HHsearch alignment for GI: 254780595 and conserved domain: KOG0747

>KOG0747 consensus.
Probab=100.00  E-value=8.4e-45  Score=275.18  Aligned_cols=281  Identities=18%  Similarity=0.236  Sum_probs=196.7

Q ss_pred             EEEEEC-CCHHHHHHHHHHHHC--CCEEEEE-----ECCHHHHHHHHH-CCCEEEECCCCCCCHHHH-HHHCCCCEEEEE
Q ss_conf             399988-888899999999988--9889999-----679446345564-498289806786402346-541156327876
Q gi|254780595|r    2 HLMIFG-AGYTGKFIADAALKV--GVYTCGT-----TRSVSNLLTLKH-KGISPFLFADQKINNLLR-EKLYFTTHIVQC   71 (289)
Q Consensus         2 kIlI~G-aG~iG~~l~~~L~~~--g~~V~~~-----~r~~~~~~~l~~-~~~~~~~~~~~~~~~~~~-~~~~~~~~v~~~   71 (289)
T Consensus         8 ~vlItgg~gfi~Sn~~~~~~~~~p~~~~v~idkL~~~s~~~~l~~~~n~p~ykfv~~di~~~~~~~~~~~~~~id~vihf   87 (331)
T KOG0747           8 NVLITGGAGFIGSNFINYLVDKYPDYKFVNLDKLDYCSNLKNLEPVRNSPNYKFVEGDIADADLVLYLFETEEIDTVIHF   87 (331)
T ss_pred             EEEEECCCCCCCHHHHHHCCCCCCCCCEEEEECCCCCCCHHHHHHHCCCCCCEEEECHHCCCHHHHHHHCCCCHHHHHHH
T ss_conf             08985476753113455334679987778762000024313544312588716860301050998765336715777767


Q ss_pred             ECCCCC---C-C------EEECCCCCHHHHH--HHCCCCCCCCCCEEECCCCCCCCCC-CCCCCCCCCHHHHHHHHHHHH
Q ss_conf             124443---3-1------0001221013443--2012334333320102576212345-321123431134554455554
Q gi|254780595|r   72 IKPSSE---G-D------PCIISMSKDFYKF--MPHVKWIGYLSSTSIYGNREGQWVD-EHSFVHPISCVATQRFNAEKE  138 (289)
Q Consensus        72 ~~~~~~---~-~------~~~~~~~~~~~~~--~~~~~~~i~~SS~~VYg~~~g~~i~-E~~~~~P~~~y~~~k~~~E~~  138 (289)
T Consensus        88 aa~t~vd~s~~~~~~~~~nnil~t~~Lle~~~~sg~i~~fvhvSTdeVYGds~~~~~~~E~s~~nPtnpyAasKaAaE~~  167 (331)
T KOG0747          88 AAQTHVDRSFGDSFEFTKNNILSTHVLLEAVRVSGNIRRFVHVSTDEVYGDSDEDAVVGEASLLNPTNPYAASKAAAEML  167 (331)
T ss_pred             HHHHHHHHHHCCHHHHHCCCCHHHHHHHHHHHHCCCEEEEEEECCCCEECCCCCCCCCCCCCCCCCCCCHHHHHHHHHHH
T ss_conf             76641466507658774576034577999988504734799964640234766445633225689998037889999999


Q ss_pred             HHHCCCCCCCCCCCCCCCCCCCCCCCH------HHH--HHCCCCCCCCCCCCEECCHHHHHHHHHHHHHHCCC-CCCCEE
Q ss_conf             320012345676420347777898503------444--31134543222110001024777799999995135-578616
Q gi|254780595|r  139 WLAITKKLNIKLAVLRLSGIYGPKRNP------FIK--IRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHH-LGGIFN  209 (289)
Q Consensus       139 ~~~~~~~~~~~~~ilR~~~iyGp~r~~------~~~--~~~g~~~~~~~~~~~~~~ihv~Dva~~i~~l~~~~-~~~iyn  209 (289)
T Consensus       168 v~Sy~~sy~lpvv~~R~nnVYGP~q~~~klipkFi~l~~~~~~~~i~g~g~~~rs~l~veD~~ea~~~v~~Kg~~geIYN  247 (331)
T KOG0747         168 VRSYGRSYGLPVVTTRMNNVYGPNQYPEKLIPKFIKLAMRGKEYPIHGDGLQTRSYLYVEDVSEAFKAVLEKGELGEIYN  247 (331)
T ss_pred             HHHHHHHCCCCEEEEECCCCCCCCCCHHHHHHHHHHHHHHCCCCCEECCCCCCEEEEEHHHHHHHHHHHHHCCCCCCEEE
T ss_conf             99987604971799941573388857167768899999718976421574101225769999999999984578562364


Q ss_pred             CCCCCHHHHHHHHHHHHHHHCCCCCCCCCCCCC----CCCHHHHHHHCCCCEECHHHHHHCCCCCCCCCHHHHHHHHHHH
Q ss_conf             268433338999999999955799863431012----5682446553069451689999739844899999999999997
Q gi|254780595|r  210 LSDDEPAPPQNVIMEAASLMKITPPLEQCFDTA----NISPFTRFFYADNKRISNAKIKSLGFQLLYPNYRISLKQLWKE  285 (289)
Q Consensus       210 i~~~~~~s~~e~~~~i~~~~g~~~~~~~~~~~~----~~~~~~~~~~~~~~~is~~kl~~lG~~p~~p~~~~gl~~~~~~  285 (289)
T Consensus       248 Igtd~e~~~~~l~k~i~eli~~~~~-~~~~~p~~~~v~dRp----~nd~Ry~~~~eKik~LGw~~~~p-~~eGLrktie~  321 (331)
T KOG0747         248 IGTDDEMRVIDLAKDICELFEKRLP-NIDTEPFIFFVEDRP----YNDLRYFLDDEKIKKLGWRPTTP-WEEGLRKTIEW  321 (331)
T ss_pred             CCCCCHHHHHHHHHHHHHHHHHHCC-CCCCCCCCEECCCCC----CCCCCCCCCHHHHHHCCCCCCCC-HHHHHHHHHHH
T ss_conf             1683076699999999999997546-888888633158887----64201000588897538721576-78889999999


Q ss_pred             HHC
Q ss_conf             513
Q gi|254780595|r  286 IEN  288 (289)
Q Consensus       286 ~~~  288 (289)
T Consensus       322 y~~  324 (331)
T KOG0747         322 YTK  324 (331)
T ss_pred             HHH
T ss_conf             986