>cd03051 GST_N_GTT2_like GST_N family, Saccharomyces cerevisiae GTT2-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S. cerevisiae GST protein, GTT2. GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress. GSTs also show GSH peroxidase activity and are involved in the synthesis of prostaglandins and leukotrienes. The GST fold contains an N-terminal TRX-fold domain and a C-terminal alpha helical domain, with an active site located in a cleft between the two domains. GTT2, a homodimer, exhibits GST activity with standard substrates. Strains with deleted GTT2 genes are viable but exhibit increased sensitivity to heat shock.

Probab=99.83 E-value=3.8e-21 Score=140.70 Aligned_cols=71 Identities=27% Similarity=0.418 Sum_probs=66.1 Q ss_pred CCCCCCCCCHHHHHHHHHHHHCCCCEEEEECCCC---CCCHHHHHHCCCCCCCHHHHCCHHHHCCCCHHHHHHH Q ss_conf 5213589986899999999986998299988867---7788999855687752011100011101210356777 Q gi|254780594|r 2 SILYHYPLSSSSRFIRLILSEYEFTTDMIEEFPW---GKRREFLELNPSGTLPVYIDEHMQALCGVFVISEYLD 72 (230) Q Consensus 2 ~~LY~~~~sp~~~kvr~~L~e~gi~y~~~~~~~~---~~~~~~~~lnP~g~vP~L~~~dg~~l~eS~aI~~yL~ 72 (230) T Consensus 1 mkLy~~~~Sp~~~rvri~L~ekgl~~e~~~v~~~~~~~~~~~~~~~NP~g~vP~L~~ddg~~l~ES~aI~~YLd 74 (74) T cd03051 1 MKLYDSPTAPNPRRVRIFLAEKGIDVPLVTVDLAAGEQRSPEFLAKNPAGTVPVLELDDGTVITESVAICRYLE 74 (74) T ss_pred CEEEECCCCHHHHHHHHHHHHHCCCCEEEEEECCCCCCCCHHHHHHCCCCCCCEEEECCCCEEECHHHHHHHHC T ss_conf 98982799927999999999969998699975777877898999779898646799789979974899998629

HHsearch alignment for GI: 254780594 and conserved domain: cd03051