HHsearch alignment for GI: 254780595 and conserved domain: KOG1209

>KOG1209 consensus.
Probab=97.57  E-value=0.00022  Score=44.58  Aligned_cols=72  Identities=17%  Similarity=0.233  Sum_probs=52.7

Q ss_pred             EEEEECC--CHHHHHHHHHHHHCCCEEEEEECCHHHHHHHH-HCCCEEEECCCCCCCHHHH------HHH-CCCCEEEEE
Q ss_conf             3999888--88899999999988988999967944634556-4498289806786402346------541-156327876
Q gi|254780595|r    2 HLMIFGA--GYTGKFIADAALKVGVYTCGTTRSVSNLLTLK-HKGISPFLFADQKINNLLR------EKL-YFTTHIVQC   71 (289)
Q Consensus         2 kIlI~Ga--G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~-~~~~~~~~~~~~~~~~~~~------~~~-~~~~~v~~~   71 (289)
T Consensus         9 ~VlItgcs~GGIG~ala~ef~~~G~~V~AtaR~~e~M~~L~~~~gl~~~kLDV~~~~~V~~v~~evr~~~~Gkld~L~NN   88 (289)
T KOG1209           9 KVLITGCSSGGIGYALAKEFARNGYLVYATARRLEPMAQLAIQFGLKPYKLDVSKPEEVVTVSGEVRANPDGKLDLLYNN   88 (289)
T ss_pred             EEEEEECCCCCHHHHHHHHHHHCCEEEEEECCCCCHHHHHHHHHCCEEEEECCCCHHHHHHHHHHHHHCCCCCEEEEECC
T ss_conf             59996057765349999999867819999702246076678860970587056872778998888861899826888717


Q ss_pred             EC
Q ss_conf             12
Q gi|254780595|r   72 IK   73 (289)
Q Consensus        72 ~~   73 (289)
T Consensus        89 AG   90 (289)
T KOG1209          89 AG   90 (289)
T ss_pred             CC
T ss_conf             99