0.127 0.333 Gapped Lambda K H 0.267 0.0567 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 987,225 Number of extensions: 41044 Number of successful extensions: 84 Number of sequences better than 10.0: 1 Number of HSP's gapped: 84 Number of HSP's successfully gapped: 11 Length of query: 91 Length of database: 6,263,737 Length adjustment: 60 Effective length of query: 31 Effective length of database: 4,967,197 Effective search space: 153983107 Effective search space used: 153983107 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 51 (23.8 bits)