RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780594|ref|YP_003065007.1| Glutathione S-transferase domain protein [Candidatus Liberibacter asiaticus str. psy62] (230 letters) >gnl|CDD|30970 COG0625, Gst, Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones]. Length = 211 Score = 116 bits (291), Expect = 5e-27 Identities = 58/211 (27%), Positives = 90/211 (42%), Gaps = 13/211 (6%) Query: 3 ILYHYPLSSSSRFIRLILSEYEFTTDMIEEFPW--GKRREFLELNPSGTLPVYIDEHMQA 60 LY P S SR +RL L E +++ K +FL LNP G +P +D+ + Sbjct: 2 KLYGSPTSPYSRKVRLALEEKGLPYEIVLVDLDAEQKPPDFLALNPLGKVPALVDDDGEV 61 Query: 61 LCGVFVISEYLDETYGAIAQKNRLLSTDPLQRAETRRMIEWFMYQMEQDVTRPLAHERVY 120 L I EYL E Y LL DPL R R ++ W+++ D+ + R Sbjct: 62 LTESGAILEYLAERYPG----PPLLPADPLARRA-RALLLWWLFFAASDLHPVIGQRR-- 114 Query: 121 KLHMTTEQGGGSPDSKVLRIARNNMREHIKYITWLIKSRSWIAGHHMSYADFAASATISI 180 L AR +R + + L+ ++AG + AD A + + Sbjct: 115 ---RALLGSEPELLEAALEAARAEIRALLALLEALLADGPYLAGDRFTIADIALAPLLWR 171 Query: 181 LDYLGEIDWDTAPIVKEWYQRMKSRPSFRPL 211 L LG + P +K WY+R+ +RP+FR + Sbjct: 172 LALLG-EELADYPALKAWYERVLARPAFRAV 201 >gnl|CDD|36085 KOG0867, KOG0867, KOG0867, Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones]. Length = 226 Score = 76.6 bits (188), Expect = 5e-15 Identities = 48/211 (22%), Positives = 90/211 (42%), Gaps = 16/211 (7%) Query: 3 ILYHYPLSSSSRFIRLILSEYEFTTDMIEEFPWGKRR---EFLELNPSGTLPVYIDEHMQ 59 LY + S +R + + E ++ + EFL+LNP G +P D Sbjct: 4 KLYGHLGSPPARAVLIAAKELGLEVELKPVDLVKGEQKSPEFLKLNPLGKVPALED-GGL 62 Query: 60 ALCGVFVISEYLDETYGAIAQKNRLLSTDPLQRAETRRMIEWFMYQMEQDVTRPLAHERV 119 L I YL E YG LL D +RA + +E+ + P+ ER Sbjct: 63 TLWESHAILRYLAEKYGP--LGGILLPKDLKERAIVDQWLEFENGVL-----DPVTFERP 115 Query: 120 YKLHMTTEQGGGSPDSKVLRIARNNMREHIKYITWLIKSRSWIAGHHMSYADFAASATIS 179 + G + ++ +R+ + + +K++ ++AG ++ AD + ++T+S Sbjct: 116 ILAPLLV---GLPLNPTAVKELEAKLRKALDNLERFLKTQVYLAGDQLTLADLSLASTLS 172 Query: 180 IL--DYLGEIDWDTAPIVKEWYQRMKSRPSF 208 + E D++ P V WY+R++ RP++ Sbjct: 173 QFQGKFATEKDFEKYPKVARWYERIQKRPAY 203 >gnl|CDD|48103 cd00299, GST_C_family, Glutathione S-transferase (GST) family, C-terminal alpha helical domain; a large, diverse group of cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress. In addition, GSTs also show GSH peroxidase activity and are involved in the synthesis of prostaglandins and leukotrienes. This family, also referred to as soluble GSTs, is the largest family of GSH transferases and is only distantly related to the mitochondrial GSTs (GSTK). Soluble GSTs bear no structural similarity to microsomal GSTs (MAPEG family) and display additional activities unique to their group, such as catalyzing thiolysis, reduction and isomerization of certain compounds. The GST fold contains an N-terminal thioredoxin-fold domain and a C-terminal alpha helical domain, with an active site located in a cleft between the two domains. GSH binds to the N-terminal domain while the hydrophobic substrate occupies a pocket in the C-terminal domain. Based on sequence similarity, different classes of GSTs have been identified, which display varying tissue distribution, substrate specificities and additional specific activities. In humans, GSTs display polymorphisms which may influence individual susceptibility to diseases such as cancer, arthritis, allergy and sclerosis. Some GST family members with non-GST functions include glutaredoxin 2, the CLIC subfamily of anion channels, prion protein Ure2p, crystallins, metaxins and stringent starvation protein A.. Length = 100 Score = 56.7 bits (136), Expect = 5e-09 Identities = 29/110 (26%), Positives = 42/110 (38%), Gaps = 12/110 (10%) Query: 95 TRRMIEWFMYQMEQDVTRPLAHERVYKLHMTTEQGGGSPDSKVLRIARNNMREHIKYITW 154 R EW +E R L V G D L AR + + + Sbjct: 1 VRAWEEWADTTLEPAARRLLLLAFV----------GPEVDEAALEEAREELAAALAALEK 50 Query: 155 LIKSRSWIAGHHMSYADFAASATISILDYLGEI--DWDTAPIVKEWYQRM 202 L+ R ++AG S AD A + ++ LD LG + D P + WY R+ Sbjct: 51 LLAGRPYLAGDRFSLADIALAPVLARLDLLGPLLGLLDEYPRLAAWYDRL 100 >gnl|CDD|35627 KOG0406, KOG0406, KOG0406, Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones]. Length = 231 Score = 53.4 bits (128), Expect = 5e-08 Identities = 48/223 (21%), Positives = 85/223 (38%), Gaps = 31/223 (13%) Query: 3 ILYHYPLSSSSRFIRLILSEYEFTTDMIEEFPWGKRREFLELNPS-GTLPVYIDEHMQ-A 60 L S ++ +R+ L + +EE K LE NP +PV EH Sbjct: 11 KLLGMWFSPFAQRVRIALKLKGIPYEYVEEDLTNKSEWLLEKNPVHKKVPVL--EHNGKP 68 Query: 61 LCGVFVISEYLDETYGAIAQKNRLLSTDPLQRAETRRMIEWFMYQMEQDVTRPLAHERVY 120 +C +I EY+DET+ +L +DP +RA+ R W Y + Sbjct: 69 ICESLIIVEYIDETW---PSGPPILPSDPYERAQAR---FWAEYIDK------------- 109 Query: 121 KLHMTTEQGGGSPDSKVLRIARNNMREHIKYI-TWLIKSRSWIAGHHMSYADFAASATIS 179 K+ + + A+ +RE +K + L K + + G + + D A + Sbjct: 110 KVFFVGRFVVAAKGGEEQEAAKEELREALKVLEEELGKGKDFFGGETIGFVDIAIGPSFE 169 Query: 180 ILDYLGE-------IDWDTAPIVKEWYQRMKSRPSFRPLLSER 215 + E I + P + +W +RMK + + +L + Sbjct: 170 RWLAVLEKFGGVKFIIEEETPKLIKWIKRMKEDEAVKAVLPDS 212 >gnl|CDD|48493 cd00570, GST_N_family, Glutathione S-transferase (GST) family, N-terminal domain; a large, diverse group of cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress. In addition, GSTs also show GSH peroxidase activity and are involved in the synthesis of prostaglandins and leukotrienes. This family, also referred to as soluble GSTs, is the largest family of GSH transferases and is only distantly related to the mitochondrial GSTs (GSTK subfamily, a member of the DsbA family). Soluble GSTs bear no structural similarity to microsomal GSTs (MAPEG family) and display additional activities unique to their group, such as catalyzing thiolysis, reduction and isomerization of certain compounds. The GST fold contains an N-terminal TRX-fold domain and a C-terminal alpha helical domain, with an active site located in a cleft between the two domains. Based on sequence similarity, different classes of GSTs have been identified, which display varying tissue distribution, substrate specificities and additional specific activities. In humans, GSTs display polymorphisms which may influence individual susceptibility to diseases such as cancer, arthritis, allergy and sclerosis. Some GST family members with non-GST functions include glutaredoxin 2, the CLIC subfamily