HHsearch alignment for GI: 254780595 and conserved domain: PRK03815

>PRK03815 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional.
Probab=93.60  E-value=0.12  Score=28.97  Aligned_cols=31  Identities=29%  Similarity=0.326  Sum_probs=26.8

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEEEEEC
Q ss_conf             9399988888899999999988988999967
Q gi|254780595|r    1 MHLMIFGAGYTGKFIADAALKVGVYTCGTTR   31 (289)
Q Consensus         1 MkIlI~GaG~iG~~l~~~L~~~g~~V~~~~r   31 (289)
T Consensus         1 mKi~V~GlG~sG~s~a~~L~~~g~~~i~dD~   31 (401)
T PRK03815          1 MKISLFGYGKTTKALARFFVKNGGVDIYDDK   31 (401)
T ss_pred             CEEEEEEECHHHHHHHHHHHHCCCEEEEECC
T ss_conf             9399984777189999999948797999899