RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780592|ref|YP_003065005.1| TPR repeat-containing protein [Candidatus Liberibacter asiaticus str. psy62] (271 letters) >gnl|CDD|34615 COG5010, TadD, Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion]. Length = 257 Score = 148 bits (374), Expect = 2e-36 Identities = 89/225 (39%), Positives = 125/225 (55%), Gaps = 3/225 (1%) Query: 37 SIPDPESLENMNHEQLLEVTSTIGLQYQSHTKNKMIGIVYADVLRRVGRTAQALAVMRQV 96 + PES M Q + +G + ++ I A L G +LAV+++ Sbjct: 36 ATGAPESSLAMRQTQ--GAAAALGAAVLRNPEDLSI-AKLATALYLRGDADSSLAVLQKS 92 Query: 97 AILYPEDQEVLAAYGKSLANAGYLDEGLDAINRAQRPDIPDWQLISAKGSVLAQMGKHSE 156 AI YP+D+E+LAA GK+ G E + + +A R DW+ + G+ L Q+G+ E Sbjct: 93 AIAYPKDRELLAAQGKNQIRNGNFGEAVSVLRKAARLAPTDWEAWNLLGAALDQLGRFDE 152 Query: 157 ALIEYERALELSPNESSIVSNIAMSYLLMGDLKTAEEKLRFASQMIGADSRIRQNLALVV 216 A Y +ALEL+PNE SI +N+ MS LL GDL+ AE L A ADSR+RQNLALVV Sbjct: 153 ARRAYRQALELAPNEPSIANNLGMSLLLRGDLEDAETLLLPAYLSPAADSRVRQNLALVV 212 Query: 217 GLQGRMKEAYSIASQELSPEEATRNIKYIKSILSQRDPWKKIAKA 261 GLQG +EA IA QEL E+A N+ +++ SQ W ++AK Sbjct: 213 GLQGDFREAEDIAVQELLSEQAANNVAALRAAASQSGAWTQLAKK 257 >gnl|CDD|29151 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here. Length = 100 Score = 50.8 bits (121), Expect = 4e-07 Identities = 27/94 (28%), Positives = 43/94 (45%) Query: 105 EVLAAYGKSLANAGYLDEGLDAINRAQRPDIPDWQLISAKGSVLAQMGKHSEALIEYERA 164 E L G G DE L+ +A D + + ++GK+ EAL +YE+A Sbjct: 1 EALLNLGNLYYKLGDYDEALEYYEKALELDPDNADAYYNLAAAYYKLGKYEEALEDYEKA 60 Query: 165 LELSPNESSIVSNIAMSYLLMGDLKTAEEKLRFA 198 LEL P+ + N+ ++Y +G + A E A Sbjct: 61 LELDPDNAKAYYNLGLAYYKLGKYEEALEAYEKA 94 Score = 49.7 bits (118), Expect = 8e-07 Identities = 25/87 (28%), Positives = 46/87 (52%) Query: 139 QLISAKGSVLAQMGKHSEALIEYERALELSPNESSIVSNIAMSYLLMGDLKTAEEKLRFA 198 + + G++ ++G + EAL YE+ALEL P+ + N+A +Y +G + A E A Sbjct: 1 EALLNLGNLYYKLGDYDEALEYYEKALELDPDNADAYYNLAAAYYKLGKYEEALEDYEKA 60 Query: 199 SQMIGADSRIRQNLALVVGLQGRMKEA 225 ++ +++ NL L G+ +EA Sbjct: 61 LELDPDNAKAYYNLGLAYYKLGKYEEA 87 Score = 43.1 bits (101), Expect = 8e-05 Identities = 24/94 (25%), Positives = 43/94 (45%) Query: 77 ADVLRRVGRTAQALAVMRQVAILYPEDQEVLAAYGKSLANAGYLDEGLDAINRAQRPDIP 136 ++ ++G +AL + L P++ + + G +E L+ +A D Sbjct: 7 GNLYYKLGDYDEALEYYEKALELDPDNADAYYNLAAAYYKLGKYEEALEDYEKALELDPD 66 Query: 137 DWQLISAKGSVLAQMGKHSEALIEYERALELSPN 170 + + G ++GK+ EAL YE+ALEL PN Sbjct: 67 NAKAYYNLGLAYYKLGKYEEALEAYEKALELDPN 100 >gnl|CDD|36341 KOG1126, KOG1126, KOG1126, DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning]. Length = 638 Score = 46.2 bits (109), Expect = 9e-06 Identities = 29/130 (22%), Positives = 53/130 (40%), Gaps = 4/130 (3%) Query: 72 IGIVYADVLRRVGRTAQALAVMRQVAILYPEDQEVLAAYGKSLANAGYLDEGLDAINRAQ 131 +G VY + + A ++ + P + +L G+ D+ L +A Sbjct: 495 LGTVY----LKQEKLEFAEFHFQKAVEINPSNSVILCHIGRIQHQLKRKDKALQLYEKAI 550 Query: 132 RPDIPDWQLISAKGSVLAQMGKHSEALIEYERALELSPNESSIVSNIAMSYLLMGDLKTA 191 D + + S+L +G++ EAL E E EL P ESS+ + + Y +G+ A Sbjct: 551 HLDPKNPLCKYHRASILFSLGRYVEALQELEELKELVPQESSVFALLGKIYKRLGNTDLA 610 Query: 192 EEKLRFASQM 201 +A + Sbjct: 611 LLHFSWALDL 620 Score = 38.8 bits (90), Expect = 0.002 Identities = 24/122 (19%), Positives = 52/122 (42%), Gaps = 2/122 (1%) Query: 120 LDEGLDAINRAQRPDIPDWQLISAKGSVLAQMGKHSEALIEYERALELSPNESSIVSNIA 179 D+ + + +A D + G+V + K A +++A+E++P+ S I+ +I Sbjct: 471 FDKAMKSFRKALGVDPRHYNAWYGLGTVYLKQEKLEFAEFHFQKAVEINPSNSVILCHIG 530 Query: 180 MSYLLMGDLKTAEEKLRFASQMIGADSRIRQNLALVVGLQGRMKEAYSIASQ--ELSPEE 237 + A + A + + + + A ++ GR EA + EL P+E Sbjct: 531 RIQHQLKRKDKALQLYEKAIHLDPKNPLCKYHRASILFSLGRYVEALQELEELKELVPQE 590 Query: 238 AT 239 ++ Sbjct: 591 SS 592 Score = 31.5 bits (71), Expect = 0.28 Identities = 24/108 (22%), Positives = 45/108 (41%), Gaps = 4/108 (3%) Query: 139 QLISAKGSVLAQMGKHSEALIEYERALELSPNESSIVSNIAMSYLLMGDLKTAEEKLRFA 198 ++ G + Q+ + +AL YE+A+ L P + A +G A ++L Sbjct: 524 VILCHIGRIQHQLKRKDKALQLYEKAIHLDPKNPLCKYHRASILFSLGRYVEALQELEEL 583 Query: 199 SQMIGADSRIRQNLALVVGLQGRMKEA---YSIASQELSPEEATRNIK 243 +++ +S + L + G A +S A +L P+ A IK Sbjct: 584 KELVPQESSVFALLGKIYKRLGNTDLALLHFSWAL-DLDPKGAQIQIK 630 Score = 29.6 bits (66), Expect = 1.1 Identities = 23/137 (16%), Positives = 51/137 (37%) Query: 47 MNHEQLLEVTSTIGLQYQSHTKNKMIGIVYADVLRRVGRTAQALAVMRQVAILYPEDQEV 106 + E+L + + N +I + ++ R +AL + + L P++ Sbjct: 500 LKQEKLEFAEFHFQKAVEINPSNSVILCHIGRIQHQLKRKDKALQLYEKAIHLDPKNPLC 559 Query: 107 LAAYGKSLANAGYLDEGLDAINRAQRPDIPDWQLISAKGSVLAQMGKHSEALIEYERALE 166 L + G E L + + + + + G + ++G AL+ + AL+ Sbjct: 560 KYHRASILFSLGRYVEALQELEELKELVPQESSVFALLGKIYKRLGNTDLALLHFSWALD 619 Query: 167 LSPNESSIVSNIAMSYL 183 L P + I A+ + Sbjct: 620 LDPKGAQIQIKAAIERM 636 >gnl|CDD|39826 