of anion channels, prion protein Ure2p, crystallins, metaxin 2 and stringent starvation protein A.. Length = 71 Score = 48.8 bits (116), Expect = 1e-06 Identities = 25/71 (35%), Positives = 35/71 (49%), Gaps = 2/71 (2%) Query: 3 ILYHYPLSSSSRFIRLILSEYEFTTDMIE-EFPWGKRREFLELNPSGTLPVYIDEHMQAL 61 LY++P S S +RL L E +++ + G++ EFL LNP G +PV D L Sbjct: 2 KLYYFPGSPRSLRVRLALEEKGLPYELVPVDLGEGEQEEFLALNPLGKVPVLEDGG-LVL 60 Query: 62 CGVFVISEYLD 72 I EYL Sbjct: 61 TESLAILEYLA 71 >gnl|CDD|48104 cd03177, GST_C_Delta_Epsilon, GST_C family, Class Delta and Epsilon subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress. GSTs also show GSH peroxidase activity and are involved in the synthesis of prostaglandins and leukotrienes. The GST fold contains an N-terminal thioredoxin-fold domain and a C-terminal alpha helical domain, with an active site located in a cleft between the two domains. GSH binds to the N-terminal domain while the hydrophobic substrate occupies a pocket in the C-terminal domain. The class Delta and Epsilon subfamily is made up primarily of insect GSTs, which play major roles in insecticide resistance by facilitating reductive dehydrochlorination of insecticides or conjugating them with GSH to produce water-soluble metabolites that are easily excreted. They are also implicated in protection against cellular damage by oxidative stress.. Length = 118 Score = 47.1 bits (112), Expect = 4e-06 Identities = 17/65 (26%), Positives = 34/65 (52%) Query: 155 LIKSRSWIAGHHMSYADFAASATISILDYLGEIDWDTAPIVKEWYQRMKSRPSFRPLLSE 214 ++ ++AG ++ AD + AT+S L+ L +D P V+ W +R+K+ P + + Sbjct: 53 FLEGSDYVAGDQLTIADLSLVATVSTLEALLPLDLSKYPNVRAWLERLKALPPYEEANGK 112 Query: 215 RIRGL 219 + L Sbjct: 113 GAKEL 117 >gnl|CDD|36086 KOG0868, KOG0868, KOG0868, Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones]. Length = 217 Score = 46.5 bits (110), Expect = 6e-06 Identities = 51/214 (23%), Positives = 91/214 (42%), Gaps = 25/214 (11%) Query: 3 ILYHYPLSSSSRFIRLILS----EYEF-TTDMIEEFPWGKRREFLELNPSGTLPVYIDEH 57 ILY Y SS S +R+ L+ +YE+ ++++E EF E+NP +P + + Sbjct: 7 ILYSYWRSSCSWRVRIALALKGIDYEYKPVNLLKEED-QSDSEFKEINPMEKVPTLVIDG 65 Query: 58 MQALCGVFVISEYLDETYGAIAQKNRLLSTDPLQRAETRRMIEWFMYQMEQDVTRPLAHE 117 L I EYL+ETY LL DP +RA+ R + ++ PL + Sbjct: 66 -LTLTESLAIIEYLEETY----PDPPLLPKDPHKRAKARAISLLIASGIQ-----PLQNL 115 Query: 118 RVYKLHMTTEQGGGSPDSKVLRIARNNMREHIKYITWLIKSRS--WIAGHHMSYADFAAS 175 V K+ E G G + A++ + + + L+KS + + G ++ AD Sbjct: 116 SVLKMLNEKEPGYG------DQWAQHFITKGFTALEKLLKSHAGKYCVGDEVTIADLCLP 169 Query: 176 ATISILDYLGEIDWDTAPIVKEWYQRMKSRPSFR 209 + + +D P + + + P+F+ Sbjct: 170 PQVYNANRF-HVDLTPYPTITRINEELAELPAFQ 202 >gnl|CDD|39621 KOG4420, KOG4420, KOG4420, Uncharacterized conserved protein (Ganglioside-induced differentiation associated protein 1, GDAP1) [Function unknown]. Length = 325 Score = 45.8 bits (108), Expect = 1e-05 Identities = 54/268 (20%), Positives = 100/268 (37%), Gaps = 52/268 (19%) Query: 3 ILYHYPLSSSSRFIRLILSEYEFT-TDMIEEFPWGKRRE--FLELNPSGTLPVYID-EHM 58 +LYH+P S SS+ +RL+++E + P G+ +E F+ LNP G +PV I +++ Sbjct: 28 VLYHHPYSFSSQKVRLVIAEKGIDCEEYDVSLPQGEHKEPWFMRLNPGGEVPVLIHGDNI 87 Query: 59 QALCGVFVISEYLDETYGA----IAQKNRLLSTDPLQRAE---TRRMIEWFMYQMEQDVT 111 + I +Y++ T+ + + L LQ E M + + Sbjct: 88 --ISDYTQIIDYVERTFTGERVLMPEVGSLQHDRVLQYEELLDALPMDAYTHGCILHPEL 145 Query: 112 RPLAH---------------ERVYKLHMTTEQGGGSPDSKVLRIARNNMREH-------- 148 + V KL E + + EH Sbjct: 146 TTDSMIPKYAEIRRHLAKATTDVMKLDHEEEPDLAEAYLAKQKKLMAKLLEHDDVSYLKK 205 Query: 149 --------IKYITWLIKSRS----WIAGHHMSYADFAASATISILDYLG----EIDWDTA 192 + + ++ R W+ G S AD + AT+ L +LG + + Sbjct: 206 ILDELAMVLDQVETELEKRKLCELWLCGCEFSLADVSLGATLHRLKFLGLEKKYWEDGSR 265 Query: 193 PIVKEWYQRMKSRPSFRPLLSERIRGLL 220 P ++ +++R++ R SFR +L + L Sbjct: 266 PNLESYFERVRRRFSFRKVLGDIFNILR 293 >gnl|CDD|48110 cd03183, GST_C_Theta, GST_C family, Class Theta subfamily; composed of eukaryotic class Theta GSTs and bacterial dichloromethane (DCM) dehalogenase. GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress. The GST fold contains an N-terminal thioredoxin-fold domain and a C-terminal alpha helical domain, with an active site located in a cleft between the two domains. GSH binds to the N-terminal domain while the hydrophobic substrate occupies a pocket in the C-terminal domain. Mammalian class Theta GSTs show poor GSH conjugating activity towards the standard substrates, CDNB and ethacrynic acid, differentiating them from other mammalian GSTs. GSTT1-1 shows similar cataytic activity as bacterial DCM dehalogenase, catalyzing the GSH-dependent hydrolytic dehalogenation of dihalomethanes. This is an essential process in methylotrophic bacteria to enable them to use chloromethane and DCM as sole carbon and energy sources. The presence of polymorphisms in human GSTT1-1 and its relationship to the onset of diseases including cancer is subject of many studies. Human GSTT2-2 exhibits a highly specific sulfatase activity, catalyzing the cleavage of sulfate ions from aralkyl sufate esters, but not from the aryl or alkyl sulfate esters.. Length = 126 Score = 44.4 bits (105), Expect = 3e-05 Identities = 19/79 (24%), Positives = 37/79 (46%), Gaps = 3/79 (3%) Query: 129 GGGSPDSKVLRIARNNMREHIKYI--TWLIKSRSWIAGHHMSYADFAASATISILDYLGE 186 GG + ++ A N+ E + + +L K + ++AG +S AD +A I + G Sbjct: 34 GGKPVSPEKVKKAEENLEESLDLLENYFL-KDKPFLAGDEISIADLSAVCEIMQPEAAGY 92 Query: 187 IDWDTAPIVKEWYQRMKSR 205 ++ P + W +R+K Sbjct: 93 DVFEGRPKLAAWRKRVKEA 111 >gnl|CDD|48608 cd03059, GST_N_SspA, GST_N family, Stringent starvation protein A (SspA) subfamily; SspA is a RNA polymerase (RNAP)-associated protein required for the lytic development of phage P1 and for stationary phase-induced acid tolerance of E. coli. It is implicated in survival during nutrient starvation. SspA adopts the GST fold with an N-terminal TRX-fold domain and a C-terminal alpha helical domain, but it does not bind glutathione (GSH) and lacks GST activity. SspA is highly conserved among gram-negative bacteria. Related proteins found in Neisseria (called RegF), Francisella and Vibrio regulate the expression of virulence factors necessary for pathogenesis.. Length = 73 Score = 43.3 bits (102), Expect = 