RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780594|ref|YP_003065007.1| Glutathione S-transferase domain protein [Candidatus Liberibacter asiaticus str. psy62] (230 letters) >gnl|CDD|162274 TIGR01262, maiA, maleylacetoacetate isomerase. Maleylacetoacetate isomerase is an enzyme of tyrosine and phenylalanine catabolism. It requires glutathione and belongs by homology to the zeta family of glutathione S-transferases. The enzyme (EC 5.2.1.2) is described as active also on maleylpyruvate, and the example from a Ralstonia sp. catabolic plasmid is described as a maleylpyruvate isomerase involved in gentisate catabolism. Length = 210 Score = 50.4 bits (121), Expect = 4e-07 Identities = 35/101 (34%), Positives = 52/101 (51%), Gaps = 15/101 (14%) Query: 3 ILYHYPLSSSSRFIRLILS----EYEF-TTDMIEEFPWGKRR--EFLELNPSGTLPVYID 55 LY Y SS S +R+ L+ +YE+ +++ + G++R EFL LNP G +P Sbjct: 1 KLYSYWRSSCSYRVRIALALKGIDYEYVPVNLLRD---GEQRSPEFLALNPQGLVPTLDI 57 Query: 56 EHMQALCGVFVISEYLDETYGAIAQKNRLLSTDPLQRAETR 96 + + L I EYL+ETY LL DP++RA R Sbjct: 58 DG-EVLTQSLAIIEYLEETYPD----PPLLPADPIKRARVR 93 >gnl|CDD|181895 PRK09481, sspA, stringent starvation protein A; Provisional. Length = 211 Score = 42.8 bits (101), Expect = 7e-05 Identities = 49/206 (23%), Positives = 86/206 (41%), Gaps = 23/206 (11%) Query: 13 SRFIRLILSEYEFTTDMIEEFPWGKRREFLELNPSGTLPVYIDEHMQALCGVFVISEYLD 72 S +R++L+E + ++ + ++ ++LNP ++P +D + L +I EYLD Sbjct: 22 SHQVRIVLAEKGVSVEIEQVEKDNLPQDLIDLNPYQSVPTLVDREL-TLYESRIIMEYLD 80 Query: 73 ETYGAIAQKNRLLSTDPLQRAETRRMIEWFMYQMEQDVTRPLAHERVYKLHMTTEQGGGS 132 E + L+ P+ R E+R M M+++E+D Y L G S Sbjct: 81 ERF----PHPPLMPVYPVARGESRLM----MHRIEKD---------WYSLMNKIVNGSAS 123 Query: 133 PDSKVLRIARNNMREHIKYITWLIKSRSWIAGHHMSYADFAASATISILDYLG-EIDWDT 191 AR +RE + I + + + S D + + L LG E+ Sbjct: 124 EADA----ARKQLREELLAIAPVFGEKPYFMSEEFSLVDCYLAPLLWRLPVLGIELSGPG 179 Query: 192 APIVKEWYQRMKSRPSFRPLLSERIR 217 A +K + R+ R SF L+E R Sbjct: 180 AKELKGYMTRVFERDSFLASLTEAER 205 >gnl|CDD|182533 PRK10542, PRK10542, glutathionine S-transferase; Provisional. Length = 201 Score = 37.4 bits (87), Expect = 0.004 Identities = 38/177 (21%), Positives = 67/177 (37%), Gaps = 23/177 (12%) Query: 39 REFLELNPSGTLPVYIDEHMQALCGVFVISEYLDETYGAIAQKNRLLSTDPLQRAETRRM 98 ++L +NP G +P + + L I +YL ++ + + L L R T Sbjct: 41 DDYLAINPKGQVPALLLDDGTLLTEGVAIMQYLADS---VPDRQLLAPVGSLSRYHT--- 94 Query: 99 IEWFMYQMEQDVTRPLAHERVYKLH--MTTEQGGGSPDSKVLRIARNNMREHIKYITWLI 156 IEW Y +A E LH T +P+ R + + +Y+ + Sbjct: 95 IEWLNY---------IATE----LHKGFTPLFRPDTPEE-YKPTVRAQLEKKFQYVDEAL 140 Query: 157 KSRSWIAGHHMSYADFAASATISILDYLGEIDWDTAPIVKEWYQRMKSRPSFRPLLS 