HHsearch alignment for GI: 254780595 and conserved domain: PRK06182

>PRK06182 short chain dehydrogenase; Validated.
Probab=98.83  E-value=2e-08  Score=67.57  Aligned_cols=146  Identities=19%  Similarity=0.152  Sum_probs=92.5

Q ss_pred             EEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHCCCEEEECCCCCCCHHH------HHHHCCCCEEEEEECCC
Q ss_conf             999888-88899999999988988999967944634556449828980678640234------65411563278761244
Q gi|254780595|r    3 LMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLL------REKLYFTTHIVQCIKPS   75 (289)
Q Consensus         3 IlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~~~~~~~~~~~~~~~~~~~------~~~~~~~~~v~~~~~~~   75 (289)
T Consensus         6 ~lITGassGIG~a~a~~la~~G~~V~~~~r~~~~l~~l~~~~~~~~~~Dvt~~~~v~~~~~~i~~~~g~iDiLVNNAG~~   85 (273)
T PRK06182          6 ALVTGASSGIGKATARKLIAEGFTVYGAARRVDKMEDLASLGIHPLALDVTDEASMKAAVATILAEEGRIDVLVNNAGYG   85 (273)
T ss_pred             EEEECCCHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHCCCEEEEEECCCHHHHHHHHHHHHHHHCCCCEEEECCCCC
T ss_conf             99906320999999999998799899997989999999967997999858999999999999999839988775058677


Q ss_pred             CCC---CEEE----CCCCCHHH-------HHHH-----CCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHH
Q ss_conf             433---1000----12210134-------4320-----123343333201025762123453211234311345544555
Q gi|254780595|r   76 SEG---DPCI----ISMSKDFY-------KFMP-----HVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAE  136 (289)
Q Consensus        76 ~~~---~~~~----~~~~~~~~-------~~~~-----~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~y~~~k~~~E  136 (289)
T Consensus        86 ~~~~~~~~~~~~~~~~~~vN~~g~~~~~~~~lp~m~~~~~G~IvnisS~ag~~---~------~p--~~~~Y~asK~av~  154 (273)
T PRK06182         86 SYGAIEDVPIDEARAQFEVNLFGAARLTQLVLPHMRAQRSGRIINITSMGGKI---Y------TP--LGAWYHATKFALE  154 (273)
T ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEECCHHHCC---C------CC--CCCHHHHHHHHHH
T ss_conf             78748873199999999988699999999853342148995899986844407---7------99--9757999999999


Q ss_pred             HHHHH---CCCCCCCCCCCCCCCCCC
Q ss_conf             54320---012345676420347777
Q gi|254780595|r  137 KEWLA---ITKKLNIKLAVLRLSGIY  159 (289)
Q Consensus       137 ~~~~~---~~~~~~~~~~ilR~~~iy  159 (289)
T Consensus       155 ~~t~~La~El~~~gI~V~~v~PG~v~  180 (273)
T PRK06182        155 GLSDALRLEVAPFGIDVVVIEPGGIK  180 (273)
T ss_pred             HHHHHHHHHHCHHCCEEEEEECCCCC
T ss_conf             99999999844038789999738986