HHsearch alignment for GI: 254780595 and conserved domain: PRK01390

>PRK01390 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional.
Probab=94.41  E-value=0.14  Score=28.54  Aligned_cols=44  Identities=20%  Similarity=0.221  Sum_probs=36.9

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHCCCE
Q ss_conf             39998888889999999998898899996794463455644982
Q gi|254780595|r    2 HLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGIS   45 (289)
Q Consensus         2 kIlI~GaG~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~~~~~~   45 (289)
T Consensus        11 ~v~v~GlG~sG~s~a~~L~~~G~~V~~~D~~~~~~~~~~~~g~~   54 (457)
T PRK01390         11 TVALFGLGGSGLATARALKAGGAEVIAWDDNPDSVAKAAAAGIA   54 (457)
T ss_pred             EEEEEEECHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHCCCC
T ss_conf             89999436999999999997899799993992066899875983