HHsearch alignment for GI: 254780595 and conserved domain: PRK06732

>PRK06732 phosphopantothenate--cysteine ligase; Validated.
Probab=96.94  E-value=0.0024  Score=38.58  Aligned_cols=74  Identities=20%  Similarity=0.259  Sum_probs=46.8

Q ss_pred             CEEEEE-C---------------C-CHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHCCCEEEECC-CCCCCHHHHHHH
Q ss_conf             939998-8---------------8-888999999999889889999679446345564498289806-786402346541
Q gi|254780595|r    1 MHLMIF-G---------------A-GYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFA-DQKINNLLREKL   62 (289)
Q Consensus         1 MkIlI~-G---------------a-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~~~~~~~~~~~-~~~~~~~~~~~~   62 (289)
T Consensus         1 ~kvLITaG~T~E~ID~VR~IsN~SSGk~G~aiA~~~~~~Ga~Vtli~g~~-~~~p~~~~~~~~i~v~ta~em~~~~~~~~   79 (228)
T PRK06732          1 MKILITSGGTTEPIDAVRGITNHSTGQLGKIIAETFLQAGHEVTLVTTKT-AVKPEPHPNLSIIEIENVDDLLATLKPLV   79 (228)
T ss_pred             CEEEEECCCCCCCCCCCCEECCCCHHHHHHHHHHHHHHCCCEEEEEECCC-CCCCCCCCCEEEEEECCHHHHHHHHHHHC
T ss_conf             98999578876676884476767814999999999997899899995677-56889889858999458999999999747


Q ss_pred             CCCCEEEEEECCC
Q ss_conf             1563278761244
Q gi|254780595|r   63 YFTTHIVQCIKPS   75 (289)
Q Consensus        63 ~~~~~v~~~~~~~   75 (289)
T Consensus        80 ~~~D~~I~aAAVs   92 (228)
T PRK06732         80 PHHDVLIHSMAVS   92 (228)
T ss_pred             CCCCEEEEEEEEC
T ss_conf             8999999931810