213 WI G + AD A T+ Y +++ + + + QR+ RP+ L Sbjct: 141 ADEQWICGQRFTIAD-AYLFTVLRWAYAVKLNLEGLEHIAAYMQRVAERPAVAAALK 196 >gnl|CDD|166036 PLN02395, PLN02395, glutathione S-transferase. Length = 215 Score = 36.4 bits (84), Expect = 0.006 Identities = 55/236 (23%), Positives = 98/236 (41%), Gaps = 50/236 (21%) Query: 1 MSILYHYPLSSSSR--FIRLILSEYEFTT---DMIEEFPWGKRR--EFLELNPSGTLPVY 53 M + + P +S + + LI EF T D+++ G+ + E+L L P G +PV Sbjct: 1 MVLKVYGPAFASPKRALVTLIEKGVEFETVPVDLMK----GEHKQPEYLALQPFGVVPVI 56 Query: 54 IDEHMQALCGVFVISEYLDETYGAIAQKNRLLSTDPLQRA-ETRRMIEWFMYQMEQDVTR 112 +D + ++ Y A+K R D L + E R +E ++ DV Sbjct: 57 VDGDYKIFESRAIMRYY--------AEKYRSQGPDLLGKTIEERGQVEQWL-----DVEA 103 Query: 113 PLAHERVYKLH---MTTEQGGGSPDSKVLRIARNNMREHIK-YITWLIKSRSWIAGHHMS 168 H + L + + G D KV++ + + + + Y L KS+ ++AG +S Sbjct: 104 TSYHPPLLNLTLHILFASKMGFPADEKVIKESEEKLAKVLDVYEARLSKSK-YLAGDFVS 162 Query: 169 YADFAASATISILDYLGEIDWDTAPI-----------VKEWYQRMKSRPSFRPLLS 213 AD A + +YL PI V W+ + SRP+++ +L+ Sbjct: 163 LADLAH---LPFTEYL------VGPIGKAYLIKDRKHVSAWWDDISSRPAWKEVLA 209 >gnl|CDD|172475 PRK13972, PRK13972, GSH-dependent disulfide bond oxidoreductase; Provisional. Length = 215 Score = 34.7 bits (79), Expect = 0.020 Identities = 45/179 (25%), Positives = 76/179 (42%), Gaps = 29/179 (16%) Query: 38 RREFLELNPSGTLPVYIDEHMQALCG----VF---VISEYLDETYGAIAQKNRLLSTDPL 90 R EFL ++P+ +P +D H A G +F I YL E G LS + Sbjct: 40 RPEFLRISPNNKIPAIVD-HSPADGGEPLSLFESGAILLYLAEKTGL------FLSHETR 92 Query: 91 QRAETRRMIEWFMYQMEQDVTRPLAHERVYKLHMTTEQGGGSPDSKVLRIARNNMREHIK 150 +RA T ++W +Q+ P+ + + H +P + I R + Sbjct: 93 ERAAT---LQWLFWQVGG--LGPMLGQNHHFNH-------AAPQTIPYAIERYQVETQRL 140 Query: 151 Y--ITWLIKSRSWIAGHHMSYADFAASATISILDYLGEIDWDTAPIVKEWYQRMKSRPS 207 Y + +++ W+ G + S AD A ++ ID P VK W++R++SRP+ Sbjct: 141 YHVLNKRLENSPWLGGENYSIADIACWPWVNAWTR-QRIDLAMYPAVKNWHERIRSRPA 198 >gnl|CDD|185068 PRK15113, PRK15113, glutathione S-transferase; Provisional. Length = 214 Score = 31.1 bits (71), Expect = 0.23 Identities = 11/35 (31%), Positives = 17/35 (48%), Gaps = 1/35 (2%) Query: 67 ISEYLDETYGAIAQKNRLLSTDPLQRAETRRMIEW 101 I+EYL+E + R+ D RA R++ W Sbjct: 75 IAEYLEERFAP-PAWERIYPADLQARARARQIQAW 108 >gnl|CDD|162528 TIGR01776, TonB-tbp-lbp, TonB-dependent lactoferrin and transferrin receptors. This family of TonB-dependent receptors are responsible for import of iron from the mammalian iron carriers lactoferrin and transferrin across the outer membrane. These receptors are found only in bacteria which can infect mammals such as Moraxella, Mannheimia, Neisseria, Actinobacillus, Pasteurella, Haemophilus and