>gnl|CDD|48104 cd03177, GST_C_Delta_Epsilon, GST_C family, Class Delta and Epsilon subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress. GSTs also show GSH peroxidase activity and are involved in the synthesis of prostaglandins and leukotrienes. The GST fold contains an N-terminal thioredoxin-fold domain and a C-terminal alpha helical domain, with an active site located in a cleft between the two domains. GSH binds to the N-terminal domain while the hydrophobic substrate occupies a pocket in the C-terminal domain. The class Delta and Epsilon subfamily is made up primarily of insect GSTs, which play major roles in insecticide resistance by facilitating reductive dehydrochlorination of insecticides or conjugating them with GSH to produce water-soluble metabolites that are easily excreted. They are also implicated in protection against cellular damage by oxidative stress.. Length = 118

 Score = 47.1 bits (112), Expect = 4e-06
 Identities = 17/65 (26%), Positives = 34/65 (52%)

Query: 155 LIKSRSWIAGHHMSYADFAASATISILDYLGEIDWDTAPIVKEWYQRMKSRPSFRPLLSE 214
            ++   ++AG  ++ AD +  AT+S L+ L  +D    P V+ W +R+K+ P +     +
Sbjct: 53  FLEGSDYVAGDQLTIADLSLVATVSTLEALLPLDLSKYPNVRAWLERLKALPPYEEANGK 112

Query: 215 RIRGL 219
             + L
Sbjct: 113 GAKEL 117