KOG4626, KOG4626, KOG4626, O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism, Posttranslational modification, protein turnover, chaperones, Signal transduction mechanisms]. Length = 966 Score = 44.6 bits (105), Expect = 3e-05 Identities = 27/116 (23%), Positives = 50/116 (43%) Query: 76 YADVLRRVGRTAQALAVMRQVAILYPEDQEVLAAYGKSLANAGYLDEGLDAINRAQRPDI 135 A++L+ G+ ALA+ R L P+ + +L G L+ + A + + Sbjct: 122 LANILKERGQLQDALALYRAAIELKPKFIDAYINLAAALVTQGDLELAVQCFFEALQLNP 181 Query: 136 PDWQLISAKGSVLAQMGKHSEALIEYERALELSPNESSIVSNIAMSYLLMGDLKTA 191 + S G++L G+ EA Y +A+E P + SN+ + G++ A Sbjct: 182 DLYCARSDLGNLLKAEGRLEEAKACYLKAIETQPCFAIAWSNLGCVFNAQGEIWLA 237 Score = 43.1 bits (101), Expect = 8e-05 Identities = 34/157 (21%), Positives = 61/157 (38%) Query: 77 ADVLRRVGRTAQALAVMRQVAILYPEDQEVLAAYGKSLANAGYLDEGLDAINRAQRPDIP 136 A+ L+ G +A+ + L P + + G G ++E +A Sbjct: 327 ANALKDKGSVTEAVDCYNKALRLCPNHADAMNNLGNIYREQGKIEEATRLYLKALEVFPE 386 Query: 137 DWQLISAKGSVLAQMGKHSEALIEYERALELSPNESSIVSNIAMSYLLMGDLKTAEEKLR 196 + S+ Q G +A++ Y+ AL + P + +SN+ +Y MGD+ A + Sbjct: 387 FAAAHNNLASIYKQQGNLDDAIMCYKEALRIKPTFADALSNMGNTYKEMGDVSAAIQCYT 446 Query: 197 FASQMIGADSRIRQNLALVVGLQGRMKEAYSIASQEL 233 A Q+ + NLA + G + EA L Sbjct: 447 RAIQINPTFAEAHSNLASIYKDSGNIPEAIQSYRTAL 483 Score = 41.9 bits (98), Expect = 2e-04 Identities = 34/149 (22%), Positives = 56/149 (37%), Gaps = 4/149 (2%) Query: 79 VLRRVGRTAQALAVMRQVAILYPEDQEVLAAYGKSLANAGYLDEGLDAINRAQR--PDIP 136 +L+ GR +A A + P + G G + + A + P+ Sbjct: 193 LLKAEGRLEEAKACYLKAIETQPCFAIAWSNLGCVFNAQGEIWLAIQHYEEAVKLDPNFL 252 Query: 137 DWQLISAKGSVLAQMGKHSEALIEYERALELSPNESSIVSNIAMSYLLMGDLKTAEEKLR 196 D + G+V + A+ Y RAL L PN + N+A Y G L A + + Sbjct: 253 DAYI--NLGNVYKEARIFDRAVSCYLRALNLRPNHAVAHGNLACIYYEQGLLDLAIDTYK 310 Query: 197 FASQMIGADSRIRQNLALVVGLQGRMKEA 225 A ++ NLA + +G + EA Sbjct: 311 RALELQPNFPDAYNNLANALKDKGSVTEA 339 Score = 40.8 bits (95), Expect = 5e-04 Identities = 24/86 (27%), Positives = 43/86 (50%) Query: 142 SAKGSVLAQMGKHSEALIEYERALELSPNESSIVSNIAMSYLLMGDLKTAEEKLRFASQM 201 S ++L + G+ +AL Y A+EL P N+A + + GDL+ A + A Q+ Sbjct: 120 SNLANILKERGQLQDALALYRAAIELKPKFIDAYINLAAALVTQGDLELAVQCFFEALQL 179 Query: 202 IGADSRIRQNLALVVGLQGRMKEAYS 227 R +L ++ +GR++EA + Sbjct: 180 NPDLYCARSDLGNLLKAEGRLEEAKA 205 Score = 35.4 bits (81), Expect = 0.017 Identities = 29/117 (24%), Positives = 50/117 (42%), Gaps = 7/117 (5%) Query: 145 GSVLAQMGKHSEALIEYERALELSPNESSIVSNIAMSYLLMGDLKTAEEKLRFASQMIGA 204 + + G A+ Y+RALEL PN +N+A + G + A + A ++ Sbjct: 293 ACIYYEQGLLDLAIDTYKRALELQPNFPDAYNNLANALKDKGSVTEAVDCYNKALRLCPN 352 Query: 205 DSRIRQNLALVVGLQGRMKEAYSI--ASQELSPE--EATRNIKYIKSILSQRDPWKK 257 + NL + QG+++EA + + E+ PE A N + SI Q+ Sbjct: 353 HADAMNNLGNIYREQGKIEEATRLYLKALEVFPEFAAAHNN---LASIYKQQGNLDD 406 Score = 27.3 bits (60), Expect = 4.1 Identities = 21/105 (20%), Positives = 39/105 (37%), Gaps = 4/105 (3%) Query: 77 ADVLRRVGRTAQALAVMRQVAILYPEDQEVLAAYGKSLANAGYLDEGLDAINRA--QRPD 134 A + ++ G A+ ++ + P + L+ G + G + + RA P Sbjct: 395 ASIYKQQGNLDDAIMCYKEALRIKPTFADALSNMGNTYKEMGDVSAAIQCYTRAIQINPT 454 Query: 135 IPDWQLISAKGSVLAQMGKHSEALIEYERALELSPNESSIVSNIA 179 + S S+ G EA+ Y AL+L P+ N+ Sbjct: 455 FAEAH--SNLASIYKDSGNIPEAIQSYRTALKLKPDFPDAYCNLL 497 >gnl|CDD|36388 KOG1173, KOG1173, KOG1173, Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning, Posttranslational modification, protein turnover, chaperones]. Length = 611 Score = 43.0 bits (101), Expect = 9e-05 Identities = 31/151 (20%), Positives = 61/151 (40%), Gaps = 10/151 (6%) Query: 93 MRQVAILYPEDQEVLAAYGKSLANAGYLDEGLD------AINRAQRPDIPDWQ-LISAKG 145 +Q + P D VL G E L + ++ + W+ ++ G Sbjct: 403 FKQALAIAPSDPLVLHELGVVAYTYEEYPEALKYFQKALEVIKSVLNEKIFWEPTLNNLG 462 Query: 146 SVLAQMGKHSEALIEYERALELSPNESSIVSNIAMSYLLMGDLKTAEEKLRFASQMIGAD 205 ++ K+ EA+ Y++AL LSP ++S ++I Y L+G+L A + A + + Sbjct: 463 HAYRKLNKYEEAIDYYQKALLLSPKDASTHASIGYIYHLLGNLDKAIDHFHKALALKPDN 522 Query: 206 SRIRQNLALVVGLQGRMKEAYSIASQELSPE 236 I + L L + + + S++ Sbjct: 523 IFISELLKLAIED---SECKSGVDSKDYITC 550 >gnl|CDD|39364 KOG4162, KOG4162, KOG4162, Predicted calmodulin-binding protein [Signal transduction mechanisms]. Length = 799 Score = 42.7 bits (100), Expect = 1e-04 Identities = 31/155 (20%), Positives = 60/155 (38%), Gaps = 19/155 (12%) Query: 75 VYADVLRRVGRTAQALAVMRQVAILYPEDQEVLAAYGKSLANAGYLDEGLDAINRAQRPD 134 + R+ + L ++ L + L GYL G+ +A++ + Sbjct: 399 ASKLCIERLKLVEEGLDYAQKAISLLGGQRSHLKP-------RGYLFLGIAYGFQARQAN 451 Query: 135 IPDWQLISAKGSVLAQMGKHSEALIEYERALELSPNESSIVSNIAMSYLLMGDLKTAEEK 194 + + H ++L E A++ P + ++ +A+ Y L +A + Sbjct: 452 LKS-----------ERDALHKKSLQALEEAVQFDPTDPLVIFYLALQYAEQRQLTSALDY 500 Query: 195 LRFASQMIGADS-RIRQNLALVVGLQGRMKEAYSI 228 R A + DS + LALV+ Q R+KEA + Sbjct: 501 AREALALNRGDSAKAWHLLALVLSAQKRLKEALDV 535 Score = 29.6 bits (66), Expect = 1.0 Identities = 21/87 (24%), Positives = 31/87 (35%), Gaps = 8/87 (9%) Query: 144 KGSVLAQMGKHSEALIEYERALELSPNESSIVSNIAMSYLLMGDLKTAEEKLRFASQMIG 203 + G S+A+ +L+ S S I + S L + LK EE L +A + I Sbjct: 363 LALSYSAAGSDSKAVNLLRESLKKSEQPSDISVLLMASKLCIERLKLVEEGLDYAQKAIS 422 Query: 204 A--------DSRIRQNLALVVGLQGRM 222 R L + G Q R Sbjct: 423 LLGGQRSHLKPRGYLFLGIAYGFQARQ 449 >gnl|CDD|36340 KOG1125, KOG1125, KOG1125, TPR repeat-containing protein [General function prediction only]. Length = 579 Score = 41.2 bits (96), Expect = 3e-04 Identities = 40/180 (22%), Positives = 72/180 (40%), Gaps = 6/180 (3%) Query: 73 GIVYADVLRRVGRTAQALAVMRQVAILYPEDQEVLAAYGKSLANAGYLDEGLDAINRAQR 132 + + L + L RQ+ D +V + G +G D +D A + Sbjct: 403 SFLDSSHLAHI--QELFLEAARQLPT--KIDPDVQSGLGVLYNLSGEFDRAVDCFEAALQ 458 Query: 133 PDIPDWQLISAKGSVLAQMGKHSEALIEYERALELSPNESSIVSNIAMSYLLMGDLKTAE 192 D+ L + G+ LA + EA+ Y RAL+L P + N+ +S + +G K A Sbjct: 459 VKPNDYLLWNRLGATLANGNRSEEAISAYNRALQLQPGYVRVRYNLGISCMNLGAYKEAV 518 Query: 193 EKLRFASQMIGADSRIRQNLALVVGLQGRMKEAYSIASQELSPEEA--TRNIKYIKSILS 250 + L A M + + ++ A S ++ +EA +RN+ +K+ S Sbjct: 519 KHLLEALSMQRKSRNHNKAPMASENIWQTLRLALSAMNRSDLLQEAAPSRNLSALKAEFS 578 Score = 26.9 bits (59), Expect = 5.5 Identities = 13/45 (28%), Positives = 19/45 (42%), Gaps = 3/45 (6%) Query: 138 WQLISAKGSVLAQMGKHSEALIEYERALELSPNESSIVSNIAMSY 182 WQ + G A+ A+ R LEL P + +A+SY Sbjct: 322 WQKL---GITQAENENEQNAISALRRCLELDPTNLEALMALAVSY 363 >gnl|CDD|36371 KOG1156, KOG1156, KOG1156, N-terminal acetyltransferase [Chromatin structure and dynamics]. Length = 700 Score = 40.3 bits (94), Expect = 6e-04 Identities = 32/147 (21%), Positives = 62/147 (42%), Gaps = 6/147 (4%) Query: 88 QALAVMRQVAILYPEDQEVLAAYGKSLANAGYLDEGLDAINRAQRPDIPDWQLISAKGSV 147 + L +++Q+ +PE E LA G +L G +E + + R D+ G + Sbjct: 25 KGLKLIKQILKKFPEHGESLAMKGLTLNCLGKKEEAYELVRLGLRNDLKSHVCWHVLGLL 84 Query: 148 LAQMGKHSEALIEYERALELSPNESSIVSNIAMSYLLMGDLKTAEEKLRFASQMIGADSR 207 K+ EA+ Y AL++ + I+ ++++ + M D + E +Q++ Sbjct: 85 QRSDKKYDEAIKCYRNALKIEKDNLQILRDLSLLQIQMRDYEGYLET---RNQLLQLRPS 141 Query: 208 IRQN---LALVVGLQGRMKEAYSIASQ 231 R + A+ L G K A I + Sbjct: 142 QRASWIGFAVAQHLLGEYKMALEILEE 168 >gnl|CDD|37287 KOG2076, KOG2076, KOG2076, RNA polymerase III transcription factor TFIIIC [Transcription]. Length = 895 Score = 39.6 bits (92), Expect = 9e-04 Identities = 27/128 (21%), Positives = 52/128 (40%), Gaps = 1/128 (0%) Query: 77 ADVLRRVGRTAQALAVMRQVAILYPEDQEVLAAYGKSLANAGYLDEGLDAINRAQRPDIP 136 ++ + G +AL A L P+D E+ G +++ +RA + + Sbjct: 180 GEIYEQRGDIEKALNFWLLAAHLNPKDYELWKRLADLSEQLGNINQARYCYSRAIQANPS 239 Query: 137 DWQLISAKGSVLAQMGKHSEALIEYERALELSPNESSIVSNIAMSYLLMGDLKTAEEKLR 196 +W+LI + S+ + G A+ + + L+L P I + + T E+ R Sbjct: 240 NWELIYERSSLYQKTGDLKRAMETFLQLLQLDPP-VDIERIEDLIRRVAHYFITHNERER 298 Query: 197 FASQMIGA 204 A + GA Sbjct: 299 AAKALEGA 306 Score = 31.5 bits (71), Expect = 0.28 Identities = 18/73 (24%), Positives = 32/73 (43%) Query: 137 DWQLISAKGSVLAQMGKHSEALIEYERALELSPNESSIVSNIAMSYLLMGDLKTAEEKLR 196 D++L + Q+G ++A Y RA++ +P+ ++ + Y GDLK A E Sbjct: 206 DYELWKRLADLSEQLGNINQARYCYSRAIQANPSNWELIYERSSLYQKTGDLKRAMETFL 265 Query: 197 FASQMIGADSRIR 209 Q+ R Sbjct: 266 QLLQLDPPVDIER 278 >gnl|CDD|36389 KOG1174, KOG1174, KOG1174, Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning, Posttranslational modification, protein turnover, chaperones]. Length = 564 Score = 37.7 bits (87), Expect = 0.004 Identities = 25/133 (18%), Positives = 54/133 (40%) Query: 75 VYADVLRRVGRTAQALAVMRQVAILYPEDQEVLAAYGKSLANAGYLDEGLDAINRAQRPD 134 +YA +L + G Q A+M + + + L + + L+ + + + Sbjct: 271 LYAVLLGQEGGCEQDSALMDYLFAKVKYTASHWFVHAQLLYDEKKFERALNFVEKCIDSE 330 Query: 135 IPDWQLISAKGSVLAQMGKHSEALIEYERALELSPNESSIVSNIAMSYLLMGDLKTAEEK 194 + + + KG +L + +H++A+I + A L+P I + SYL K A Sbjct: 331 PRNHEALILKGRLLIALERHTQAVIAFRTAQMLAPYRLEIYRGLFHSYLAQKRFKEANAL 390 Query: 195 LRFASQMIGADSR 207 + ++ +R Sbjct: 391 ANWTIRLFQNSAR 403 >gnl|CDD|35767 KOG0547, KOG0547, KOG0547, Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport]. Length = 606 Score = 37.3 bits (86), Expect = 0.005 Identities = 18/50 (36%), Positives = 27/50 (54%) Query: 144 KGSVLAQMGKHSEALIEYERALELSPNESSIVSNIAMSYLLMGDLKTAEE 193 KG+ + K+ EA+ Y +A+EL P+E SN A Y +GD + E Sbjct: 121 KGNKFFRNKKYDEAIKYYTQAIELCPDEPIFYSNRAACYESLGDWEKVIE 170 Score = 26.1 bits (57), Expect = 9.5 Identities = 13/56 (23%), Positives = 26/56 (46%) Query: 120 LDEGLDAINRAQRPDIPDWQLISAKGSVLAQMGKHSEALIEYERALELSPNESSIV 175 +++ + + +A D Q Q GK EA+ +E++ +L+ ES +V Sbjct: 519 INQAENLLRKAIELDPKCEQAYETLAQFELQRGKIDEAIELFEKSAQLARTESEMV 574 >gnl|CDD|35773 KOG0553, KOG0553, KOG0553, TPR repeat-containing protein [General function prediction only]. Length = 304 Score = 35.8 bits (82), Expect = 0.012 Identities = 21/85 (24%), Positives = 39/85 (45%) Query: 141 ISAKGSVLAQMGKHSEALIEYERALELSPNESSIVSNIAMSYLLMGDLKTAEEKLRFASQ 200 + +G+ L + + EA+ +Y A+EL P + N A +Y +G+ + A + A Sbjct: 84 LKNEGNKLMKNKDYQEAVDKYTEAIELDPTNAVYYCNRAAAYSKLGEYEDAVKDCESALS 143 Query: 201 MIGADSRIRQNLALVVGLQGRMKEA 225 + S+ L L G+ +EA Sbjct: 144 IDPHYSKAYGRLGLAYLALGKYEEA 168 Score = 30.4 bits (68), Expect = 0.55 Identities = 28/116 (24%), Positives = 46/116 (39%), Gaps = 15/116 (12%) Query: 118 GYLDEGLDAINRAQRPDIPDWQLISAKGSVLAQMGKHSEALIEYERALELSPNESSIVSN 177 G ++ + A D + G +GK+ EA+ Y++ALEL P+ S SN Sbjct: 129 GEYEDAVKDCESALSIDPHYSKAYGRLGLAYLALGKYEEAIEAYKKALELDPDNESYKSN 188 Query: 178 IAMSYLLMGDLKTAEEKLRFASQMIGADSRIRQNLALVVGLQGRMKEAYSIASQEL 233 LK AE+KL + + GL G ++ S+ + +L Sbjct: 189 ----------LKIAEQKLN---EPKSSAQASGSFDM--AGLIGAFPDSRSMFNGDL 229 >gnl|CDD|34394 COG4783, COG4783, Putative Zn-dependent protease, contains TPR repeats [General function prediction only]. Length = 484 Score = 35.7 bits (82), Expect = 0.015 Identities = 26/133 (19%), Positives = 46/133 (34%), Gaps = 23/133 (17%) Query: 77 ADVLRRVGRTAQALAVMRQVAILYPEDQEVLAAYGKSLANAGYLDEGLDAINRA--QRPD 134 D+L + +A+ +++ L P + ++L G E + +NR P+ Sbjct: 347 GDILLEANKAKEAIERLKKALALDPNSPLLQLNLAQALLKGGKPQEAIRILNRYLFNDPE 406 Query: 135 IPD-WQLISAKGSVLAQMGKHSEALIEYERALELSPNESSIVSNIAMSYLLMGDLKTAEE 193 P+ W L++ + L + A E Y L G L+ A Sbjct: 407 DPNGWDLLAQAYAELGNRAEALLARAEG--------------------YALAGRLEQAII 446 Query: 194 KLRFASQMIGADS 206 L ASQ + Sbjct: 447 FLMRASQQVKLGF 459 >gnl|CDD|35843 KOG0624, KOG0624, KOG0624, dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms]. Length = 504 Score = 35.0 bits (80), Expect = 0.021 Identities = 29/96 (30%), Positives = 41/96 (42%) Query: 101 PEDQEVLAAYGKSLANAGYLDEGLDAINRAQRPDIPDWQLISAKGSVLAQMGKHSEALIE 160 P D E GK L G L + L + A D ++Q I + +V MGK AL + Sbjct: 35 PADVEKHLELGKELLARGQLSDALTHYHAAVEGDPNNYQAIFRRATVYLAMGKSKAALQD 94 Query: 161 YERALELSPNESSIVSNIAMSYLLMGDLKTAEEKLR 196 R LEL P+ + + L G+L+ AE Sbjct: 95 LSRVLELKPDFMAARIQRGVVLLKQGELEQAEADFD 130 Score = 26.9 bits (59), Expect = 5.9 Identities = 26/152 (17%), Positives = 61/152 (40%), Gaps = 16/152 (10%) Query: 77 ADVLRRVGRTAQALAVMRQVAILYPEDQEVLAAYG------KSLANAGYLDEG---LDAI 127 + +L VG +L +R+ L P+ + Y KSL +A E + + Sbjct: 230 SQLLYTVGDAENSLKEIRECLKLDPDHKLCFPFYKKLKKVVKSLESAEQAIEEKHWTECL 289 Query: 128 NRAQR-----PDIPDWQLISAK--GSVLAQMGKHSEALIEYERALELSPNESSIVSNIAM 180 ++ P+ + + + + + EA+ + + L++ P++ ++ + A Sbjct: 290 EAGEKVLKNEPEETMIRYNGFRVLCTCYREDEQFGEAIQQCKEVLDIDPDDVQVLCDRAE 349 Query: 181 SYLLMGDLKTAEEKLRFASQMIGADSRIRQNL 212 +YL A A ++ +++R R+ L Sbjct: 350 AYLGDEMYDDAIHDYEKALELNESNTRAREGL 381 >gnl|CDD|37213 KOG2002, KOG2002, KOG2002, TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism]. Length = 1018 Score = 34.6 bits (79), Expect = 0.028 Identities = 29/130 (22%), Positives = 56/130 (43%), Gaps = 2/130 (1%) Query: 88 QALAVMRQVAILYPEDQEVLAAYGKSLANAGYLDEGLDAINRAQRPDIPDWQLISAKGSV 147 +AL + +V P++ G LA G E D ++ + + Sbjct: 630 KALQLYGKVLRNDPKNMYAANGIGIVLAEKGRFSEARDIFSQVREATSDFEDVWLNLAHC 689 Query: 148 LAQMGKHSEALIEYERALE--LSPNESSIVSNIAMSYLLMGDLKTAEEKLRFASQMIGAD 205 + G++ A+ YE L+ N S ++ +A ++ G L+ A+E L A + ++ Sbjct: 690 YVEQGQYRLAIQMYENCLKKFYKKNRSEVLHYLARAWYEAGKLQEAKEALLKARHLAPSN 749 Query: 206 SRIRQNLALV 215 + ++ NLALV Sbjct: 750 TSVKFNLALV 759 >gnl|CDD|32877 COG3063, PilF, Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion]. Length = 250 Score = 34.2 bits (78), Expect = 0.039 Identities = 35/137 (25%), Positives = 52/137 (37%), Gaps = 6/137 (4%) Query: 75 VYADVLRRVGRTAQALAVMRQVAILYPEDQEVLAAYGKSLANAGYLDEGLDAINRAQRPD 134 V A +++G A R+ L P + +VL YG L G +E + RA Sbjct: 74 VRAHYYQKLGENDLADESYRKALSLAPNNGDVLNNYGAFLCAQGRPEEAMQQFERAL--A 131 Query: 135 IPDWQLISA----KGSVLAQMGKHSEALIEYERALELSPNESSIVSNIAMSYLLMGDLKT 190 P + S G + G+ +A +RALEL P + +A + GD Sbjct: 132 DPAYGEPSDTLENLGLCALKAGQFDQAEEYLKRALELDPQFPPALLELARLHYKAGDYAP 191 Query: 191 AEEKLRFASQMIGADSR 207 A L Q GA + Sbjct: 192 ARLYLERYQQRGGAQAE 208 Score = 29.6 bits (66), Expect = 1.0 Identities = 22/84 (26%), Positives = 36/84 (42%) Query: 150 QMGKHSEALIEYERALELSPNESSIVSNIAMSYLLMGDLKTAEEKLRFASQMIGADSRIR 209 Q G +++A E+ALE P+ A Y +G+ A+E R A + + + Sbjct: 47 QQGDYAQAKKNLEKALEHDPSYYLAHLVRAHYYQKLGENDLADESYRKALSLAPNNGDVL 106 Query: 210 QNLALVVGLQGRMKEAYSIASQEL 233 N + QGR +EA + L Sbjct: 107 NNYGAFLCAQGRPEEAMQQFERAL 130 Score = 26.5 bits (58), Expect = 8.0 Identities = 28/125 (22%), Positives = 47/125 (37%), Gaps = 11/125 (8%) Query: 118 GYLDEGLDAINR-------AQRPDIPDWQLISAKGSVLAQMGKHSEALIEYERALELSPN 170 GYL +G A + P L+ A ++G++ A Y +AL L+PN Sbjct: 44 GYLQQGDYAQAKKNLEKALEHDPSYYLAHLVRA--HYYQKLGENDLADESYRKALSLAPN 101 Query: 171 