Histophilus species. Length = 932 Score = 28.2 bits (63), Expect = 1.6 Identities = 15/53 (28%), Positives = 22/53 (41%) Query: 49 TLPVYIDEHMQALCGVFVISEYLDETYGAIAQKNRLLSTDPLQRAETRRMIEW 101 + H +L F I +Y+D G K+ STD L + T R + W Sbjct: 581 PRKIKGSNHYISLNDNFTIGKYVDLGLGGRYDKHNFKSTDRLVYSGTYRNLSW 633 >gnl|CDD|184798 PRK14704, PRK14704, anaerobic ribonucleoside triphosphate reductase; Provisional. Length = 618 Score = 28.2 bits (63), Expect = 2.0 Identities = 12/30 (40%), Positives = 16/30 (53%) Query: 188 DWDTAPIVKEWYQRMKSRPSFRPLLSERIR 217 D D AP V++ +R K R PL E+I Sbjct: 141 DVDLAPYVRKTVERHKKRLQSYPLTKEQIE 170 >gnl|CDD|148394 pfam06762, DUF1222, Protein of unknown function (DUF1222). This family, which includes bacterial and eukaryotic members, represents a conserved region located towards the C-terminal end of a number of hypothetical proteins of unknown function. These are possibly integral membrane proteins. Length = 371 Score = 27.7 bits (62), Expect = 3.0 Identities = 17/50 (34%), Positives = 22/50 (44%), Gaps = 4/50 (8%) Query: 1 MSILYHYPL-SSSSRFIRLILSEYEFTT---DMIEEFPWGKRREFLELNP 46 +S+L H P RF+R L Y FTT + E W +R E P Sbjct: 316 LSLLAHNPFPDDPPRFVRARLYRYRFTTFAKERRETGQWWRRTLVGEYVP 365 >gnl|CDD|182405 PRK10357, PRK10357, putative glutathione S-transferase; Provisional. Length = 202 Score = 26.6 bits (59), Expect = 5.2 Identities = 17/66 (25%), Positives = 32/66 (48%), Gaps = 3/66 (4%) Query: 10 SSSSRFIR---LILSEYEFTTDMIEEFPWGKRREFLELNPSGTLPVYIDEHMQALCGVFV 66 S +S F+R ++L E T + + E P+ + NP G +P + E + + Sbjct: 6 SYTSPFVRKISILLLEKGITFEFVNELPYNADNGVAQYNPLGKVPALVTEEGECWFDSPI 65 Query: 67 ISEYLD 72 I+EY++ Sbjct: 66 IAEYIE 71 >gnl|CDD|152387 pfam11952, DUF3469, Protein of unknown function (DUF3469). This family of proteins are functionally uncharacterized. This protein is found in eukaryotes. Proteins in this family are typically between 108 to 439 amino acids in length. Length = 87 Score = 26.5 bits (59), Expect = 6.3 Identities = 11/45 (24%), Positives = 19/45 (42%), Gaps = 1/45 (2%) Query: 32 EFPWGKRREFLELNPSGTLPVYIDEHMQALCGVFVISEYLDETYG 76 + W RREF+E + P ++ + L V+ +L Y Sbjct: 11 DKHWELRREFIERH-KDDYPTGREDRLLCLSQVWANHVFLGCRYP 54 >gnl|CDD|162033 TIGR00770, Dcu, anaerobic c4-dicarboxylate membrane transporter family protein. These proteins are members of th C4-Dicarboxylate Uptake (Dcu) Family (TC 2.A.13). Most proteins in this family have 12 GES predicted transmembrane regions; however one member has 10 experimentally determined transmembrane regions with both the N- and C-termini localized to the periplasm. The two Escherichia coli proteins, DcuA and