HHsearch alignment for GI: 254780595 and conserved domain: PRK05868

>PRK05868 hypothetical protein; Validated.
Probab=95.46  E-value=0.027  Score=32.60  Aligned_cols=33  Identities=18%  Similarity=0.111  Sum_probs=30.0

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCCEEEEEECCHH
Q ss_conf             399988888899999999988988999967944
Q gi|254780595|r    2 HLMIFGAGYTGKFIADAALKVGVYTCGTTRSVS   34 (289)
Q Consensus         2 kIlI~GaG~iG~~l~~~L~~~g~~V~~~~r~~~   34 (289)
T Consensus         3 kVlIvGaGiAGlalA~~L~r~G~~VtV~Er~p~   35 (372)
T PRK05868          3 TVLVSGASVAGTAAAYWLGRHGYSVTMVERHPG   35 (372)
T ss_pred             EEEEECCCHHHHHHHHHHHHCCCCEEEEECCCC
T ss_conf             999989888999999999858998899957999