6e-05 Identities = 24/72 (33%), Positives = 38/72 (52%), Gaps = 1/72 (1%) Query: 4 LYHYPLSSSSRFIRLILSEYEFTTDMIEEFPWGKRREFLELNPSGTLPVYIDEHMQALCG 63 LY P S +R++L+E + ++I+ P + ELNP GT+P +D + L Sbjct: 3 LYSGPDDVYSHRVRIVLAEKGVSVEIIDVDPDNPPEDLAELNPYGTVPTLVDRDL-VLYE 61 Query: 64 VFVISEYLDETY 75 +I EYLDE + Sbjct: 62 SRIIMEYLDERF 73 >gnl|CDD|48105 cd03178, GST_C_Ure2p_like, GST_C family, Ure2p-like subfamily; composed of the Saccharomyces cerevisiae Ure2p and related GSTs. Ure2p is a regulator for nitrogen catabolism in yeast. It represses the expression of several gene products involved in the use of poor nitrogen sources when rich sources are available. A transmissible conformational change of Ure2p results in a prion called [Ure3], an inactive, self-propagating and infectious amyloid. Ure2p displays a GST fold containing an N-terminal thioredoxin-fold domain and a C-terminal alpha helical domain. The N-terminal thioredoxin-fold domain is sufficient to induce the [Ure3] phenotype and is also called the prion domain of Ure2p. In addition to its role in nitrogen regulation, Ure2p confers protection to cells against heavy metal ion and oxidant toxicity, and shows glutathione (GSH) peroxidase activity. GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of GSH with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress. GSTs also show GSH peroxidase activity and are involved in the synthesis of prostaglandins and leukotrienes. The GST active site is located in a cleft between the N- and C-terminal domains. GSH binds to the N-terminal domain while the hydrophobic substrate occupies a pocket in the C-terminal domain.. Length = 113 Score = 42.9 bits (101), Expect = 8e-05 Identities = 18/53 (33%), Positives = 28/53 (52%) Query: 157 KSRSWIAGHHMSYADFAASATISILDYLGEIDWDTAPIVKEWYQRMKSRPSFR 209 R ++AG S AD A + L+++G D D P VK W R+ +RP+ + Sbjct: 57 AGRDYLAGDEYSIADIAIFPWVRRLEWIGIDDLDDFPNVKRWLDRIAARPAVQ 109 >gnl|CDD|48115 cd03188, GST_C_Beta, GST_C family, Class Beta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress. The GST fold contains an N-terminal thioredoxin-fold domain and a C-terminal alpha helical domain, with an active site located in a cleft between the two domains. GSH binds to the N-terminal domain while the hydrophobic substrate occupies a pocket in the C-terminal domain. Unlike mammalian GSTs which detoxify a broad range of compounds, the bacterial class Beta GSTs exhibit limited GSH conjugating activity with a narrow range of substrates. In addition to GSH conjugation, they also bind antibiotics and reduce the antimicrobial activity of beta-lactam drugs. The structure of the Proteus mirabilis enzyme reveals that the cysteine in the active site forms a covalent bond with GSH.. Length = 114 Score = 41.4 bits (97), Expect = 2e-04 Identities = 15/76 (19%), Positives = 30/76 (39%), Gaps = 1/76 (1%) Query: 137 VLRIARNNMREHIKYITWLIKSRSWIAGHHMSYADFAASATISILDYLGEIDWDTAPIVK 196 V AR + + Y+ + ++ G S AD + +G +D P + Sbjct: 40 VKAAARERLAARLAYLDAQLAGGPYLLGDRFSVADAYLFVVLRWAPGVG-LDLSDWPNLA 98 Query: 197 EWYQRMKSRPSFRPLL 212 + R+ +RP+ + L Sbjct: 99 AYLARVAARPAVQAAL 114 >gnl|CDD|48137 cd03210, GST_C_Pi, GST_C family, Class Pi subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress. The GST fold contains an N-terminal thioredoxin-fold domain and a C-terminal alpha helical domain, with an active site located in a cleft between the two domains. GSH binds to the N-terminal domain while the hydrophobic substrate occupies a pocket in the C-terminal domain. Class Pi GST is a homodimeric eukaryotic protein. The human GSTP1 is mainly found in erythrocytes, kidney, placenta and fetal liver. It is involved in stress responses and in cellular proliferation pathways as an inhibitor of JNK (c-Jun N-terminal kinase). Following oxidative stress, monomeric GSTP1 dissociates from JNK and dimerizes, losing its ability to bind JNK and causing an increase in JNK activity, thereby promoting apoptosis. GSTP1 is expressed in various tumors and is the predominant GST in a wide range of cancer cells. It has been implicated in the development of multidrug-resistant tumors.. Length = 126 Score = 40.2 bits (94), Expect = 5e-04 Identities = 18/80 (22%), Positives = 35/80 (43%), Gaps = 3/80 (3%) Query: 147 EHIKYITWLIK---SRSWIAGHHMSYADFAASATISILDYLGEIDWDTAPIVKEWYQRMK 203 E +K L+ + +I G +S+AD+ + I L D P++K + +R+ Sbjct: 42 EQLKPFEKLLSKNNGKGFIVGDKISFADYNLFDLLDIHLVLAPGCLDAFPLLKAFVERLS 101 Query: 204 SRPSFRPLLSERIRGLLPVS 223 +RP + L P++ Sbjct: 102 ARPKLKAYLESDAFKNRPIN 121 >gnl|CDD|48109 cd03182, GST_C_GTT2_like, GST_C family, Saccharomyces cerevisiae GTT2-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S. cerevisiae GST protein, GTT2. GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress. GSTs also show GSH peroxidase activity and are involved in the synthesis of prostaglandins and leukotrienes. The GST fold contains an N-terminal thioredoxin-fold domain and a C-terminal alpha helical domain, with an active site located in a cleft between the two domains. GSH binds to the N-terminal domain while the hydrophobic substrate occupies a pocket in the C-terminal domain. GTT2, a homodimer, exhibits GST activity with standard substrates. Strains with deleted GTT2 genes are viable but exhibit increased sensitivity to heat shock.. Length = 117 Score = 39.8 bits (93), Expect = 6e-04 Identities = 22/123 (17%), Positives = 41/123 (33%), Gaps = 10/123 (8%) Query: 88 DPLQRAETRRMIEWFMYQMEQDVTRPLAHERVYKLHMTTEQGGGSPDSKVLRIARNNMRE 147 PL+RA+ E P+ H T + +V + Sbjct: 1 TPLERAQIEMWQRR----AELQGLYPIG---QAFRHATPGLKPPDREEQVPEWGERSKAR 53 Query: 148 HIKYITWL---IKSRSWIAGHHMSYADFAASATISILDYLGEIDWDTAPIVKEWYQRMKS 204 ++ +L + ++AG + AD A + + + ++ WY RM + Sbjct: 54 AADFLAYLDTRLAGSPYVAGDRFTIADITAFVGLDFAKVVKLRVPEELTHLRAWYDRMAA 113 Query: 205 RPS 207 RPS Sbjct: 114 RPS 116 >gnl|CDD|109112 pfam00043, GST_C, Glutathione S-transferase, C-terminal domain. GST conjugates reduced glutathione to a variety of targets including S-crystallin from squid, the eukaryotic elongation factor 1-gamma, the HSP26 family of stress-related proteins and auxin-regulated proteins in plants. Stringent starvation proteins in