HHsearch alignment for GI: 254780595 and conserved domain: PRK06223

>PRK06223 malate dehydrogenase; Reviewed.
Probab=96.98  E-value=0.002  Score=39.09  Aligned_cols=71  Identities=17%  Similarity=0.036  Sum_probs=43.0

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCC--CEEEEEECCHHHHH----HHHHCCCEEEECCCCCC--CHHHHHHHCCCCEEEEEE
Q ss_conf             93999888888999999999889--88999967944634----55644982898067864--023465411563278761
Q gi|254780595|r    1 MHLMIFGAGYTGKFIADAALKVG--VYTCGTTRSVSNLL----TLKHKGISPFLFADQKI--NNLLREKLYFTTHIVQCI   72 (289)
Q Consensus         1 MkIlI~GaG~iG~~l~~~L~~~g--~~V~~~~r~~~~~~----~l~~~~~~~~~~~~~~~--~~~~~~~~~~~~~v~~~~   72 (289)
T Consensus         1 mKI~IiGaG~VG~~~a~~l~~~~l~~el~L~Di~~~~a~g~a~Dl~~~--~~~~~~~~~i~~~~d~-~~~~daDiVVita   77 (312)
T PRK06223          1 MKISIIGAGNVGATLAHLLALKELGKDVVLFDIPEGIPQGKALDIAES--SAVDGFDAKITGTNDY-ADIAGSDVVIITA   77 (312)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCCCEEEEECCCCCHHHHHHHHHHCC--CCCCCCCCEEEECCCH-HHHCCCCEEEEEC
T ss_conf             979999969899999999985799874899769997336798887651--4336888479837888-9957999999906


Q ss_pred             CC
Q ss_conf             24
Q gi|254780595|r   73 KP   74 (289)
Q Consensus        73 ~~   74 (289)
T Consensus        78 g~   79 (312)
T PRK06223         78 GV   79 (312)
T ss_pred             CC
T ss_conf             77