ESSIVSNIAMSYLLMGDLKTAEEKLRFASQ--MIGADSRIRQNLALVVGLQGRMKEAYSI 228 +++N G + A ++ A G S +NL L G+ +A Sbjct: 102 NGDVLNNYGAFLCAQGRPEEAMQQFERALADPAYGEPSDTLENLGLCALKAGQFDQAEEY 161 Query: 229 ASQEL 233 + L Sbjct: 162 LKRAL 166 >gnl|CDD|33959 COG4235, COG4235, Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones]. Length = 287 Score = 33.8 bits (77), Expect = 0.047 Identities = 23/108 (21%), Positives = 37/108 (34%), Gaps = 3/108 (2%) Query: 87 AQALAVMRQVAILYPEDQEVLAAYGKSLANAGYLDEGLDAINRAQRPDIPDWQLISAKGS 146 +A + P D E G++ G + L A A R + +++ Sbjct: 139 EALIARLETHLQQNPGDAEGWDLLGRAYMALGRASDALLAYRNALRLAGDNPEILLGLAE 198 Query: 147 VL-AQMGKHSEALIE--YERALELSPNESSIVSNIAMSYLLMGDLKTA 191 L Q G+ A +AL L P +S +A + GD A Sbjct: 199 ALYYQAGQQMTAKARALLRQALALDPANIRALSLLAFAAFEQGDYAEA 246 Score = 32.6 bits (74), Expect = 0.12 Identities = 33/131 (25%), Positives = 50/131 (38%), Gaps = 9/131 (6%) Query: 130 AQRP-DIPDWQLISAKGSVLAQMGKHSEALIEYERALELSPNESSIVSNIAMSYLLMGDL 188 Q P D W L+ G +G+ S+AL+ Y AL L+ + I+ +A + Sbjct: 150 QQNPGDAEGWDLL---GRAYMALGRASDALLAYRNALRLAGDNPEILLGLAEALYYQAGQ 206 Query: 189 KT---AEEKLRFASQMIGADSRIRQNLALVVGLQGRMKEAYSIASQ--ELSPEEATRNIK 243 + A LR A + A+ R LA QG EA + +L P + R Sbjct: 207 QMTAKARALLRQALALDPANIRALSLLAFAAFEQGDYAEAAAAWQMLLDLLPADDPRRSL 266 Query: 244 YIKSILSQRDP 254 +SI Sbjct: 267 IERSIARALAQ 277 >gnl|CDD|37264 KOG2053, KOG2053, KOG2053, Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton]. Length = 932 Score = 33.8 bits (77), Expect = 0.056 Identities = 25/107 (23%), Positives = 44/107 (41%), Gaps = 1/107 (0%) Query: 83 VGRTAQALAVMRQVAILYPEDQEVLAAYGKSLANAGYLDEGLDAINRAQRPDIPDWQLIS 142 + +ALA + ++ +P SL G DE L + D + Sbjct: 22 SSQFKKALAKLGKLLKKHPNALYAKVLKALSLFRLGKGDEALKLLEALYGLKGTDDLTLQ 81 Query: 143 AKGSVLAQMGKHSEALIEYERALELSPNESSIVSNIAMSYLLMGDLK 189 +V +GK EA+ YERA + P+E ++ ++ M+Y+ K Sbjct: 82 FLQNVYRDLGKLDEAVHLYERANQKYPSE-ELLYHLFMAYVREKSYK 127 >gnl|CDD|38270 KOG3060, KOG3060, KOG3060, Uncharacterized conserved protein [Function unknown]. Length = 289 Score = 33.8 bits (77), Expect = 0.057 Identities = 32/151 (21%), Positives = 60/151 (39%), Gaps = 11/151 (7%) Query: 48 NHEQLLEVTSTIGLQYQSHTKNKMIGIVYADVLRRV-------GRTAQALAVMRQVAILY 100 N E++++ +G + +++K+ +G + +V GR A + Q+ + Sbjct: 27 NSEEVVQ----LGSEVLNYSKSGALGDEIWTLYEQVFIAALDTGRDDLAQKCINQLRDRF 82 Query: 101 PEDQEVLAAYGKSLANAGYLDEGLDAINRAQRPDIPDWQLISAKGSVLAQMGKHSEALIE 160 P + V L G E ++ D D + K ++L GK+ EA+ E Sbjct: 83 PGSKRVGKLKAMLLEATGNYKEAIEYYESLLEDDPTDTVIRKRKLAILKAQGKNLEAIKE 142 Query: 161 YERALELSPNESSIVSNIAMSYLLMGDLKTA 191 L+ N+ +A YL GD + A Sbjct: 143 LNEYLDKFMNDQEAWHELAEIYLSEGDFEKA 173 >gnl|CDD|34549 COG4941, COG4941, Predicted RNA polymerase sigma factor containing a TPR repeat domain [Transcription]. Length = 415 Score = 33.0 bits (75), Expect = 0.096 Identities = 16/54 (29%), Positives = 29/54 (53%), Gaps = 2/54 (3%) Query: 121 DEGLDAINRA-QRPDIPDWQLI-SAKGSVLAQMGKHSEALIEYERALELSPNES 172 GL + RP + + L +A+ +LA++G+ EA Y+RA+ L+ N + Sbjct: 346 AAGLAMVEALLARPRLDGYHLYHAARADLLARLGRVEEARAAYDRAIALARNAA 399 >gnl|CDD|176974 CHL00033, ycf3, photosystem I assembly protein Ycf3. Length = 168 Score = 32.3 bits (74), Expect = 0.14 Identities = 16/56 (28%), Positives = 28/56 (50%), Gaps = 7/56 (12%) Query: 145 GSVLAQMGKHSEALIEYERALELSPNESSIVSNIAMSY-------LLMGDLKTAEE 193 G + G+H++AL Y +ALE +P ++N+A+ + GD + AE Sbjct: 79 GLIHTSNGEHTKALEYYFQALERNPFLPQALNNMAVICHYRGEQAIEQGDSEIAEA 134 >gnl|CDD|39841 KOG4642, KOG4642, KOG4642, Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones]. Length = 284 Score = 32.3 bits (73), Expect = 0.16 Identities = 19/82 (23%), Positives = 36/82 (43%), Gaps = 4/82 (4%) Query: 153 KHSEALIEYERALELSPNESSIVSNIAMSYLLMGDLKTAEEKLRFASQMIGADSRIRQNL 212 ++ +A+ Y RA+ ++P +S +N A+ +L + + EE R A Q+ + L Sbjct: 25 RYDDAIDCYSRAICINPTVASYYTNRALCHLKLKHWEPVEEDCRRALQLDPNLVKAHYFL 84 Query: 213 ALVVGLQGRMKEAYSIASQELS 234 G + Y A + L Sbjct: 85 ----GQWLLQSKGYDEAIKVLQ 102 >gnl|CDD|144197 pfam00515, TPR_1, Tetratricopeptide repeat. Length = 34 Score = 32.0 bits (74), Expect = 0.18 Identities = 13/27 (48%), Positives = 20/27 (74%) Query: 144 KGSVLAQMGKHSEALIEYERALELSPN 170 G+ ++GK+ EA+ YE+ALEL+PN Sbjct: 7 LGNAYFKLGKYDEAIEYYEKALELNPN 33 >gnl|CDD|35763 KOG0543, KOG0543, KOG0543, FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones]. Length = 397 Score = 31.5 bits (71), Expect = 0.24 Identities = 15/81 (18%), Positives = 35/81 (43%), Gaps = 3/81 (3%) Query: 147 VLAQMGKHSEALIEYERALELSPNESSIVSNIAMSYLLMGDLKTAEEKLRFASQMIGADS 206 ++ ++ EA+ + LEL PN + + L +G+ A + + A ++ ++ Sbjct: 266 CYLKLKEYKEAIESCNKVLELDPNNVKALYRRGQALLALGEYDLARDDFQKALKLEPSNK 325 Query: 207 RIRQNLALVVGLQGRMKEAYS 227 R L L+ +++E Sbjct: 326 AARAELIK---LKQKIREYEE 343 >gnl|CDD|35768 