HHsearch alignment for GI: 254780595 and conserved domain: PRK06475

>PRK06475 salicylate hydroxylase; Provisional.
Probab=93.78  E-value=0.11  Score=29.20  Aligned_cols=32  Identities=22%  Similarity=0.159  Sum_probs=28.9

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCCEEEEEECCH
Q ss_conf             39998888889999999998898899996794
Q gi|254780595|r    2 HLMIFGAGYTGKFIADAALKVGVYTCGTTRSV   33 (289)
Q Consensus         2 kIlI~GaG~iG~~l~~~L~~~g~~V~~~~r~~   33 (289)
T Consensus         4 ~VlIVGaGiaGL~~A~~L~~~G~~v~V~E~~~   35 (400)
T PRK06475          4 SILIAGAGVAGLSAALELAARGWAVTIIEKAQ   35 (400)
T ss_pred             CEEEECCCHHHHHHHHHHHHCCCCEEEECCCC
T ss_conf             79998958899999999997899999991799