HHsearch alignment for GI: 254780595 and conserved domain: COG2910

>COG2910 Putative NADH-flavin reductase [General function prediction only].
Probab=99.48  E-value=4.1e-13  Score=94.35  Aligned_cols=195  Identities=17%  Similarity=0.128  Sum_probs=123.5

Q ss_pred             CEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHCCCEEEECCCCCCCHHHHHHHCCCCEEEEEECCC-CCC
Q ss_conf             93999888-8889999999998898899996794463455644982898067864023465411563278761244-433
Q gi|254780595|r    1 MHLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKLYFTTHIVQCIKPS-SEG   78 (289)
Q Consensus         1 MkIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~-~~~   78 (289)
T Consensus         1 mKIaiIgAsG~~Gs~i~~EA~~RGHeVTAivRn~~K~~~~--~~~~i~q~Dif-d~~~~a~~l~g~DaVIsA~~~~~~~~   77 (211)
T COG2910           1 MKIAIIGASGKAGSRILKEALKRGHEVTAIVRNASKLAAR--QGVTILQKDIF-DLTSLASDLAGHDAVISAFGAGASDN   77 (211)
T ss_pred             CEEEEEECCCHHHHHHHHHHHHCCCEEEEEEECHHHCCCC--CCCEEECCCCC-CHHHHHHHHCCCCEEEEECCCCCCCH
T ss_conf             9078995374567999999986798048998076766522--35302000222-74566766358766997215788871


Q ss_pred             CEEECCCCCHHHHHHH--CCCCCCCCCCE-EECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCC
Q ss_conf             1000122101344320--12334333320-10257621234532112343113455445555432001234567642034
Q gi|254780595|r   79 DPCIISMSKDFYKFMP--HVKWIGYLSST-SIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIKLAVLRL  155 (289)
Q Consensus        79 ~~~~~~~~~~~~~~~~--~~~~~i~~SS~-~VYg~~~g~~i~E~~~~~P~~~y~~~k~~~E~~~~~~~~~~~~~~~ilR~  155 (289)
T Consensus        78 ~~~~~k~~~~li~~l~~agv~RllVVGGAGSL~id~g~rL--vD~p~fP~ey~~~A~~~ae~-L~~Lr~~~~l~WTfvSP  154 (211)
T COG2910          78 DELHSKSIEALIEALKGAGVPRLLVVGGAGSLEIDEGTRL--VDTPDFPAEYKPEALAQAEF-LDSLRAEKSLDWTFVSP  154 (211)
T ss_pred             HHHHHHHHHHHHHHHHHCCCEEEEEECCCCCEEECCCCEE--ECCCCCCHHHHHHHHHHHHH-HHHHHHCCCCCEEEECC
T ss_conf             5778889999999986159705999847420587688455--05899856677999877899-99986356764599671


Q ss_pred             CCCCCCCCCHHHHHHCCCCCCCCCCCCEECCHHHHHHHHHHHHHHCCC
Q ss_conf             777789850344431134543222110001024777799999995135
Q gi|254780595|r  156 SGIYGPKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHH  203 (289)
Q Consensus       156 ~~iyGp~r~~~~~~~~g~~~~~~~~~~~~~~ihv~Dva~~i~~l~~~~  203 (289)
T Consensus       155 aa~f~PGe-rTg~yrlggD~ll~n~-~G~SrIS~aDYAiA~lDe~E~~  200 (211)
T COG2910         155 AAFFEPGE-RTGNYRLGGDQLLVNA-KGESRISYADYAIAVLDELEKP  200 (211)
T ss_pred             HHHCCCCC-CCCCEEECCCEEEECC-CCCEEEEHHHHHHHHHHHHHCC
T ss_conf             78457765-5685676363577748-8850344899999999877464