HHsearch alignment for GI: 254780595 and conserved domain: KOG0409

>KOG0409 consensus.
Probab=96.83  E-value=0.0033  Score=37.85  Aligned_cols=76  Identities=12%  Similarity=0.150  Sum_probs=59.2

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHCCCEEEECCCCCCCHHHHHHHCCCCEEEEEECCCCCCCEE
Q ss_conf             39998888889999999998898899996794463455644982898067864023465411563278761244433100
Q gi|254780595|r    2 HLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKLYFTTHIVQCIKPSSEGDPC   81 (289)
Q Consensus         2 kIlI~GaG~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~~~~~~   81 (289)
T Consensus        37 ~iGFIGLG~MG~~M~~nLik~G~kVtV~dr~~~k~~~f~~~Ga~v--------~~sPaeVae~sDvvitmv~~~~~v~~v  108 (327)
T KOG0409          37 RIGFIGLGNMGSAMVSNLIKAGYKVTVYDRTKDKCKEFQEAGARV--------ANSPAEVAEDSDVVITMVPNPKDVKDV  108 (327)
T ss_pred             EEEEEEECCCHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCHHH--------HCCHHHHHHHCCEEEEECCCHHHHHHH
T ss_conf             135774341118999999975987999958678878999705014--------079799986368899976880766888


Q ss_pred             ECCC
Q ss_conf             0122
Q gi|254780595|r   82 IISM   85 (289)
Q Consensus        82 ~~~~   85 (289)
T Consensus       109 ~~g~  112 (327)
T KOG0409         109 LLGK  112 (327)
T ss_pred             HCCC
T ss_conf             4077