KOG0548, KOG0548, KOG0548, Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones]. Length = 539 Score = 31.5 bits (71), Expect = 0.25 Identities = 15/49 (30%), Positives = 26/49 (53%) Query: 143 AKGSVLAQMGKHSEALIEYERALELSPNESSIVSNIAMSYLLMGDLKTA 191 KG+ + G + EA+ Y A++ P ++ + SN A YL +G+ A Sbjct: 363 EKGNEAFKKGDYPEAVKHYTEAIKRDPEDARLYSNRAACYLKLGEYPEA 411 >gnl|CDD|39847 KOG4648, KOG4648, KOG4648, Uncharacterized conserved protein, contains LRR repeats [Function unknown]. Length = 536 Score = 31.3 bits (70), Expect = 0.29 Identities = 16/53 (30%), Positives = 26/53 (49%) Query: 141 ISAKGSVLAQMGKHSEALIEYERALELSPNESSIVSNIAMSYLLMGDLKTAEE 193 I +G+ + GK+ EA+ Y A+ + P+ N A++YL AEE Sbjct: 100 IKERGNTYFKQGKYEEAIDCYSTAIAVYPHNPVYHINRALAYLKQKSFAQAEE 152 >gnl|CDD|37051 KOG1840, KOG1840, KOG1840, Kinesin light chain [Cytoskeleton]. Length = 508 Score = 31.1 bits (70), Expect = 0.34 Identities = 28/116 (24%), Positives = 48/116 (41%), Gaps = 9/116 (7%) Query: 95 QVAILYPEDQEVLAAYGKSLANAGYLDEGLDAINRAQRPDIPDWQ-LISAKGSVLAQMGK 153 VA + GK Y + L+ + P+ +S ++L M + Sbjct: 281 AVAATLNNLAVLYYKQGKFAEAEEYCERALEIYEKLLGASHPEVAAQLSELAAILQSMNE 340 Query: 154 HSEALIEYERALEL--------SPNESSIVSNIAMSYLLMGDLKTAEEKLRFASQM 201 + EA ++AL++ + N + I +N+A YL MG K AEE + A Q+ Sbjct: 341 YEEAKKLLQKALKIYLDAPGEDNVNLAKIYANLAELYLKMGKYKEAEELYKKAIQI 396 >gnl|CDD|36343 KOG1128, KOG1128, KOG1128, Uncharacterized conserved protein, contains TPR repeats [General function prediction only]. Length = 777 Score = 30.8 bits (69), Expect = 0.42 Identities = 14/56 (25%), Positives = 27/56 (48%) Query: 143 AKGSVLAQMGKHSEALIEYERALELSPNESSIVSNIAMSYLLMGDLKTAEEKLRFA 198 G Q+ K A+ + R + L P+ + +N++ +Y+ + K A KL+ A Sbjct: 524 GLGCAALQLEKEQAAVKAFHRCVTLEPDNAEAWNNLSTAYIRLKKKKRAFRKLKEA 579 Score = 26.9 bits (59), Expect = 5.6 Identities = 20/62 (32%), Positives = 28/62 (45%), Gaps = 8/62 (12%) Query: 135 IPDWQLISAKGSVLAQMGKHSEALIEYERALELSPNESSIVSNIAMSYLLMGDLKTAEEK 194 P WQL +L +G AL+ +ER LE+ + + YLL+G AEE Sbjct: 395 PPIWQLQRLLAELLLSLGITKSALVIFER-LEM-------WDPVILCYLLLGQHGKAEEI 446 Query: 195 LR 196 R Sbjct: 447 NR 448 >gnl|CDD|38989 KOG3785, KOG3785, KOG3785, Uncharacterized conserved protein [Function unknown]. Length = 557 Score = 30.0 bits (67), Expect = 0.82 Identities = 22/75 (29%), Positives = 34/75 (45%), Gaps = 1/75 (1%) Query: 157 ALIEYERALELSPNESSIVSNIAMSYLLMGDLKTAEEKLRFASQMIGADSRIRQNLALVV 216 +L+E++ L+ E S+ IA Y +GD + A F A + + NLA Sbjct: 43 SLLEFKLNLD-REEEDSLQLWIAHCYFHLGDYEEALNVYTFLMNKDDAPAELGVNLACCK 101 Query: 217 GLQGRMKEAYSIASQ 231 G+ EA SIA + Sbjct: 102 FYLGQYIEAKSIAEK 116 >gnl|CDD|34316 COG4700, COG4700, Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown]. Length = 251 Score = 29.6 bits (66), Expect = 1.0 Identities = 17/71 (23%), Positives = 25/71 (35%), Gaps = 6/71 (8%) Query: 74 IVYADVLRRVGRTAQALAVMRQVAILYPEDQEVLAAYGKSLANAGYLDEGLDAINRAQRP 133 +++A L G+ A A + YP + Y + LA G L E AQ Sbjct: 164 LLFARTLAAQGKYADAESAFEVAISYYP-GPQARIYYAEMLAKQGRLREA-----NAQYV 217 Query: 134 DIPDWQLISAK 144 + D S Sbjct: 218 AVVDTAKRSRP 228 Score = 26.9 bits (59), Expect = 6.8 Identities = 35/195 (17%), Positives = 76/195 (38%), Gaps = 35/195 (17%) Query: 96 VAILYPE------DQEVLAAYGKSLANAGYLDEGLDAINRAQRPDIPDWQLISAKGSVLA 149 VA++ PE +L A + L +L E + + A P Q + LA Sbjct: 46 VAVMLPELGADRHAHTLLMALQQKLDPERHLREATEELAIA-----PTVQNRYRLANALA 100 Query: 150 QMGKHSEALIEYERALE-LSPNESSIVSNIAMSYLLMGDLKTAEEKL----------RFA 198 ++G++ EA+ Y++AL + ++++++ +A + + + A++ L R Sbjct: 101 ELGRYHEAVPHYQQALSGIFAHDAAMLLGLAQAQFAIQEFAAAQQTLEDLMEYNPAFRSP 160 Query: 199 SQMI-------------GADSRIRQNLALVVGLQGRMKEAYSIASQELSPEEATRNIKYI 245 + A+S ++ G Q R+ A +A Q E + + + Sbjct: 161 DGHLLFARTLAAQGKYADAESAFEVAISYYPGPQARIYYAEMLAKQGRLREANAQYVAVV 220 Query: 246 KSILSQRDPWKKIAK 260 + R ++K + Sbjct: 221 DTAKRSRPHYRKHHR 235 >gnl|CDD|48214 cd03402, Band_7_2, A subgroup of the band 7 domain of flotillin (reggie) like proteins. This subgroup contains proteins similar to stomatin, prohibitin, flotillin, HlfK/C and podicin. Many of these band 7 domain-containing proteins are lipid raft-associated. Individual proteins of this band 7 domain family may cluster to form membrane microdomains which may in turn recruit multiprotein complexes. Microdomains formed from flotillin proteins may in addition be dynamic units with their own regulatory functions. Flotillins have been implicated in signal transduction, vesicle trafficking, cytoskeleton rearrangement and are known to interact with a variety of proteins. Stomatin interacts with and regulates members of the degenerin/epithelia Na+ channel family in mechanosensory cells of Caenorhabditis elegans and vertebrate neurons and participates in trafficking of Glut1 glucose transporters. Prohibitin