DcuB, transport aspartate, malate, fumarate and succinate, and function as antiporters with any two of these substrates. Since DcuA is encoded in an operon with the gene for aspartase, and DcuB is encoded in an operon with the gene for fumarase, their physiological functions may be to catalyze aspartate:fumarate and fumarate:malate exchange during the anaerobic utilization of aspartate and fumarate, respectively. Length = 430 Score = 26.2 bits (58), Expect = 7.7 Identities = 19/75 (25%), Positives = 34/75 (45%), Gaps = 16/75 (21%) Query: 137 VLRIARNNMREHIKYITWLIKSRSWIAGHHMSYADFAASATISILDYLGEIDWDTAPIVK 196 +++IA +R + KYIT L S ++ ++IL G + + T P++ Sbjct: 69 LVQIAEKLLRRNPKYITILAPSVTY---------------FLTILAGTGHVVYSTLPVIA 113 Query: 197 EWYQRMKSRPSFRPL 211 E + +P RPL Sbjct: 114 EVAKEQGIKPE-RPL 127 >gnl|CDD|132039 TIGR02994, ectoine_eutE, ectoine utilization protein EutE. Members of this family, part of the succinylglutamate desuccinylase / aspartoacylase family (pfam04952), belong to ectoine utilization operons, as found in Sinorhizobium meliloti 1021 (where it the operon is known to be induced by ectoine), Mesorhizobium loti, Silicibacter pomeroyi, Agrobacterium tumefaciens, and Pseudomonas putida. Length = 325 Score = 25.9 bits (57), Expect = 9.2 Identities = 12/33 (36%), Positives = 22/33 (66%), Gaps = 1/33 (3%) Query: 115 AHERVYKLHMTTEQGG-GSPDSKVLRIARNNMR 146 A E + K+ +TTE GG G+ ++ ++IA+ +R Sbjct: 196 AAEEMGKVFVTTELGGGGTASARTIKIAKRGVR 228 >gnl|CDD|129825 TIGR00742, yjbN, tRNA dihydrouridine synthase A. Members of this family show a distant relationship to alpha/beta (TIM) barrel enzymes such as dihydroorotate dehydrogenase and glycolate oxidase. Length = 318 Score = 25.9 bits (57), Expect = 9.5 Identities = 15/53 (28%), Positives = 28/53 (52%), Gaps = 12/53 (22%) Query: 113 PLAHERVYKL-----HMTTEQGGGSPDSKVLRIARNNMREHIKYITWLIKSRS 160 PL +ERVY+L H+T E GG +S+ +++H+ ++ ++ R Sbjct: 180 PLRYERVYQLKKDFPHLTIEINGGIKNSE-------QIKQHLSHVDGVMVGRE 225 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.322 0.136 0.419 Gapped Lambda K H 0.267 0.0644 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 3,945,347 Number of extensions: 247813 Number of successful extensions: 450 Number of sequences better than 10.0: 1 Number of HSP's gapped: 446 Number of HSP's successfully gapped: 21 Length of query: 230 Length of database: 5,994,473 Length adjustment: 90 Effective length of query: 140 Effective length of database: 4,049,753 Effective search space: 566965420 Effective search space used: 566965420 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 55 (25.1 bits)