HHsearch alignment for GI: 254780595 and conserved domain: KOG1611

>KOG1611 consensus.
Probab=94.07  E-value=0.43  Score=25.78  Aligned_cols=131  Identities=13%  Similarity=-0.002  Sum_probs=66.2

Q ss_pred             EEEEECC-CHHHHHHHHHHHH-CCCEEEEEE-CCHHHH-HHHH-----HCCCEEEECCCCCCCHHHHHH---------HC
Q ss_conf             3999888-8889999999998-898899996-794463-4556-----449828980678640234654---------11
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALK-VGVYTCGTT-RSVSNL-LTLK-----HKGISPFLFADQKINNLLREK---------LY   63 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~-~g~~V~~~~-r~~~~~-~~l~-----~~~~~~~~~~~~~~~~~~~~~---------~~   63 (289)
T Consensus         5 sv~ItGaNRGIGlgLVk~llk~~~i~~iiat~r~~e~a~~~l~~k~~~d~rvHii~Ldvt~d-eS~~~~~~~V~~iVg~~   83 (249)
T KOG1611           5 SVFITGANRGIGLGLVKELLKDKGIEVIIATARDPEKAATELALKSKSDSRVHIIQLDVTCD-ESIDNFVQEVEKIVGSD   83 (249)
T ss_pred             CEEEECCCCCHHHHHHHHHHCCCCCEEEEEECCCHHHHHHHHHHHHCCCCCEEEEEEECCCH-HHHHHHHHHHHHHCCCC
T ss_conf             08996267621077889983578847999844796776578787632588527998733657-77999999987514668


Q ss_pred             CCCEEEEEECCCCCCCE--------EECCCCCH--------------HHHHHHC---------CCCCCCCCCEEECCCCC
Q ss_conf             56327876124443310--------00122101--------------3443201---------23343333201025762
Q gi|254780595|r   64 FTTHIVQCIKPSSEGDP--------CIISMSKD--------------FYKFMPH---------VKWIGYLSSTSIYGNRE  112 (289)
Q Consensus        64 ~~~~v~~~~~~~~~~~~--------~~~~~~~~--------------~~~~~~~---------~~~~i~~SS~~VYg~~~  112 (289)
T Consensus        84 GlnlLinNaGi~~~y~~~~~~~r~~~~~~~~tN~v~~il~~Q~~lPLLkkaas~~~gd~~s~~raaIinisS~~--~s~~  161 (249)
T KOG1611          84 GLNLLINNAGIALSYNTVLKPSRAVLLEQYETNAVGPILLTQAFLPLLKKAASKVSGDGLSVSRAAIINISSSA--GSIG  161 (249)
T ss_pred             CCEEEEECCCEEEECCCCCCCCHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEEEECCC--CCCC
T ss_conf             70588854600132345668858999987501340399999999999998752246776564313589852111--3457


Q ss_pred             CCCCCCCCCCCCCCHHHHHHHHHHHHHHH
Q ss_conf             12345321123431134554455554320
Q gi|254780595|r  113 GQWVDEHSFVHPISCVATQRFNAEKEWLA  141 (289)
Q Consensus       113 g~~i~E~~~~~P~~~y~~~k~~~E~~~~~  141 (289)
T Consensus       162 ~------~~~~~~~AYrmSKaAlN~f~ks  184 (249)
T KOG1611         162 G------FRPGGLSAYRMSKAALNMFAKS  184 (249)
T ss_pred             C------CCCCCHHHHHHHHHHHHHHHHH
T ss_conf             8------7776345667559999999988