>cd03037 GST_N_GRX2 GST_N family, Glutaredoxin 2 (GRX2) subfamily; composed of bacterial proteins similar to E. coli GRX2, an atypical GRX with a molecular mass of about 24kD, compared with other GRXs which are 9-12kD in size. GRX2 adopts a GST fold containing an N-terminal thioredoxin-fold domain and a C-terminal alpha helical domain. It contains a redox active CXXC motif located in the N-terminal domain but is not able to reduce ribonucleotide reductase like other GRXs. However, it catalyzes GSH-dependent protein disulfide reduction of other substrates efficiently. GRX2 is thought to function primarily in catalyzing the reversible glutathionylation of proteins in cellular redox regulation including stress responses.

Probab=99.44 E-value=7.9e-14 Score=98.68 Aligned_cols=71 Identities=14% Similarity=0.134 Sum_probs=62.3 Q ss_pred CCCCCCCCCHHHHHHHHHHHHCCCCEEEEECCCCCCCHHHHHHCCCCCCCHHHHCCHHHHCCCCHHHHHHHH Q ss_conf 521358998689999999998699829998886777889998556877520111000111012103567775 Q gi|254780594|r 2 SILYHYPLSSSSRFIRLILSEYEFTTDMIEEFPWGKRREFLELNPSGTLPVYIDEHMQALCGVFVISEYLDE 73 (230) Q Consensus 2 ~~LY~~~~sp~~~kvr~~L~e~gi~y~~~~~~~~~~~~~~~~lnP~g~vP~L~~~dg~~l~eS~aI~~yL~~ 73 (230) T Consensus 1 mkLY~y~hCPfc~raRm~~g~kni~~e~~~l~~d-d~~t~~~~iG~k~VPiL~~~DG~~m~ESlDIi~y~de 71 (71) T cd03037 1 MKLYIYEHCPFCVKARMIAGLKNIPVEQIILQND-DEATPIRMIGAKQVPILEKDDGSFMAESLDIVAFIDE 71 (71) T ss_pred CCEEEECCCHHHHHHHHHHHHCCCCEEEEEEECC-CCHHHHHHCCCCCCCEEEECCCCCCHHHHHHHHHHCC T ss_conf 9515834483889999998762998489983059-8441476538822237982898780589999998609

HHsearch alignment for GI: 254780594 and conserved domain: cd03037