HHsearch alignment for GI: 254780595 and conserved domain: PRK02318

>PRK02318 mannitol-1-phosphate 5-dehydrogenase; Provisional.
Probab=94.40  E-value=0.32  Score=26.47  Aligned_cols=43  Identities=21%  Similarity=0.228  Sum_probs=34.2

Q ss_pred             CEEEEECCCHHHHHHHHHHHH-CCCEEEEEECCHHHHHHHHHCC
Q ss_conf             939998888889999999998-8988999967944634556449
Q gi|254780595|r    1 MHLMIFGAGYTGKFIADAALK-VGVYTCGTTRSVSNLLTLKHKG   43 (289)
Q Consensus         1 MkIlI~GaG~iG~~l~~~L~~-~g~~V~~~~r~~~~~~~l~~~~   43 (289)
T Consensus         1 mKavhFGAGNigRGFI~~ll~~~g~~v~Fvdvn~~li~~Ln~~~   44 (381)
T PRK02318          1 MKALHFGAGNIGRGFIGKLLADNGFEVTFADVNQEIIDALNKRK   44 (381)
T ss_pred             CCEEEECCCHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHCCC
T ss_conf             94699787422126689999977976999958788999986069