RPS-BLAST 2.2.22 [Sep-27-2009] Database: pdb70 24,244 sequences; 5,693,230 total letters Searching..................................................done Query= gi|254780590|ref|YP_003065003.1| hypothetical protein CLIBASIA_02385 [Candidatus Liberibacter asiaticus str. psy62] (91 letters) >3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 Score = 29.1 bits (64), Expect = 0.23 Identities = 16/60 (26%), Positives = 27/60 (45%), Gaps = 6/60 (10%) Query: 2 ESIR----SVEKKTQEFDAL--LLHEKMQVAIEYQNEAWAEGMAEGIEPEIIANAAITQA 55 ESIR K+ QE DA ++ ++ + + E W + +E +E I N +A Sbjct: 85 ESIRKWREEQRKRLQELDAASKVMEQEWREKAKKDLEEWNQRQSEQVEKNKINNRIADKA 144 >2ddm_A Pyridoxine kinase; pyridoxal kinase, ribokinase, pyridoxal 5'-phosphate, vitamin B6, phosphorylation, transferase; 2.10A {Escherichia coli} PDB: 2ddo_A* 2ddw_A* Length = 283 Score = 25.2 bits (54), Expect = 3.5 Identities = 6/37 (16%), Positives = 13/37 (35%), Gaps = 3/37 (8%) Query: 33 AWAEGMAEGIEPE---IIANAAITQAIRETVRIHGEE 66 G+ +G A + + +R T + +E Sbjct: 238 QLISGLLKGKALTDAVHRAGLRVLEVMRYTQQHESDE 274 >1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* Length = 418 Score = 25.1 bits (54), Expect = 3.7 Identities = 11/46 (23%), Positives = 21/46 (45%), Gaps = 4/46 (8%) Query: 45 EIIANAAITQAIRETVRIHGEEKMESLLKSLMSRMLAGEFSPERVI 90 E+I + A QA+ + +R S+ + ++ G S E V+ Sbjct: 366 ELIHSEAGEQAMEKHIR----ATTPSIRDDGLDKVRQGITSLEEVM 407 Database: pdb70 Posted date: Jan 26, 2011 11:21 AM Number of letters in database: 5,693,230 Number of sequences in database: 24,244 Lambda K H 0.313 0.127 0.333 Gapped Lambda K H 0.267 0.0450 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 24244 Number of Hits to DB: 713,105 Number of extensions: 27466 Number of successful extensions: 64 Number of sequences better than 10.0: 1 Number of HSP's gapped: 64 Number of HSP's successfully gapped: 9 Length of query: 91 Length of database: 5,693,230 Length adjustment: 58 Effective length of query: 33 Effective length of database: 4,287,078 Effective search space: 141473574 Effective search space used: 141473574 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 50 (23.7 bits)