E. coli are also included in the alignment but are not known to have GST activity. The glutathione molecule binds in a cleft between N and C-terminal domains. The catalytically important residues are proposed to reside in the N-terminal domain. In plants, GSTs are encoded by a large gene family (48 GST genes in Arabidopsis) and can be divided into the phi, tau, theta, zeta, and lambda classes. Length = 92 Score = 39.2 bits (92), Expect = 9e-04 Identities = 13/50 (26%), Positives = 25/50 (50%) Query: 157 KSRSWIAGHHMSYADFAASATISILDYLGEIDWDTAPIVKEWYQRMKSRP 206 K ++++ G ++ AD A + L L + P +K W +R+ +RP Sbjct: 43 KGKTYLVGDKLTLADIALYPALDWLYMLDPDCLEKFPNLKAWRKRVAARP 92 >gnl|CDD|48598 cd03049, GST_N_3, GST_N family, unknown subfamily 3; composed of uncharacterized bacterial proteins with similarity to GSTs. GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress. GSTs also show GSH peroxidase activity and are involved in the synthesis of prostaglandins and leukotrienes. The GST fold contains an N-terminal TRX-fold domain and a C-terminal alpha helical domain, with an active site located in a cleft between the two domains.. Length = 73 Score = 38.3 bits (89), Expect = 0.002 Identities = 21/71 (29%), Positives = 32/71 (45%), Gaps = 2/71 (2%) Query: 4 LYHYPLSSSSRFIRLILSEY--EFTTDMIEEFPWGKRREFLELNPSGTLPVYIDEHMQAL 61 L + P S R +R+ E +++ PW L +NP G +P + + +AL Sbjct: 3 LLYSPTSPYVRKVRVAAHETGLGDDVELVLVNPWSDDESLLAVNPLGKIPALVLDDGEAL 62 Query: 62 CGVFVISEYLD 72 VI EYLD Sbjct: 63 FDSRVICEYLD 73 >gnl|CDD|48600 cd03051, GST_N_GTT2_like, GST_N family, Saccharomyces cerevisiae GTT2-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S. cerevisiae GST protein, GTT2. GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress. GSTs also show GSH peroxidase activity and are involved in the synthesis of prostaglandins and leukotrienes. The GST fold contains an N-terminal TRX-fold domain and a C-terminal alpha helical domain, with an active site located in a cleft between the two domains. GTT2, a homodimer, exhibits GST activity with standard substrates. Strains with deleted GTT2 genes are viable but exhibit increased sensitivity to heat shock.. Length = 74 Score = 37.2 bits (86), Expect = 0.004 Identities = 21/72 (29%), Positives = 36/72 (50%), Gaps = 3/72 (4%) Query: 4 LYHYPLSSSSRFIRLILSEYEFTTDMIE-EFPWGKRR--EFLELNPSGTLPVYIDEHMQA 60 LY P + + R +R+ L+E ++ + G++R EFL NP+GT+PV + Sbjct: 3 LYDSPTAPNPRRVRIFLAEKGIDVPLVTVDLAAGEQRSPEFLAKNPAGTVPVLELDDGTV 62 Query: 61 LCGVFVISEYLD 72 + I YL+ Sbjct: 63 ITESVAICRYLE 74 >gnl|CDD|48595 cd03046, GST_N_GTT1_like, GST_N family, Saccharomyces cerevisiae GTT1-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S. cerevisiae GST protein, GTT1, and the Schizosaccharomyces pombe GST-III. GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress. GSTs also show GSH peroxidase activity and are involved in the synthesis of prostaglandins and leukotrienes. The GST fold contains an N-terminal TRX-fold domain and a C-terminal alpha helical domain, with an active site located in a cleft between the two domains. GTT1, a homodimer, exhibits GST activity with standard substrates and associates with the endoplasmic reticulum. Its expression is induced after diauxic shift and remains high throughout the stationary phase. S. pombe GST-III is implicated in the detoxification of various metals.. Length = 76 Score = 36.6 bits (85), Expect = 0.006 Identities = 26/78 (33%), Positives = 33/78 (42%), Gaps = 7/78 (8%) Query: 3 ILYHYPLSSSSRFIRLILSE----YEFTTDMIEEFPWGKRREFLELNPSGTLPVYIDEHM 58 LYH P S S R I +L E YE E+L +NP G +PV +D + Sbjct: 2 TLYHLPRSRSFR-ILWLLEELGLPYELVL-YDRGPGEQAPPEYLAINPLGKVPVLVDGDL 59 Query: 59 QALCGVFVISEYLDETYG 76 +I YL E YG Sbjct: 60 VLTESAAII-LYLAEKYG 76 >gnl|CDD|48113 cd03186, GST_C_SspA, GST_N family, Stringent starvation protein A (SspA) subfamily; SspA is a RNA polymerase (RNAP)-associated protein required for the lytic development of phage P1 and for stationary phase-induced acid tolerance of E. coli. It is implicated in survival during nutrient starvation. SspA adopts the GST fold with an N-terminal thioredoxin-fold domain and a C-terminal alpha helical domain, but it does not bind glutathione (GSH) and lacks GST activity. SspA is highly conserved among gram-negative bacteria. Related proteins found in Neisseria (called RegF), Francisella and Vibrio regulate the expression of virulence factors necessary for pathogenesis.. Length = 107 Score = 34.4 bits (79), Expect = 0.023 Identities = 31/122 (25%), Positives = 54/122 (44%), Gaps = 19/122 (15%) Query: 89 PLQRAETRRMIEWFMYQMEQDVTRPLAHERVYKLHMTTEQGGGSPDSKVLRIARNNMREH 148 P+ RA +R + M+++EQD Y L T E+G K AR +RE Sbjct: 1 PVARARSRLL----MHRIEQDW---------YPLVDTIEKG----RKKEAEKARKELRES 43 Query: 149 IKYITWLIKSRSWIAGHHMSYADFAASATISILDYLG-EIDWDTAPIVKEWYQRMKSRPS 207 + + + + + S D A + + L LG E+ P+ K++ +R+ +R S Sbjct: 44 LLALAPVFAHKPYFMSEEFSLVDCALAPLLWRLPALGIELPKQAKPL-KDYMERVFARDS 102 Query: 208 FR 209 F+ Sbjct: 103 FQ 104 >gnl|CDD|48107 cd03180, GST_C_2, GST_C family, unknown subfamily 2; composed of uncharacterized bacterial proteins, with similarity to GSTs. GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress. GSTs also show GSH peroxidase activity and are involved in the synthesis of prostaglandins and leukotrienes. The GST fold contains an N-terminal thioredoxin-fold domain and a C-terminal alpha helical domain, with an active site located in a cleft between the two domains. GSH binds to the N-terminal domain while the hydrophobic substrate occupies a pocket in the C-terminal domain.. Length = 110 Score = 34.0 bits (78), Expect = 0.032 Identities = 14/52 (26%), Positives = 25/52 (48%), Gaps = 3/52 (5%) Query: 158 SRSWIAGHHMSYADFAASATISILDYLG-EIDWDTAPIVKEWYQRMKSRPSF 208 R ++AG + AD S + I+ P ++ WY R+++RP+F Sbjct: 61 GRPYLAGDRFTLADIPLGC--SAYRWFELPIERPPLPHLERWYARLRARPAF 110 >gnl|CDD|48597 cd03048, GST_N_Ure2p_like, GST_N family, Ure2p-like subfamily; composed of the Saccharomyces cerevisiae Ure2p and related GSTs. Ure2p is a regulator for nitrogen catabolism in yeast. It represses the expression of several gene products involved in the use of poor nitrogen sources when rich sources