may act as a chaperone for the stabilization of mitochondrial proteins. Prokaryotic HflK/C plays a role in the decision between lysogenic and lytic cycle growth during lambda phage infection. Flotillins have been implicated in the progression of prion disease, in the pathogenesis of neurodegenerative diseases such as Parkinson's and Alzheimer's disease and, in cancer invasion and metastasis. Mutations in the podicin gene give rise to autosomal recessive steroid resistant nephritic syndrome.. Length = 219 Score = 29.5 bits (66), Expect = 1.1 Identities = 22/92 (23%), Positives = 43/92 (46%), Gaps = 6/92 (6%) Query: 88 QALAVMRQVAILYPEDQEVLAAYGKSLANAGYLDEGLDAINR--AQRPDIPDWQLISAKG 145 Q+ + +R VA YP D V K + G DE D + R +R + +++ A+ Sbjct: 92 QSESALRHVASQYPYDDPV----NKETSLRGNSDEVSDELARELQERLAVAGVEVVEARI 147 Query: 146 SVLAQMGKHSEALIEYERALELSPNESSIVSN 177 + LA + ++A+++ ++A + IV Sbjct: 148 THLAYAPEIAQAMLQRQQASAIIAARRKIVEG 179 >gnl|CDD|32795 COG2976, COG2976, Uncharacterized protein conserved in bacteria [Function unknown]. Length = 207 Score = 29.5 bits (66), Expect = 1.1 Identities = 21/96 (21%), Positives = 38/96 (39%), Gaps = 10/96 (10%) Query: 84 GRTAQALAVMRQVAILYPEDQEVLAA----YGKSLANAGYLDEGLDAINRAQRPDIPDWQ 139 +A A ++Q A+ +D+ + A + D L ++ + W Sbjct: 103 NNLDKAEAQLKQ-ALAQTKDENLKALAALRLARVQLQQKKADAALKTLDTIKEES---WA 158 Query: 140 LISA--KGSVLAQMGKHSEALIEYERALELSPNESS 173 I A +G +L G EA YE+ALE + ++ Sbjct: 159 AIVAELRGDILLAKGDKQEARAAYEKALESDASPAA 194 >gnl|CDD|35559 KOG0338, KOG0338, KOG0338, ATP-dependent RNA helicase [RNA processing and modification]. Length = 691 Score = 28.4 bits (63), Expect = 2.0 Identities = 27/96 (28%), Positives = 43/96 (44%), Gaps = 11/96 (11%) Query: 80 LRRVGRTAQALAVMRQVAILYPEDQEVLAAYGKSLANAGYLDEGLDAINRAQRPDIPDWQ 139 L RVGRTA+A R V ++ D+++L KS AG NR + Sbjct: 511 LHRVGRTARAGRAGRSVTLVGESDRKLLKEIIKSSTKAGS-----KLKNR-----NIPPE 560 Query: 140 LISAKGSVLAQMGKHSEALIEYERA-LELSPNESSI 174 +I + +M +A+++ ER ELS E+ + Sbjct: 561 VIEKFRKKIEEMEDTIQAVLDEEREEKELSKAEAQL 596 >gnl|CDD|37214 KOG2003, KOG2003, KOG2003, TPR repeat-containing protein [General function prediction only]. Length = 840 Score = 28.5 bits (63), Expect = 2.1 Identities = 14/56 (25%), Positives = 29/56 (51%), Gaps = 5/56 (8%) Query: 145 GSVLAQMGKHSEALIEYERALELSPNESSIVSNIAMSYLLMGDLKTAEEKLRFASQ 200 G Q G++ +A+ ++ +E +PN + + N+ + +GD EK++ A Q Sbjct: 283 GVTFIQAGQYDDAINSFDHCMEEAPNFIAAL-NLIICAFAIGD----AEKMKEAFQ 333 >gnl|CDD|36370 KOG1155, KOG1155, KOG1155, Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning, Posttranslational modification, protein turnover, chaperones]. Length = 559 Score = 27.6 bits (61), Expect = 3.3 Identities = 16/56 (28%), Positives = 29/56 (51%) Query: 152 GKHSEALIEYERALELSPNESSIVSNIAMSYLLMGDLKTAEEKLRFASQMIGADSR 207 +H +A++ ++RAL+L+P S + + Y+ M + A E R A + D R Sbjct: 344 SEHEKAVMYFKRALKLNPKYLSAWTLMGHEYVEMKNTHAAIESYRRAVDINPRDYR 399 Score = 26.5 bits (58), Expect = 7.4 Identities = 17/55 (30%), Positives = 27/55 (49%) Query: 137 DWQLISAKGSVLAQMGKHSEALIEYERALELSPNESSIVSNIAMSYLLMGDLKTA 191 D +L A G ++ + EA+ Y+RA+ L E S + +A Y + DL A Sbjct: 431 DSRLWVALGECYEKLNRLEEAIKCYKRAILLGDTEGSALVRLAKLYEELKDLNEA 485 >gnl|CDD|30666 COG0318, CaiC, Acyl-CoA synthetases (AMP-forming)/AMP-acid ligases II [Lipid metabolism / Secondary metabolites biosynthesis, transport, and catabolism]. Length = 534 Score = 27.8 bits (61), Expect = 3.5 Identities = 18/84 (21%), Positives = 30/84 (35%), Gaps = 9/84 (10%) Query: 32 LNPRISIPDPESLENMNHEQLLEVTSTIGLQYQSHTKNKMIGIVYADVLRRVGRTAQALA 91 N + + +L ++ L + + Y ++ RR R A AL Sbjct: 1 ANRLMRMTAELTLASLLERAARRNPDRPALIFLGRGGR----LTYRELDRRANRLAAALQ 56 Query: 92 VMR-----QVAILYPEDQEVLAAY 110 + +VAIL P E L A+ Sbjct: 57 ALGVKPGDRVAILLPNSPEFLIAF 80 >gnl|CDD|32484 COG2333, ComEC, Predicted hydrolase (metallo-beta-lactamase superfamily) [General function prediction only]. Length = 293 Score = 27.2 bits (60), Expect = 4.4 Identities = 24/110 (21%), Positives = 39/110 (35%), Gaps = 21/110 (19%) Query: 89 ALAVMRQVAILYPEDQEVLAAYGKSLANAGYLDEGLDAINRAQRPDIPDWQLISAKGSVL 148 V++ + + E+ G + L + + + D WQ VL Sbjct: 107 LDEVLKTIKV-----PELWIYAGSDSTSTFVLRDAGIPVRSCKAGDS--WQWGGVVFQVL 159 Query: 149 AQMGKHSEALIEYERALELSPNESSIVSNIA---MSYLLMGDLKTAEEKL 195 + +G S+ L N S V + S+LL GDL+ EKL Sbjct: 160 SPVGGVSDDL-----------NNDSCVLRVTFGGNSFLLTGDLEEKGEKL 198 >gnl|CDD|112637 pfam03833, PolC_DP2, DNA polymerase II large subunit DP2. Length = 852 Score = 27.0 bits (60), Expect = 5.3 Identities = 10/26 (38%), Positives = 17/26 (65%) Query: 68 KNKMIGIVYADVLRRVGRTAQALAVM 93 ++ + + YA +R G TAQAL+V+ Sbjct: 125 GSEYLAVYYAGPIRSAGGTAQALSVL 150 >gnl|CDD|176995 CHL00054, psaB, photosystem I P700 chlorophyll a apoprotein A2. Length = 734 