HHsearch alignment for GI: 254780595 and conserved domain: COG1004

>COG1004 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelope biogenesis, outer membrane].
Probab=97.79  E-value=9.9e-05  Score=46.52  Aligned_cols=77  Identities=12%  Similarity=0.146  Sum_probs=55.3

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHCCCEEEECC------------CCCCCHHHHHHHCCCCEE
Q ss_conf             93999888888999999999889889999679446345564498289806------------786402346541156327
Q gi|254780595|r    1 MHLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFA------------DQKINNLLREKLYFTTHI   68 (289)
Q Consensus         1 MkIlI~GaG~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~~~~~~~~~~~------------~~~~~~~~~~~~~~~~~v   68 (289)
T Consensus         1 MkI~viGtGYVGLv~g~~lA~~GHeVv~vDid~~KV~~ln~g~~PI~EpgLe~ll~~~~~~gRl~fTtd~~~a~~~adv~   80 (414)
T COG1004           1 MKITVIGTGYVGLVTGACLAELGHEVVCVDIDESKVELLNKGISPIYEPGLEELLKENLASGRLRFTTDYEEAVKDADVV   80 (414)
T ss_pred             CCEEEECCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHCCCCCCCCCCHHHHHHHCCCCCCEEEECCHHHHHHCCCEE
T ss_conf             91589888556887899998709848999578899999867999976705899998462357279874788896259779


Q ss_pred             EEEECCCCC
Q ss_conf             876124443
Q gi|254780595|r   69 VQCIKPSSE   77 (289)
Q Consensus        69 ~~~~~~~~~   77 (289)
T Consensus        81 fIavgTP~~   89 (414)
T COG1004          81 FIAVGTPPD   89 (414)
T ss_pred             EEECCCCCC
T ss_conf             997489999