are available. A transmissible conformational change of Ure2p results in a prion called [Ure3], an inactive, self-propagating and infectious amyloid. Ure2p displays a GST fold containing an N-terminal TRX-fold domain and a C-terminal alpha helical domain, with an active site located in a cleft between the two domains. The N-terminal TRX-fold domain is sufficient to induce the [Ure3] phenotype and is also called the prion domain of Ure2p. In addition to its role in nitrogen regulation, Ure2p confers protection to cells against heavy metal ion and oxidant toxicity, and shows glutathione (GSH) peroxidase activity. Characterized GSTs in this subfamily include Aspergillus fumigatus GSTs 1 and 2, and Schizosaccharomyces pombe GST-I. GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of GSH with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress. GSTs also show GSH peroxidase activity and are involved in the synthesis of prostaglandins and leukotrienes.. Length = 81 Score = 33.9 bits (78), Expect = 0.037 Identities = 17/44 (38%), Positives = 24/44 (54%), Gaps = 4/44 (9%) Query: 37 KRREFLELNPSGTLPVYIDEHMQALCGVF---VISEYLDETYGA 77 K+ EFL++NP+G +P +D + L VF I YL E Y Sbjct: 39 KKPEFLKINPNGRIPAIVDHNGTPLT-VFESGAILLYLAEKYDK 81 >gnl|CDD|48134 cd03207, GST_C_8, GST_C family, unknown subfamily 8; composed of uncharacterized bacterial proteins with similarity to GSTs. GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress. GSTs also show GSH peroxidase activity and are involved in the synthesis of prostaglandins and leukotrienes. The GST fold contains an N-terminal thioredoxin-fold domain and a C-terminal alpha helical domain, with an active site located in a cleft between the two domains. GSH binds to the N-terminal domain while the hydrophobic substrate occupies a pocket in the C-terminal domain.. Length = 103 Score = 32.9 bits (75), Expect = 0.078 Identities = 9/54 (16%), Positives = 20/54 (37%), Gaps = 2/54 (3%) Query: 156 IKSRSWIAGHHMSYADFAASATISILDYLGEIDWDTAPIVKEWYQRMKSRPSFR 209 + ++ G + AD + + G + P + R+ RP+F+ Sbjct: 46 LAKGPYLLGERFTAADVLVGSPLGWGLQFGLLP--ERPAFDAYIARITDRPAFQ 97 >gnl|CDD|133109 cd06252, M14_ASTE_ASPA_like_2, A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases. ASTE catalyzes the fifth and last step in arginine catabolism by the arginine succinyltransferase pathway, and aspartoacylase (ASPA, also known as aminoacylase 2, and ACY-2; EC:3.5.1.15) cleaves N-acetyl L-aspartic acid (NAA) into aspartate and acetate. NAA is abundant in the brain, and hydrolysis of NAA by ASPA may help maintain white matter. ASPA is an NAA scavenger in other tissues. Mutations in the gene encoding ASPA cause Canavan disease (CD), a fatal progressive neurodegenerative disorder involving dysmyelination and spongiform degeneration of white matter in children. This enzyme binds zinc which is necessary for activity. Measurement of elevated NAA levels in urine is used in the diagnosis of CD. Length = 316 Score = 32.6 bits (75), Expect = 0.081 Identities = 20/69 (28%), Positives = 31/69 (44%), Gaps = 12/69 (17%) Query: 88 DPLQRAETRRMIE-------WFMYQMEQDVTRPLAHERVYKLHMTTEQGGG---SPDSKV 137 DP Q A M ++++ T A ER+ K ++TE GGG +PD+ Sbjct: 149 DPEQEARCLAAARAFGAPYTLLMREIDEAGTFDAAAERLGKTFVSTELGGGGTVTPDA-- 206 Query: 138 LRIARNNMR 146 + IA +R Sbjct: 207 VAIAERGVR 215 >gnl|CDD|48106 cd03179, GST_C_1, GST_C family, unknown subfamily 1; composed of uncharacterized bacterial proteins, with similarity to GSTs. GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress. GSTs also show GSH peroxidase activity and are involved in the synthesis of prostaglandins and leukotrienes. The GST fold contains an N-terminal thioredoxin-fold domain and a C-terminal alpha helical domain, with an active site located in a cleft between the two domains. GSH binds to the N-terminal domain while the hydrophobic substrate occupies a pocket in the C-terminal domain.. Length = 105 Score = 32.9 bits (75), Expect = 0.087 Identities = 24/113 (21%), Positives = 44/113 (38%), Gaps = 10/113 (8%) Query: 93 AETRRMIEWFMYQMEQ--DVTRPLAHERVYKLHMTTEQGGGSPDSKVLRIARNNMREHIK 150 E +++ W ++ L RVY G G D++VL R + Sbjct: 1 EERAQVLRWLFFEQYSHEPYIATLRFLRVY-------LGLGEADAEVLAFLRERGHAALA 53 Query: 151 YITWLIKSRSWIAGHHMSYADFAASATISILDYLGEIDWDTAPIVKEWYQRMK 203 + + R ++ G ++ AD A +A + D G D P ++ W R++ Sbjct: 54 VLEAHLAGRDFLVGDALTIADIALAAYTHVADEGG-FDLADYPAIRAWLARIE 105 >gnl|CDD|48606 cd03057, GST_N_Beta, GST_N family, Class Beta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress. The GST fold contains an N-terminal TRX-fold domain and a C-terminal alpha helical domain, with an active site located in a cleft between the two domains. Unlike mammalian GSTs which detoxify a broad range of compounds, the bacterial class Beta GSTs exhibit limited GSH conjugating activity with a narrow range of substrates. In addition to GSH conjugation, they also bind antibiotics and reduce the antimicrobial activity of beta-lactam drugs. The structure of the Proteus mirabilis enzyme reveals that the cysteine in the active site forms a covalent bond with GSH.. Length = 77 Score = 32.8 bits (75), Expect = 0.088 Identities = 17/75 (22%), Positives = 32/75 (42%), Gaps = 4/75 (5%) Query: 4 LYHYPLSSSSRFIRLILSEY--EFTTDMIE-EFPWGKRREFLELNPSGTLPVYIDEHMQA 60 LY+ P + S + L E F ++ K ++L +NP G +P + + + Sbjct: 3 LYYSP-GACSLAPHIALEELGLPFELVRVDLRTKTQKGADYLAINPKGQVPALVLDDGEV 61 Query: 61 LCGVFVISEYLDETY 75 L I +YL + + Sbjct: 62 LTESAAILQYLADLH 76 >gnl|CDD|48601 cd03052, GST_N_GDAP1, GST_N family, Ganglioside-induced differentiation-associated protein 1 (GDAP1) subfamily; GDAP1 was originally identified as a highly expressed gene at the differentiated stage of GD3 synthase-transfected cells. More recently, mutations in GDAP1 have been reported to cause both axonal and demyelinating autosomal-recessive Charcot-Marie-Tooth (CMT) type 4A neuropathy. CMT is characterized by slow and progressive weakness and atrophy of muscles. Sequence analysis of GDAP1 shows similarities and differences with GSTs; it appears to contain both N-terminal TRX-fold and C-terminal alpha helical domains of GSTs, however, it also contains additional C-terminal transmembrane