HHsearch alignment for GI: 254780595 and conserved domain: KOG1210

>KOG1210 consensus.
Probab=97.25  E-value=0.0063  Score=36.21  Aligned_cols=187  Identities=17%  Similarity=0.153  Sum_probs=93.4

Q ss_pred             EEEEEC-CCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHC-----CCEEEEC--CCCCCCHHHH---HHH----CCCC
Q ss_conf             399988-88889999999998898899996794463455644-----9828980--6786402346---541----1563
Q gi|254780595|r    2 HLMIFG-AGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHK-----GISPFLF--ADQKINNLLR---EKL----YFTT   66 (289)
Q Consensus         2 kIlI~G-aG~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~~~-----~~~~~~~--~~~~~~~~~~---~~~----~~~~   66 (289)
T Consensus        35 hi~itggS~glgl~la~e~~~~ga~Vti~ar~~~kl~~a~~~l~l~~~~~~v~~~S~d~~~Y~~v~~~~~~l~~~~~~~d  114 (331)
T KOG1210          35 HILITGGSSGLGLALALECKREGADVTITARSGKKLLEAKAELELLTQVEDVSYKSVDVIDYDSVSKVIEELRDLEGPID  114 (331)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCCEEEEECCHHHHHHHHHHHHHHHCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCCC
T ss_conf             69981684156689999999703742999464878999874311444353036753553028999988763233048950


Q ss_pred             EEEEEECC---CCCCCEEE--------CCC------CCHHHHHHHCCC---CCCCCCCE-EECCCCCCCCCCCCCCCCCC
Q ss_conf             27876124---44331000--------122------101344320123---34333320-10257621234532112343
Q gi|254780595|r   67 HIVQCIKP---SSEGDPCI--------ISM------SKDFYKFMPHVK---WIGYLSST-SIYGNREGQWVDEHSFVHPI  125 (289)
Q Consensus        67 ~v~~~~~~---~~~~~~~~--------~~~------~~~~~~~~~~~~---~~i~~SS~-~VYg~~~g~~i~E~~~~~P~  125 (289)
T Consensus       115 ~l~~cAG~~v~g~f~~~s~~~v~~~m~vNylgt~~v~~~~~~~mk~~~~~g~I~~vsS~~a~~~i------------~Gy  182 (331)
T KOG1210         115 NLFCCAGVAVPGLFEDLSPEVVEKLMDVNYLGTVNVAKAAARAMKKREHLGRIILVSSQLAMLGI------------YGY  182 (331)
T ss_pred             EEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEEHHHHHHCCC------------CCC
T ss_conf             27870676554200139999999988755344679999999986322568479984332541675------------664


Q ss_pred             CHHHHHHHHHHH---HHHHCCCCCCCCCCCCCCCCCCCCCCCHHHHHHCCCCCCCCCCCCEECCHHHHHHHHHHHHHHCC
Q ss_conf             113455445555---43200123456764203477778985034443113454322211000102477779999999513
Q gi|254780595|r  126 SCVATQRFNAEK---EWLAITKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTH  202 (289)
Q Consensus       126 ~~y~~~k~~~E~---~~~~~~~~~~~~~~ilR~~~iyGp~r~~~~~~~~g~~~~~~~~~~~~~~ihv~Dva~~i~~l~~~  202 (289)
T Consensus       183 saYs~sK~alrgLa~~l~qE~i~~~v~Vt~~~P~~~~tpGfE~En~tkP~~t~ii~g~s---s~~~~e~~a~~~~~~~~r  259 (331)
T KOG1210         183 SAYSPSKFALRGLAEALRQELIKYGVHVTLYYPPDTLTPGFERENKTKPEETKIIEGGS---SVIKCEEMAKAIVKGMKR  259 (331)
T ss_pred             CCCCCHHHHHHHHHHHHHHHHHHCCEEEEEECCCCCCCCCCCCCCCCCCHHEEEECCCC---CCCCHHHHHHHHHHHHHH
T ss_conf             13560789999999999998765266999972898789764310236742103100788---876889999999867760


Q ss_pred             C
Q ss_conf             5
Q gi|254780595|r  203 H  203 (289)
Q Consensus       203 ~  203 (289)
T Consensus       260 g  260 (331)
T KOG1210         260 G  260 (331)
T ss_pred             C
T ss_conf             6