HHsearch alignment for GI: 254780595 and conserved domain: PRK02472

>PRK02472 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional.
Probab=94.39  E-value=0.2  Score=27.59  Aligned_cols=48  Identities=17%  Similarity=0.167  Sum_probs=37.5

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCCEEEEEECCH----HHHHHHHHCCCEEEEC
Q ss_conf             39998888889999999998898899996794----4634556449828980
Q gi|254780595|r    2 HLMIFGAGYTGKFIADAALKVGVYTCGTTRSV----SNLLTLKHKGISPFLF   49 (289)
Q Consensus         2 kIlI~GaG~iG~~l~~~L~~~g~~V~~~~r~~----~~~~~l~~~~~~~~~~   49 (289)
T Consensus        11 ~i~viGlG~sG~s~a~~L~~~G~~V~~~D~~~~~~~~~~~~l~~~gi~~~~g   62 (450)
T PRK02472         11 KVLVLGLAKSGYAAAKLLHKLGANVTVNDGKPFSENPAAQELLEEGIKVICG   62 (450)
T ss_pred             EEEEEEECHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHCCCEEEEC
T ss_conf             8999977899999999999886989998488665798999999679989978