domains unlike GSTs. GDAP1 is mainly expressed in neuronal cells and is localized in the mitochondria through its transmembrane domains. It does not exhibit GST activity using standard substrates.. Length = 73 Score = 32.3 bits (73), Expect = 0.11 Identities = 23/74 (31%), Positives = 42/74 (56%), Gaps = 6/74 (8%) Query: 3 ILYHYPLSSSSRFIRLILSEYEFTTDMIE-EFPWGKRRE--FLELNPSGTLPVYI-DEHM 58 +LYH+ S SS+ +RL+++E + + P + E F+ LNP+G +PV I +++ Sbjct: 2 VLYHWTQSFSSQKVRLVIAEKGLRCEEYDVSLPLSEHNEPWFMRLNPTGEVPVLIHGDNI 61 Query: 59 QALCGVFVISEYLD 72 +C I +YL+ Sbjct: 62 --ICDPTQIIDYLE 73 >gnl|CDD|48605 cd03056, GST_N_4, GST_N family, unknown subfamily 4; composed of uncharacterized bacterial proteins with similarity to GSTs. GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress. GSTs also show GSH peroxidase activity and are involved in the synthesis of prostaglandins and leukotrienes. The GST fold contains an N-terminal TRX-fold domain and a C-terminal alpha helical domain, with an active site located in a cleft between the two domains.. Length = 73 Score = 31.3 bits (71), Expect = 0.20 Identities = 24/71 (33%), Positives = 37/71 (52%), Gaps = 4/71 (5%) Query: 4 LYHYPLSSSSRFIRLILSEYEFTTDMIE-EFPWGKRR--EFLELNPSGTLPVYIDEHMQA 60 LY +PLS + +RL+L+ + +E + G+ R EFL LNP+G +PV + + Sbjct: 3 LYGFPLSGNCYKVRLLLALLGIPYEWVEVDILKGETRTPEFLALNPNGEVPVLELDG-RV 61 Query: 61 LCGVFVISEYL 71 L I YL Sbjct: 62 LAESNAILVYL 72 >gnl|CDD|48593 cd03044, GST_N_EF1Bgamma, GST_N family, Gamma subunit of Elongation Factor 1B (EFB1gamma) subfamily; EF1Bgamma is part of the eukaryotic translation elongation factor-1 (EF1) complex which plays a central role in the elongation cycle during protein biosynthesis. EF1 consists of two functionally distinct units, EF1A and EF1B. EF1A catalyzes the GTP-dependent binding of aminoacyl-tRNA to the ribosomal A site concomitant with the hydrolysis of GTP. The resulting inactive EF1A:GDP complex is recycled to the active GTP form by the guanine-nucleotide exchange factor EF1B, a complex composed of at least two subunits, alpha and gamma. Metazoan EFB1 contain a third subunit, beta. The EF1B gamma subunit contains a GST fold consisting of an N-terminal TRX-fold domain and a C-terminal alpha helical domain. The GST-like domain of EF1Bgamma is believed to mediate the dimerization of the EF1 complex, which in yeast is a dimer of the heterotrimer EF1A:EF1Balpha:EF1Bgamma. In addition to its role in protein biosynthesis, EF1Bgamma may also display other functions. The recombinant rice protein has been shown to possess GSH conjugating activity. The yeast EF1Bgamma binds membranes in a calcium dependent manner and is also part of a complex that binds to the msrA (methionine sulfoxide reductase) promoter suggesting a function in the regulation of its gene expression.. Length = 75 Score = 30.9 bits (70), Expect = 0.28 Identities = 18/71 (25%), Positives = 28/71 (39%), Gaps = 4/71 (5%) Query: 4 LYHYPLSSSSRFIRLILSEY---EFTTDMIEEFPWGKRREFLELNPSGTLPVYIDEHMQA 60 LY YP + S I L ++Y + + K EFL+ P G +P + Sbjct: 3 LYTYPGNPRSLKI-LAAAKYNGLDVEIVDFQPGKENKTPEFLKKFPLGKVPAFEGADGFC 61 Query: 61 LCGVFVISEYL 71 L I+ Y+ Sbjct: 62 LFESNAIAYYV 72 >gnl|CDD|48114 cd03187, GST_C_Phi, GST_C family, Class Phi subfamily; composed of plant-specific class Phi GSTs and related fungal and bacterial proteins. GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress. The GST fold contains an N-terminal thioredoxin-fold domain and a C-terminal alpha helical domain, with an active site located in a cleft between the two domains. GSH binds to the N-terminal domain while the hydrophobic substrate occupies a pocket in the C-terminal domain. The class Phi GST subfamily has experience extensive gene duplication. The Arabidopsis and Oryza genomes contain 13 and 16 Tau GSTs, respectively. They are primarily responsible for herbicide detoxification together with class Tau GSTs, showing class specificity in substrate preference. Phi enzymes are highly reactive toward chloroacetanilide and thiocarbamate herbicides. Some Phi GSTs have other functions including transport of flavonoid pigments to the vacuole, shoot regeneration and GSH peroxidase activity.. Length = 118 Score = 30.9 bits (70), Expect = 0.28 Identities = 24/109 (22%), Positives = 47/109 (43%), Gaps = 22/109 (20%) Query: 110 VTRPLAHERVYKLHMTTEQGGGSPDSKVLRIARNNMREHIK-YITWLIKSRSWIAG---- 164 LA E V+K + G D V+ +++ + Y L KS+ ++AG Sbjct: 20 PASALAFELVFKPML-----GLPTDEAVVEENEEKLKKVLDVYEARLSKSK-YLAGDSFT 73 Query: 165 ----HHMSYADFAASATISILDYLGEIDWDTAPIVKEWYQRMKSRPSFR 209 H+ Y + + + L +D+ P VK W++ + +RP+++ Sbjct: 74 LADLSHLPYLQYLMATPFAKL-------FDSRPHVKAWWEDISARPAWK 115 >gnl|CDD|48607 cd03058, GST_N_Tau, GST_N family, Class Tau subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress. The GST fold contains an N-terminal TRX-fold domain and a C-terminal alpha helical domain, with an active site located in a cleft between the two domains. The plant-specific class Tau GST subfamily has undergone extensive gene duplication. The Arabidopsis and Oryza genomes contain 28 and 40 Tau GSTs, respectively. They are primarily responsible for herbicide detoxification together with class Phi GSTs, showing class specificity in substrate preference. Tau enzymes are highly efficient in detoxifying diphenylether and aryloxyphenoxypropionate herbicides. In addition, Tau GSTs play important roles in intracellular signalling, biosynthesis of anthocyanin, responses to soil stresses and responses to auxin and cytokinin hormones.. Length = 74 Score = 30.9 bits (70), Expect = 0.28 Identities = 18/74 (24%), Positives = 31/74 (41%), Gaps = 2/74 (2%) Query: 3 ILYHYPLSSSSRFIRLILSEYEFTTDMIEEFPWGKRREFLELNP-SGTLPVYIDEHMQAL 61 L S +R+ L+ + +EE K L NP +PV + + + + Sbjct: 2 KLLGAWASPFVLRVRIALALKGVPYEYVEEDLGNKSELLLASNPVHKKIPVLL-HNGKPI 60 Query: 62 CGVFVISEYLDETY 75 C +I EY+DE + Sbjct: 61 CESLIIVEYIDEAW 74 >gnl|CDD|48116 cd03189, GST_C_GTT1_like, GST_C family, Saccharomyces cerevisiae GTT1-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S. cerevisiae GST protein, GTT1, and the Schizosaccharomyces pombe GST-III. GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress. GSTs