HHsearch alignment for GI: 254780595 and conserved domain: COG3967

>COG3967 DltE Short-chain dehydrogenase involved in D-alanine esterification of lipoteichoic acid and wall teichoic acid (D-alanine transfer protein) [Cell envelope biogenesis, outer membrane].
Probab=96.15  E-value=0.029  Score=32.43  Aligned_cols=78  Identities=15%  Similarity=0.113  Sum_probs=52.6

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHCC--CEEEECCCCCC------CHHHHHHHCCCCEEEEEE
Q ss_conf             3999888-88899999999988988999967944634556449--82898067864------023465411563278761
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKG--ISPFLFADQKI------NNLLREKLYFTTHIVQCI   72 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~~~~--~~~~~~~~~~~------~~~~~~~~~~~~~v~~~~   72 (289)
T Consensus         7 TiLITGG~sGIGl~lak~f~elgN~VIi~gR~e~~L~e~~~~~p~~~t~v~Dv~d~~~~~~lvewLkk~~P~lNvliNNA   86 (245)
T COG3967           7 TILITGGASGIGLALAKRFLELGNTVIICGRNEERLAEAKAENPEIHTEVCDVADRDSRRELVEWLKKEYPNLNVLINNA   86 (245)
T ss_pred             EEEEECCCCHHHHHHHHHHHHHCCEEEEECCCHHHHHHHHHCCCCHHEEEECCCCHHHHHHHHHHHHHHCCCHHEEEECC
T ss_conf             79993796436599999999838979996574999999986094131565132035669999999986298611343030


Q ss_pred             CCCCCCC
Q ss_conf             2444331
Q gi|254780595|r   73 KPSSEGD   79 (289)
Q Consensus        73 ~~~~~~~   79 (289)
T Consensus        87 GIqr~~d   93 (245)
T COG3967          87 GIQRNED   93 (245)
T ss_pred             CCCCHHH
T ss_conf             0032011