HHsearch alignment for GI: 254780595 and conserved domain: KOG4039

>KOG4039 consensus.
Probab=97.66  E-value=0.00011  Score=46.28  Aligned_cols=143  Identities=14%  Similarity=0.044  Sum_probs=79.0

Q ss_pred             CEEEEECC-CHHHHHHHHHHHHCC--CEEEEEECCHHHHHHHHHCCCEEEECCCCCCCHHHHHHHCCCCEEEEEECCCCC
Q ss_conf             93999888-888999999999889--889999679446345564498289806786402346541156327876124443
Q gi|254780595|r    1 MHLMIFGA-GYTGKFIADAALKVG--VYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKLYFTTHIVQCIKPSSE   77 (289)
Q Consensus         1 MkIlI~Ga-G~iG~~l~~~L~~~g--~~V~~~~r~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~~   77 (289)
T Consensus        19 ~s~fvlGAtG~~G~~llk~~~E~~~FSKV~~i~RR~~~d~-at~k~v~q~~vDf~Kl-~~~a~~~qg~dV~FcaLgTTRg   96 (238)
T KOG4039          19 MSGFVLGATGLCGGGLLKHAQEAPQFSKVYAILRRELPDP-ATDKVVAQVEVDFSKL-SQLATNEQGPDVLFCALGTTRG   96 (238)
T ss_pred             CCEEEEECCCCCCHHHHHHHHHCCCCEEEEEEEECCCCCC-CCCCEEEEEEECHHHH-HHHHHHHCCCCEEEEEECCCCC
T ss_conf             2247885355313899999885656206999973157984-2136454678326888-8877650288568996113555


Q ss_pred             ---CCEEE---CCC--CCHHHHHHHCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCCCC
Q ss_conf             ---31000---122--1013443201233433332010257621234532112343113455445555432001234567
Q gi|254780595|r   78 ---GDPCI---ISM--SKDFYKFMPHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEKEWLAITKKLNIK  149 (289)
Q Consensus        78 ---~~~~~---~~~--~~~~~~~~~~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~y~~~k~~~E~~~~~~~~~~~~~  149 (289)
T Consensus        97 kaGadgfykvDhDyvl~~A~~AKe~Gck~fvLvSS~GAd---------~sS----rFlY~k~KGEvE~~v~eL~F~---~  160 (238)
T KOG4039          97 KAGADGFYKVDHDYVLQLAQAAKEKGCKTFVLVSSAGAD---------PSS----RFLYMKMKGEVERDVIELDFK---H  160 (238)
T ss_pred             CCCCCCEEEECHHHHHHHHHHHHHCCCEEEEEEECCCCC---------CCC----CEEEEECCCHHHHHHHHCCCC---E
T ss_conf             556675376153888889999885897089997426788---------643----420241034466666641550---7


Q ss_pred             CCCCCCCCCCCC
Q ss_conf             642034777789
Q gi|254780595|r  150 LAVLRLSGIYGP  161 (289)
Q Consensus       150 ~~ilR~~~iyGp  161 (289)
T Consensus       161 ~~i~RPG~ll~~  172 (238)
T KOG4039         161 IIILRPGPLLGE  172 (238)
T ss_pred             EEEECCCCEECC
T ss_conf             999437533134