also show GSH peroxidase activity and are involved in the synthesis of prostaglandins and leukotrienes. The GST fold contains an N-terminal thioredoxin-fold domain and a C-terminal alpha helical domain, with an active site located in a cleft between the two domains. GSH binds to the N-terminal domain while the hydrophobic substrate occupies a pocket in the C-terminal domain. GTT1, a homodimer, exhibits GST activity with standard substrates and associates with the endoplasmic reticulum. Its expression is induced after diauxic shift and remains high throughout the stationary phase. S. pombe GST-III is implicated in the detoxification of various metals.. Length = 119 Score = 30.6 bits (69), Expect = 0.40 Identities = 10/66 (15%), Positives = 29/66 (43%), Gaps = 1/66 (1%) Query: 141 ARNNMREHIKYITWLIKSRSWIAGHHMSYADFAASATISILDYLGEIDWDTAPIVKEWYQ 200 +++H+ ++ + + + G ++ AD S + G + P + + + Sbjct: 55 INPELKKHLDFLEDRLAKKGYFVGDKLTAADIMMSFPLEAALARGP-LLEKYPNIAAYLE 113 Query: 201 RMKSRP 206 R+++RP Sbjct: 114 RIEARP 119 >gnl|CDD|48119 cd03192, GST_C_Sigma_like, GST_C family, Class Sigma_like; composed of GSTs belonging to class Sigma and similar proteins, including GSTs from class Mu, Pi, and Alpha. GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress. The GST fold contains an N-terminal thioredoxin-fold domain and a C-terminal alpha helical domain, with an active site located in a cleft between the two domains. GSH binds to the N-terminal domain while the hydrophobic substrate occupies a pocket in the C-terminal domain. Vertebrate class Sigma GSTs are characterized as GSH-dependent hematopoietic prostaglandin (PG) D synthases and are responsible for the production of PGD2 by catalyzing the isomerization of PGH2. The functions of PGD2 include the maintenance of body temperature, inhibition of platelet aggregation, bronchoconstriction, vasodilation, and mediation of allergy and inflammation. Other class Sigma members include the class II insect GSTs, S-crystallins from cephalopods, nematode-specific GSTs, and 28-kDa GSTs from parasitic flatworms. Drosophila GST2 is associated with indirect flight muscle and exhibits preference for catalyzing GSH conjugation to lipid peroxidation products, indicating an anti-oxidant role. S-crystallin constitutes the major lens protein in cephalopod eyes and is responsible for lens transparency and proper refractive index. The 28-kDa GST from Schistosoma is a multifunctional enzyme, exhibiting GSH transferase, GSH peroxidase, and PGD2 synthase activities, and may play an important role in host-parasite interactions. Also members are novel GSTs from the fungus Cunninghamella elegans, designated as class Gamma, and from the protozoan Blepharisma japonicum, described as a light-inducible GST.. Length = 104 Score = 30.3 bits (68), Expect = 0.43 Identities = 9/45 (20%), Positives = 18/45 (40%), Gaps = 1/45 (2%) Query: 159 RSWIAGHHMSYADFAASATISILDYLGEIDWDTA-PIVKEWYQRM 202 ++ G +++AD + L YL P +K +R+ Sbjct: 60 GGYLVGDKLTWADLVVFDVLDYLLYLDPKLLLKKYPKLKALRERV 104 >gnl|CDD|48133 cd03206, GST_C_7, GST_C family, unknown subfamily 7; composed of uncharacterized proteins with similarity to GSTs. GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress. GSTs also show GSH peroxidase activity and are involved in the synthesis of prostaglandins and leukotrienes. The GST fold contains an N-terminal thioredoxin-fold domain and a C-terminal alpha helical domain, with an active site located in a cleft between the two domains. GSH binds to the N-terminal domain while the hydrophobic substrate occupies a pocket in the C-terminal domain.. Length = 100 Score = 29.8 bits (67), Expect = 0.64 Identities = 15/50 (30%), Positives = 26/50 (52%), Gaps = 1/50 (2%) Query: 159 RSWIAGHHMSYADFAASATISILDYLGEIDWDTAPIVKEWYQRMKSRPSF 208 R W+AG + AD A ++ L G +D + P ++ W R+++ P F Sbjct: 52 RDWLAGDRPTIADVAVYPYVA-LAPEGGVDLEDYPAIRRWLARIEALPGF 100 >gnl|CDD|48594 cd03045, GST_N_Delta_Epsilon, GST_N family, Class Delta and Epsilon subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress. GSTs also show GSH peroxidase activity and are involved in the synthesis of prostaglandins and leukotrienes. The GST fold contains an N-terminal TRX-fold domain and a C-terminal alpha helical domain, with an active site located in a cleft between the two domains. The class Delta and Epsilon subfamily is made up primarily of insect GSTs, which play major roles in insecticide resistance by facilitating reductive dehydrochlorination of insecticides or conjugating them with GSH to produce water-soluble metabolites that are easily excreted. They are also implicated in protection against cellular damage by oxidative stress.. Length = 74 Score = 29.3 bits (66), Expect = 0.95 Identities = 16/57 (28%), Positives = 24/57 (42%), Gaps = 3/57 (5%) Query: 3 ILYHYPLSSSSRFIRLILSEYEFTTDMIE---EFPWGKRREFLELNPSGTLPVYIDE 56 LY+ P S R + L ++ E + EFL+LNP T+P +D Sbjct: 2 DLYYLPGSPPCRAVLLTAKALGLELNLKEVNLMKGEHLKPEFLKLNPQHTVPTLVDN 58 >gnl|CDD|48591 cd03042, GST_N_Zeta, GST_N family, Class Zeta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress. The GST fold contains an N-terminal TRX-fold domain and a C-terminal alpha helical domain, with an active site located in a cleft between the two domains. Class Zeta GSTs, also known as maleylacetoacetate (MAA) isomerases, catalyze the isomerization of MAA to fumarylacetoacetate, the penultimate step in tyrosine/phenylalanine catabolism, using GSH as a cofactor. They show little GSH-conjugating activity towards traditional GST substrates but display modest GSH peroxidase activity. They are also implicated in the detoxification of the carcinogen dichloroacetic acid by catalyzing its dechlorination to glyoxylic acid.. Length = 73 Score = 29.0 bits (65), Expect = 1.1 Identities = 23/76 (30%), Positives = 32/76 (42%), Gaps = 10/76 (13%) Query: 3 ILYHYPLSSSSRFIRLILS------EYEFTTDMIEEFPWGKRREFLELNPSGTLPVYIDE 56 ILY Y SS+S +R+ L+ EY + E + LNP G +P + + Sbjct: 2 ILYSYFRSSASYRVRIALNLKGLDYEYVPVNLLKGE---QLSPAYRALNPQGLVPTLVID 58 Query: 57 HMQALCGVFVISEYLD 72 L I EYLD Sbjct: 59 G-LVLTQSLAIIEYLD 73 >gnl|CDD|48131 cd03204, GST_C_GDAP1, GST_C family, Ganglioside-induced