Score = 26.6 bits (59), Expect = 7.2 Identities = 10/25 (40%), Positives = 15/25 (60%) Query: 135 IPDWQLISAKGSVLAQMGKHSEALI 159 I D+ + +VLA+M H EA+I Sbjct: 395 IRDYNPEQNEDNVLARMLDHKEAII 419 >gnl|CDD|107214 cd06457, M3A_MIP, Peptidase M3 mitochondrial intermediate peptidase (MIP; EC 3.4.24.59) belongs to the widespread subfamily M3A, that show similarity to the Thimet oligopeptidase (TOP). It is one of three peptidases responsible for the proteolytic processing of both, nuclear and mitochondrial encoded precursor polypeptides targeted to the various subcompartments of the mitochondria. It cleaves intermediate-size proteins initially processed by mitochondrial processing peptidase (MPP) to yield a processing intermediate with a typical N-terminal octapeptide that is sequentially cleaved by MIP to mature-size protein. MIP cleaves precursor proteins of respiratory components, including subunits of the electron transport chain and tri-carboxylic acid cycle enzymes, and components of the mitochondrial genetic machinery, including ribosomal proteins, translation factors, and proteins required for mitochondrial DNA metabolism. It has been suggested that the human MIP (HMIP polypeptide; gene symbol MIPEP) may be one of the loci predicted to influence the clinical manifestations of Friedreich's ataxia (FRDA), an autosomal recessive neurodegenerative disease caused by lack of human frataxin. These proteins are enriched in cysteine residues, two of which are highly conserved, suggesting their importance to stability as well as in formation of metal binding sites, thus playing a role in MIP activity. Length = 458 Score = 26.5 bits (59), Expect = 8.6 Identities = 7/24 (29%), Positives = 13/24 (54%) Query: 66 HTKNKMIGIVYADVLRRVGRTAQA 89 H ++G++Y D+ R G+ A Sbjct: 173 HEDEGLLGVIYCDLFSRPGKPPGA 196 >gnl|CDD|38809 KOG3603, KOG3603, KOG3603, Predicted phospholipase D [General function prediction only]. Length = 456 Score = 26.5 bits (58), Expect = 8.6 Identities = 13/37 (35%), Positives = 20/37 (54%), Gaps = 1/37 (2%) Query: 231 QELSPEEATRNIKYIKSILSQRDPWKKIAKARSNHNK 267 Q+LS +I+ +K + + +KI AR NHNK Sbjct: 350 QDLSDPLENGSIQ-VKFFIVPQTNIEKIPFARVNHNK 385 >gnl|CDD|177254 MTH00211, ND5, NADH dehydrogenase subunit 5; Provisional. Length = 597 Score = 26.5 bits (59), Expect = 8.9 Identities = 13/43 (30%), Positives = 20/43 (46%), Gaps = 10/43 (23%) Query: 1 MIILFCPVILFLK----------KIKCIVFLIPLLLFSSCHLN 33 +I+L P++L L K+ + LIPLL+F L Sbjct: 13 LILLLLPLLLPLNNSKLHIKKAVKLSFFISLIPLLIFLDQGLE 55 >gnl|CDD|35569 KOG0348, KOG0348, KOG0348, ATP-dependent RNA helicase [RNA processing and modification]. Length = 708 Score = 26.1 bits (57), Expect = 9.3 Identities = 19/66 (28%), Positives = 27/66 (40%), Gaps = 3/66 (4%) Query: 77 ADVLRRVGRTAQALAVMRQVAILYPEDQEVLAAYGKSLAN--AGYLDEGLDAIN-RAQRP 133 AD L RVGRTA+A + L P + E + K ++ L A R + Sbjct: 529 ADYLHRVGRTARAGEKGEALLFLLPSEAEYVNYLKKHHIMLLQFDMEILLPAFKPRKDKA 588 Query: 134 DIPDWQ 139 +WQ Sbjct: 589 KTKEWQ 594 >gnl|CDD|34582 COG4976, COG4976, Predicted methyltransferase (contains TPR repeat) [General function prediction only]. Length = 287 Score = 26.1 bits (57), Expect = 9.9 Identities = 17/74 (22%), Positives = 29/74 (39%), Gaps = 3/74 (4%) Query: 148 LAQMGKHSEALIEYERALELSPNESSIVSNIAMSYLLMGDLKTAEEKLRFASQMIGADSR 207 LA+ G A Y +ALEL+P ++ + G+ A +++ D Sbjct: 5 LAESGDAEAAAELYNQALELAPEWAAGWFRLGEYTEKAGEFDAAAAAYE---EVLELDPE 61 Query: 208 IRQNLALVVGLQGR 221 AL + + GR Sbjct: 62 DHGGAALKLAVLGR 75 >gnl|CDD|36344 KOG1129, KOG1129, KOG1129, TPR repeat-containing protein [General function prediction only]. Length = 478 Score = 26.2 bits (57), Expect = 10.0 Identities = 19/119 (15%), Positives = 41/119 (34%), Gaps = 2/119 (1%) Query: 64 QSHTKNKMIG--IVYADVLRRVGRTAQALAVMRQVAILYPEDQEVLAAYGKSLANAGYLD 121 S T+ ++ + V +R+ + +AL V+ + +P D L + + Sbjct: 248 SSLTQFPHPDTFLLLSKVYQRIDQPERALLVIGEGLDSFPFDVTYLLGQARIHEAMEQQE 307 Query: 122 EGLDAINRAQRPDIPDWQLISAKGSVLAQMGKHSEALIEYERALELSPNESSIVSNIAM 180 + L + + + I+ AL Y R L++ + NI + Sbjct: 308 DALQLYKLVLKLHPINVEAIACIAVGYFYDNNPEMALRYYRRILQMGAQSPELFCNIGL 366 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.319 0.133 0.371 Gapped Lambda K H 0.267 0.0662 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 3,116,206 Number of extensions: 158778 Number of successful extensions: 530 Number of sequences better than 10.0: 1 Number of HSP's gapped: 518 Number of HSP's successfully gapped: 82 Length of query: 271 Length of database: 6,263,737 Length adjustment: 92 Effective length of query: 179 Effective length of database: 4,275,709 Effective search space: 765351911 Effective search space used: 765351911 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 57 (25.9 bits)