HHsearch alignment for GI: 254780595 and conserved domain: PRK06197

>PRK06197 short chain dehydrogenase; Provisional.
Probab=98.03  E-value=6.3e-05  Score=47.61  Aligned_cols=156  Identities=8%  Similarity=-0.037  Sum_probs=82.5

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHH----HHH----CCCEEEECCCCCCCHH------HHHHHCCCC
Q ss_conf             3999888-888999999999889889999679446345----564----4982898067864023------465411563
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLT----LKH----KGISPFLFADQKINNL------LREKLYFTT   66 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~----l~~----~~~~~~~~~~~~~~~~------~~~~~~~~~   66 (289)
T Consensus        18 ~~lITGa~sGIG~~~A~~La~~ga~Vil~~R~~~k~~~a~~~i~~~~~~~~i~~~~lDLssl~sV~~~a~~~~~~~~~lD   97 (306)
T PRK06197         18 VAVVTGANTGLGYETAAALAAKGAHVVLAVRNLDKGNAAAARITAAHPGADVTLQELDLASLASVRAAADALRAAYPRID   97 (306)
T ss_pred             EEEECCCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHCCCCCEEEEECCCHHHHHHHHHHHHHHHCCCCCC
T ss_conf             99991689599999999999784989999798999999999999768998579997664307789999999996189876


Q ss_pred             EEEEEECCCCC----C-CEEECCCCCH----------HHHHHH--CCCCCCCCCCEEEC-CCCCC-CCCCCCCCCCCCCH
Q ss_conf             27876124443----3-1000122101----------344320--12334333320102-57621-23453211234311
Q gi|254780595|r   67 HIVQCIKPSSE----G-DPCIISMSKD----------FYKFMP--HVKWIGYLSSTSIY-GNREG-QWVDEHSFVHPISC  127 (289)
Q Consensus        67 ~v~~~~~~~~~----~-~~~~~~~~~~----------~~~~~~--~~~~~i~~SS~~VY-g~~~g-~~i~E~~~~~P~~~  127 (289)
T Consensus        98 vLinNAGi~~~~~~~T~dG~E~~f~vN~lghflLt~lLl~~l~~~~~~RIV~vsS~~h~~~~~~~~ddl~~~~~y~~~~a  177 (306)
T PRK06197         98 LLINNAGVMYTPKQTTADGFELQFGTNHLGHFALTGLLLDRLLPVPGSRVVTVSSGGHRIRAAIHFDDLQWERRYNRVAA  177 (306)
T ss_pred             EEEECCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEECHHHHCCCCCCCCCCCCCCCCCHHHH
T ss_conf             89977844568872267653333333136888888877787531578826999445760577888424576567874788


Q ss_pred             HHHHHHHHHHHHHHCCC---CCCCCCCCC--CCCC
Q ss_conf             34554455554320012---345676420--3477
Q gi|254780595|r  128 VATQRFNAEKEWLAITK---KLNIKLAVL--RLSG  157 (289)
Q Consensus       128 y~~~k~~~E~~~~~~~~---~~~~~~~il--R~~~  157 (289)
T Consensus       178 Y~~SKLanilft~eL~rrl~~~~~~v~~~a~hPG~  212 (306)
T PRK06197        178 YGQSKLANLLFTYELQRRLAAAGATTIAVAAHPGV  212 (306)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECCCC
T ss_conf             88889999999999999876059986999927986