BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780592|ref|YP_003065005.1| TPR repeat-containing protein [Candidatus Liberibacter asiaticus str. psy62] (271 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780592|ref|YP_003065005.1| TPR repeat-containing protein [Candidatus Liberibacter asiaticus str. psy62] Length = 271 Score = 556 bits (1432), Expect = e-160, Method: Compositional matrix adjust. Identities = 271/271 (100%), Positives = 271/271 (100%) Query: 1 MIILFCPVILFLKKIKCIVFLIPLLLFSSCHLNPRISIPDPESLENMNHEQLLEVTSTIG 60 MIILFCPVILFLKKIKCIVFLIPLLLFSSCHLNPRISIPDPESLENMNHEQLLEVTSTIG Sbjct: 1 MIILFCPVILFLKKIKCIVFLIPLLLFSSCHLNPRISIPDPESLENMNHEQLLEVTSTIG 60 Query: 61 LQYQSHTKNKMIGIVYADVLRRVGRTAQALAVMRQVAILYPEDQEVLAAYGKSLANAGYL 120 LQYQSHTKNKMIGIVYADVLRRVGRTAQALAVMRQVAILYPEDQEVLAAYGKSLANAGYL Sbjct: 61 LQYQSHTKNKMIGIVYADVLRRVGRTAQALAVMRQVAILYPEDQEVLAAYGKSLANAGYL 120 Query: 121 DEGLDAINRAQRPDIPDWQLISAKGSVLAQMGKHSEALIEYERALELSPNESSIVSNIAM 180 DEGLDAINRAQRPDIPDWQLISAKGSVLAQMGKHSEALIEYERALELSPNESSIVSNIAM Sbjct: 121 DEGLDAINRAQRPDIPDWQLISAKGSVLAQMGKHSEALIEYERALELSPNESSIVSNIAM 180 Query: 181 SYLLMGDLKTAEEKLRFASQMIGADSRIRQNLALVVGLQGRMKEAYSIASQELSPEEATR 240 SYLLMGDLKTAEEKLRFASQMIGADSRIRQNLALVVGLQGRMKEAYSIASQELSPEEATR Sbjct: 181 SYLLMGDLKTAEEKLRFASQMIGADSRIRQNLALVVGLQGRMKEAYSIASQELSPEEATR 240 Query: 241 NIKYIKSILSQRDPWKKIAKARSNHNKKERA 271 NIKYIKSILSQRDPWKKIAKARSNHNKKERA Sbjct: 241 NIKYIKSILSQRDPWKKIAKARSNHNKKERA 271 >gi|254780436|ref|YP_003064849.1| hypothetical protein CLIBASIA_01605 [Candidatus Liberibacter asiaticus str. psy62] Length = 298 Score = 33.5 bits (75), Expect = 0.004, Method: Compositional matrix adjust. Identities = 20/70 (28%), Positives = 36/70 (51%), Gaps = 3/70 (4%) Query: 122 EGLDAINRAQRPDIPDWQLISAKGSVLAQMGKHSEALIEYERALELSPNESSIVSNIAMS 181 + L A+ RA D + + +G V G +AL++++ AL+L+P + +N A+ Sbjct: 56 DSLTAVIRAHPSDPEGYNV---RGVVYGMNGDFEKALLDFQSALDLNPRYYKVYANRALI 112 Query: 182 YLLMGDLKTA 191 MGD+ A Sbjct: 113 RYKMGDVPMA 122 >gi|254780622|ref|YP_003065035.1| bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase [Candidatus Liberibacter asiaticus str. psy62] Length = 405 Score = 25.4 bits (54), Expect = 1.2, Method: Compositional matrix adjust. Identities = 13/43 (30%), Positives = 24/43 (55%) Query: 83 VGRTAQALAVMRQVAILYPEDQEVLAAYGKSLANAGYLDEGLD 125 VGR ++ ++RQ+ L + +E+L ++L +G E LD Sbjct: 165 VGRMSEPCDIIRQITWLLYKSKELLLKGKRALVTSGPTYEPLD 207 >gi|254780860|ref|YP_003065273.1| NADH dehydrogenase subunit H [Candidatus Liberibacter asiaticus str. psy62] Length = 348 Score = 24.3 bits (51), Expect = 2.4, Method: Compositional matrix adjust. Identities = 13/24 (54%), Positives = 15/24 (62%), Gaps = 2/24 (8%) Query: 4 LFCPVILFLKKIKCIVFLIPLLLF 27 F P LF IK IVFL+ LL+F Sbjct: 8 FFVP--LFFMAIKSIVFLVGLLIF 29 >gi|254780371|ref|YP_003064784.1| diaminopimelate decarboxylase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 431 Score = 23.9 bits (50), Expect = 3.5, Method: Compositional matrix adjust. Identities = 12/40 (30%), Positives = 22/40 (55%), Gaps = 3/40 (7%) Query: 75 VYADVLRRVGRTAQALAVMRQVAILYPEDQ---EVLAAYG 111 ++AD++ + T +A+ R++A+ P D E AYG Sbjct: 336 IHADIVGPICETGDFIALNRKIALPRPGDLLYIEKTGAYG 375 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.319 0.133 0.371 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 156,325 Number of Sequences: 1233 Number of extensions: 5802 Number of successful extensions: 20 Number of sequences better than 100.0: 6 Number of HSP's better than 100.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 14 Number of HSP's gapped (non-prelim): 7 length of query: 271 length of database: 328,796 effective HSP length: 73 effective length of query: 198 effective length of database: 238,787 effective search space: 47279826 effective search space used: 47279826 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 37 (18.9 bits)