HHsearch alignment for GI: 254780595 and conserved domain: PRK05442

>PRK05442 malate dehydrogenase; Provisional.
Probab=95.04  E-value=0.029  Score=32.44  Aligned_cols=72  Identities=17%  Similarity=0.067  Sum_probs=37.2

Q ss_pred             CEEEEECC-CHHHHHHHHHHHHC---C----CEEEEEECCH--HHHH----HHHHCCCEEEECCCCCCCHHHHHHHCCCC
Q ss_conf             93999888-88899999999988---9----8899996794--4634----55644982898067864023465411563
Q gi|254780595|r    1 MHLMIFGA-GYTGKFIADAALKV---G----VYTCGTTRSV--SNLL----TLKHKGISPFLFADQKINNLLREKLYFTT   66 (289)
Q Consensus         1 MkIlI~Ga-G~iG~~l~~~L~~~---g----~~V~~~~r~~--~~~~----~l~~~~~~~~~~~~~~~~~~~~~~~~~~~   66 (289)
T Consensus         5 ~kV~I~GAaG~ig~~l~~~la~g~l~g~~~~v~l~L~Di~~~~~~l~G~ameL~d~a~-p~l-~~v~~~~~~~~a~~~aD   82 (325)
T PRK05442          5 VRVAVTGAAGQIGYSLLFRIASGDMLGKDQPVILQLLEIPQAQKALKGVVMELEDCAF-PLL-AGVVITDDPKVAFKDAD   82 (325)
T ss_pred             EEEEEECCCCHHHHHHHHHHHCHHHCCCCCCEEEEEECCCCCCCCCCEEEEEHHCCCC-CCC-CCEEEECCHHHHHCCCC
T ss_conf             2999988886888999999866132089984699996577766655667734211675-444-87685088789837998


Q ss_pred             EEEEEECC
Q ss_conf             27876124
Q gi|254780595|r   67 HIVQCIKP   74 (289)
Q Consensus        67 ~v~~~~~~   74 (289)
T Consensus        83 vviitag~   90 (325)
T PRK05442         83 VALLVGAR   90 (325)
T ss_pred             EEEECCCC
T ss_conf             89980786