differentiation-associated protein 1 (GDAP1) subfamily; GDAP1 was originally identified as a highly expressed gene at the differentiated stage of GD3 synthase-transfected cells. More recently, mutations in GDAP1 have been reported to cause both axonal and demyelinating autosomal-recessive Charcot-Marie-Tooth (CMT) type 4A neuropathy. CMT is characterized by slow and progressive weakness and atrophy of muscles. Sequence analysis of GDAP1 shows similarities and differences with GSTs; it appears to contain both N-terminal thioredoxin-fold and C-terminal alpha helical domains of GSTs, however, it also contains additional C-terminal transmembrane domains unlike GSTs. GDAP1 is mainly expressed in neuronal cells and is localized in the mitochondria through its transmembrane domains. It does not exhibit GST activity using standard substrates.. Length = 111 Score = 28.8 bits (64), Expect = 1.2 Identities = 17/66 (25%), Positives = 30/66 (45%), Gaps = 4/66 (6%) Query: 147 EHIKYITWLIKSRSWIAGHHMSYADFAASATISILDYLGEID--WDTA--PIVKEWYQRM 202 + K T K + W+ G + AD + T+ L +LG W P ++ +++R+ Sbjct: 46 QRRKEETEEQKCQLWLCGDTFTLADISLGVTLHRLKFLGLSRRYWGNGKRPNLEAYFERV 105 Query: 203 KSRPSF 208 R SF Sbjct: 106 LQRESF 111 >gnl|CDD|48602 cd03053, GST_N_Phi, GST_N family, Class Phi subfamily; composed of plant-specific class Phi GSTs and related fungal and bacterial proteins. GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress. The GST fold contains an N-terminal TRX-fold domain and a C-terminal alpha helical domain, with an active site located in a cleft between the two domains. The class Phi GST subfamily has experience extensive gene duplication. The Arabidopsis and Oryza genomes contain 13 and 16 Phi GSTs, respectively. They are primarily responsible for herbicide detoxification together with class Tau GSTs, showing class specificity in substrate preference. Phi enzymes are highly reactive toward chloroacetanilide and thiocarbamate herbicides. Some Phi GSTs have other functions including transport of flavonoid pigments to the vacuole, shoot regeneration and GSH peroxidase activity.. Length = 76 Score = 28.6 bits (64), Expect = 1.4 Identities = 15/56 (26%), Positives = 23/56 (41%), Gaps = 3/56 (5%) Query: 4 LYHYPLSSSSRFIRLILSE--YEFTTDMIEEFPW-GKRREFLELNPSGTLPVYIDE 56 LY +S+ R + L L E ++ ++ K E L NP G +P D Sbjct: 4 LYGAAMSTCVRRVLLCLEEKGVDYELVPVDLTKGEHKSPEHLARNPFGQIPALEDG 59 >gnl|CDD|48587 cd03038, GST_N_etherase_LigE, GST_N family, Beta etherase LigE subfamily; composed of proteins similar to Sphingomonas paucimobilis beta etherase, LigE, a GST-like protein that catalyzes the cleavage of the beta-aryl ether linkages present in low-moleculer weight lignins using GSH as the hydrogen donor. This reaction is an essential step in the degradation of lignin, a complex phenolic polymer that is the most abundant aromatic material in the biosphere. The beta etherase activity of LigE is enantioselective and it complements the activity of the other GST family beta etherase, LigF.. Length = 84 Score = 26.8 bits (59), Expect = 4.8 Identities = 12/38 (31%), Positives = 18/38 (47%) Query: 39 REFLELNPSGTLPVYIDEHMQALCGVFVISEYLDETYG 76 L T+PV +D + + F I+EYL+E Y Sbjct: 47 LGELTSGGFYTVPVIVDGSGEVIGDSFAIAEYLEEAYP 84 >gnl|CDD|176285 cd01209, SHC, SHC phosphotyrosine-binding (PTB) domain. SHC phosphotyrosine-binding (PTB) domain. SHC is a substrate for receptor tyrosine kinases, which can interact with phosphoproteins at NPXY motifs. SHC contains an PTB domain followed by an SH2 domain. PTB domains have a PH-like fold and are found in various eukaryotic signaling molecules. They were initially identified based upon their ability to recognize phosphorylated tyrosine residues In contrast to SH2 domains, which recognize phosphotyrosine and adjacent carboxy-terminal residues, PTB-domain binding specificity is conferred by residues amino-terminal to the phosphotyrosine. More recent studies have found that some types of PTB domains can bind to peptides which are not tyrosine phosphorylated or lack tyrosine residues altogether. Length = 160 Score = 26.4 bits (58), Expect = 6.0 Identities = 9/26 (34%), Positives = 12/26 (46%) Query: 162 IAGHHMSYADFAASATISILDYLGEI 187 IA HHM FA+ +Y+ I Sbjct: 97 IANHHMQSISFASGGDPDTAEYVAYI 122 >gnl|CDD|32604 COG2704, DcuB, Anaerobic C4-dicarboxylate transporter [General function prediction only]. Length = 436 Score = 26.3 bits (58), Expect = 7.3 Identities = 19/75 (25%), Positives = 35/75 (46%), Gaps = 16/75 (21%) Query: 137 VLRIARNNMREHIKYITWLIKSRSWIAGHHMSYADFAASATISILDYLGEIDWDTAPIVK 196 +++IA +R++ KYIT L ++ T++IL G + + P++ Sbjct: 73 MVQIAEKILRKNPKYITILAPFVTY---------------TLTILAGTGHVVYSILPVIA 117 Query: 197 EWYQRMKSRPSFRPL 211 E ++ RP RPL Sbjct: 118 EVAKKNGIRPE-RPL 131 >gnl|CDD|48592 cd03043, GST_N_1, GST_N family, unknown subfamily 1; composed of uncharacterized proteins, predominantly from bacteria, with similarity to GSTs. GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress. GSTs also show GSH peroxidase activity and are involved in the synthesis of prostaglandins and leukotrienes. The GST fold contains an N-terminal TRX-fold domain and a C-terminal alpha helical domain, with an active site located in a cleft between the two domains.. Length = 73 Score = 25.9 bits (57), Expect = 8.6 Identities = 14/54 (25%), Positives = 24/54 (44%), Gaps = 1/54 (1%) Query: 18 LILSEYEFTTDMIEEFPWGKRREFLELNPSGTLPVYIDEHMQALCGVFVISEYL 71 L + F ++ + R LE +P+G +PV +D + + I EYL Sbjct: 20 LKAAGIPFEEILVPLYTPDTRARILEFSPTGKVPVLVDGGI-VVWDSLAICEYL 72 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.322 0.136 0.419 Gapped Lambda K H 0.267 0.0623 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 3,000,338 Number of extensions: 154578 Number of successful extensions: 388 Number of sequences better than 10.0: 1 Number of HSP's gapped: 368 Number of HSP's successfully gapped: 50 Length of query: 230 Length of database: 6,263,737 Length adjustment: 91 Effective length of query: 139 Effective length of database: 4,297,318 Effective search space: 597327202 Effective search space used: 597327202 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 56 (25.6 bits)