HHsearch alignment for GI: 254780595 and conserved domain: KOG1430

>KOG1430 consensus.
Probab=99.97  E-value=2.5e-30  Score=192.56  Aligned_cols=285  Identities=17%  Similarity=0.197  Sum_probs=188.3

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCC--CEEEEEECCHHHH--HHH-H--HCCCEEEECCCCCCCHHHHHHHCCCCEEEEEEC
Q ss_conf             3999888-888999999999889--8899996794463--455-6--449828980678640234654115632787612
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVG--VYTCGTTRSVSNL--LTL-K--HKGISPFLFADQKINNLLREKLYFTTHIVQCIK   73 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g--~~V~~~~r~~~~~--~~l-~--~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~   73 (289)
T Consensus         6 ~vlVtGG~GflG~hlv~~L~~~~~~~~irv~D~~~~~~~~~~e~~~~~~~~v~~~~~D~~~~~~i~~a~~~~-~Vvh~aa   84 (361)
T KOG1430           6 SVLVTGGSGFLGQHLVQALLENELKLEIRVVDKTPTQSNLPAELTGFRSGRVTVILGDLLDANSISNAFQGA-VVVHCAA   84 (361)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCHHHHCCCCCCEEEEECCHHHHHHHHHHCCCC-EEEEECC
T ss_conf             799989833789999999984566617999536775556514553346774368722300005566521576-0787516


Q ss_pred             CC-CC-----C---CEEECCCCCHHHHHH--HCCCCCCCCCCEEECCCCCC-CCCCCCCC--CCCCCHHHHHHHHHHHHH
Q ss_conf             44-43-----3---100012210134432--01233433332010257621-23453211--234311345544555543
Q gi|254780595|r   74 PS-SE-----G---DPCIISMSKDFYKFM--PHVKWIGYLSSTSIYGNREG-QWVDEHSF--VHPISCVATQRFNAEKEW  139 (289)
Q Consensus        74 ~~-~~-----~---~~~~~~~~~~~~~~~--~~~~~~i~~SS~~VYg~~~g-~~i~E~~~--~~P~~~y~~~k~~~E~~~  139 (289)
T Consensus        85 ~~~~~~~~~~~~~~~~vNV~gT~nvi~~c~~~~v~~lIYtSs~~Vvf~g~~~~n~~E~~p~p~~~~d~Y~~sKa~aE~~V  164 (361)
T KOG1430          85 SPVPDFVENDRDLAMRVNVNGTLNVIEACKELGVKRLIYTSSAYVVFGGEPIINGDESLPYPLKHIDPYGESKALAEKLV  164 (361)
T ss_pred             CCCCCCCCCCHHHHEEECCHHHHHHHHHHHHHCCCEEEEECCCEEEECCEECCCCCCCCCCCCCCCCCCCHHHHHHHHHH
T ss_conf             56752023561252141405089999999982987899946742886883545577787875545543325899999999


Q ss_pred             HHCCCCCCCCCCCCCCCCCCCCCCCH-----HHHHHCCCCC-CCCCCCCEECCHHHHHHHHHHHH----HHCCC---CCC
Q ss_conf             20012345676420347777898503-----4443113454-32221100010247777999999----95135---578
Q gi|254780595|r  140 LAITKKLNIKLAVLRLSGIYGPKRNP-----FIKIRQKNSL-RLVKKNQVFNRIRVEDVARCVIF----LMTHH---LGG  206 (289)
Q Consensus       140 ~~~~~~~~~~~~ilR~~~iyGp~r~~-----~~~~~~g~~~-~~~~~~~~~~~ihv~Dva~~i~~----l~~~~---~~~  206 (289)
T Consensus       165 l~an~~~~l~T~aLR~~~IYGpgd~~~~~~i~~~~~~g~~~f~~g~~~~~~~~~~~~Nva~ahilA~~aL~~~~~~~~Gq  244 (361)
T KOG1430         165 LEANGSDDLYTCALRPPGIYGPGDKRLLPKIVEALKNGGFLFKIGDGENLNDFTYGENVAWAHILAARALLDKSPSVNGQ  244 (361)
T ss_pred             HHHCCCCCEEEEEECCCCCCCCCCCCCCHHHHHHHHHCCCEEEEECCCCCCCEEEECHHHHHHHHHHHHHHHCCCCCCCE
T ss_conf             98569987158997034111799752047899999806851786056641022880232799998899887148766850


Q ss_pred             CEECCCCCHHHHHHHHHHHHHHHCCCCCCCCCCCC------CC--------C-------CHHHHHHHCCCCEECHHHHH-
Q ss_conf             61626843333899999999995579986343101------25--------6-------82446553069451689999-
Q gi|254780595|r  207 IFNLSDDEPAPPQNVIMEAASLMKITPPLEQCFDT------AN--------I-------SPFTRFFYADNKRISNAKIK-  264 (289)
Q Consensus       207 iyni~~~~~~s~~e~~~~i~~~~g~~~~~~~~~~~------~~--------~-------~~~~~~~~~~~~~is~~kl~-  264 (289)
T Consensus       245 ~yfI~d~~p~~~~~~~~~l~~~lg~~~~~~~~~p~~l~~~~~~l~e~~~~~l~p~~p~lt~~~v~~~~~~~~f~~~kA~~  324 (361)
T KOG1430         245 FYFITDDTPVRFFDFLSPLVKALGYCLPSSIKLPLFLSYFLAYLLEIVYFLLRPYQPILTRFRVALLGVTRTFSIEKAKR  324 (361)
T ss_pred             EEEEECCCCCHHHHHHHHHHHHCCCCCCCEEECCHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHEEECCCCCCCHHHHHH
T ss_conf             89986898120368889998843999875564435899999999999998606778775766722311445507899877


Q ss_pred             HCCCCCCCCCHHHHHHHHHHHHHC
Q ss_conf             739844899999999999997513
Q gi|254780595|r  265 SLGFQLLYPNYRISLKQLWKEIEN  288 (289)
Q Consensus       265 ~lG~~p~~p~~~~gl~~~~~~~~~  288 (289)
T Consensus       325 ~lgY~P~~-~~~e~~~~~~~~~~~  347 (361)
T KOG1430         325 ELGYKPLV-SLEEAIQRTIHWVAS  347 (361)
T ss_pred             HHCCCCCC-CHHHHHHHHHHHHHH
T ss_conf             62899867-878989999998734