HHsearch alignment for GI: 254780595 and conserved domain: COG1086

>COG1086 Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism].
Probab=99.77  E-value=2.2e-17  Score=118.70  Aligned_cols=222  Identities=16%  Similarity=0.188  Sum_probs=160.5

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCC-CEEEEEECCHHHHHH----HHH----CCCEEEECCCCCCCHHHHHHHCC--CCEEE
Q ss_conf             3999888-888999999999889-889999679446345----564----49828980678640234654115--63278
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVG-VYTCGTTRSVSNLLT----LKH----KGISPFLFADQKINNLLREKLYF--TTHIV   69 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g-~~V~~~~r~~~~~~~----l~~----~~~~~~~~~~~~~~~~~~~~~~~--~~~v~   69 (289)
T Consensus       252 ~vLVTGagGSiGsel~~qil~~~p~~i~l~~~~E~~~~~i~~el~~~~~~~~~~~~igdVr-D~~~~~~~~~~~kvd~Vf  330 (588)
T COG1086         252 TVLVTGGGGSIGSELCRQILKFNPKEIILFSRDEYKLYLIDMELREKFPELKLRFYIGDVR-DRDRVERAMEGHKVDIVF  330 (588)
T ss_pred             EEEEECCCCCHHHHHHHHHHHCCCCEEEEECCCHHHHHHHHHHHHHHCCCCCEEEEECCCC-CHHHHHHHHHCCCCCEEE
T ss_conf             8999689873679999999854987899961763779999999986278751689963534-689999998638886688


Q ss_pred             EEEC----CCCCCCEE-----ECCCCCHHH--HHHHCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHH
Q ss_conf             7612----44433100-----012210134--432012334333320102576212345321123431134554455554
Q gi|254780595|r   70 QCIK----PSSEGDPC-----IISMSKDFY--KFMPHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKE  138 (289)
Q Consensus        70 ~~~~----~~~~~~~~-----~~~~~~~~~--~~~~~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~y~~~k~~~E~~  138 (289)
T Consensus       331 HAAA~KHVPl~E~nP~Eai~tNV~GT~nv~~aa~~~~V~~~V~iSTDK--------------AV~PtNvmGaTKr~aE~~  396 (588)
T COG1086         331 HAAALKHVPLVEYNPEEAIKTNVLGTENVAEAAIKNGVKKFVLISTDK--------------AVNPTNVMGATKRLAEKL  396 (588)
T ss_pred             EHHHHCCCCCHHCCHHHHHHHHHHHHHHHHHHHHHHCCCEEEEEECCC--------------CCCCCHHHHHHHHHHHHH
T ss_conf             755553686310188999987217389999999983977899970586--------------668841766889999999


Q ss_pred             HHHCCCCCC---CCCCCCCCCCCCCCCCCH----HHHHHCCCCCCCCCCCCEECCHHHHHHHHHHHHHHCCC-CCCCEEC
Q ss_conf             320012345---676420347777898503----44431134543222110001024777799999995135-5786162
Q gi|254780595|r  139 WLAITKKLN---IKLAVLRLSGIYGPKRNP----FIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHH-LGGIFNL  210 (289)
Q Consensus       139 ~~~~~~~~~---~~~~ilR~~~iyGp~r~~----~~~~~~g~~~~~~~~~~~~~~ihv~Dva~~i~~l~~~~-~~~iyni  210 (289)
T Consensus       397 ~~a~~~~~~~~~T~f~~VRFGNVlGSrGSViPlFk~QI~~GgplTvTdp~mtRyfMTI~EAv~LVlqA~a~~~gGeifvl  476 (588)
T COG1086         397 FQAANRNVSGTGTRFCVVRFGNVLGSRGSVIPLFKKQIAEGGPLTVTDPDMTRFFMTIPEAVQLVLQAGAIAKGGEIFVL  476 (588)
T ss_pred             HHHHHHCCCCCCCEEEEEEECCEECCCCCCHHHHHHHHHCCCCCCCCCCCCEEEEEEHHHHHHHHHHHHHHCCCCCEEEE
T ss_conf             99974104888857999982545458877778899999759984546867056788899999999998750689858998


Q ss_pred             CCCCHHHHHHHHHHHHHHHCCCCCCCCC
Q ss_conf             6843333899999999995579986343
Q gi|254780595|r  211 SDDEPAPPQNVIMEAASLMKITPPLEQC  238 (289)
Q Consensus       211 ~~~~~~s~~e~~~~i~~~~g~~~~~~~~  238 (289)
T Consensus       477 dMGepvkI~dLAk~mi~l~g~~~~~dI~  504 (588)
T COG1086         477 DMGEPVKIIDLAKAMIELAGQTPPGDIA  504 (588)
T ss_pred             CCCCCEEHHHHHHHHHHHHCCCCCCCCC
T ss_conf             1899727999999999981779988877