HHsearch alignment for GI: 254780595 and conserved domain: PRK06949

>PRK06949 short chain dehydrogenase; Provisional.
Probab=98.28  E-value=8.3e-06  Score=52.66  Aligned_cols=189  Identities=13%  Similarity=0.080  Sum_probs=102.6

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHH----HHHCCC--EEEECCCCCCCHHHH-------HHHCCCCE
Q ss_conf             3999888-888999999999889889999679446345----564498--289806786402346-------54115632
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLT----LKHKGI--SPFLFADQKINNLLR-------EKLYFTTH   67 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~----l~~~~~--~~~~~~~~~~~~~~~-------~~~~~~~~   67 (289)
T Consensus        11 valVTGas~GIG~aiA~~la~~Ga~V~i~~~~~~~~~~~~~~i~~~g~~~~~~~~Dv~~~-~~v~~~v~~~~~~~G~iDi   89 (258)
T PRK06949         11 VALVTGASSGLGQRFAQVLSQAGAKVVLASRRVERLKELRAEIEAEGGAAHVVSLDVTDY-QSIKAAVAHAETEAGTIDI   89 (258)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCH-HHHHHHHHHHHHHHCCCCE
T ss_conf             899958577999999999998799999996988999999999996599289998268999-9999999999998499989


Q ss_pred             EEEEECCCCCC---CE---EECC-CCCHH----------HH-HHHC---------CCCCCCCCCEEECCCCCCCCCCCCC
Q ss_conf             78761244433---10---0012-21013----------44-3201---------2334333320102576212345321
Q gi|254780595|r   68 IVQCIKPSSEG---DP---CIIS-MSKDF----------YK-FMPH---------VKWIGYLSSTSIYGNREGQWVDEHS  120 (289)
Q Consensus        68 v~~~~~~~~~~---~~---~~~~-~~~~~----------~~-~~~~---------~~~~i~~SS~~VYg~~~g~~i~E~~  120 (289)
T Consensus        90 LVnnAG~~~~~~~~~~~~~~~~~~~~vNl~g~~~~~~~~~~~mi~~~~~~~~~~~~G~IVni~S~~~~~-----------  158 (258)
T PRK06949         90 LVNNSGVSTTQKLVDVTPADFEFVFDTNTRGAFFVAQEVAKRMIARAKGAGNAKPQCRIINIASVAGLR-----------  158 (258)
T ss_pred             EEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCEEEEEECCHHHCC-----------
T ss_conf             998998899989265999999999998709999999999999998457998888983999983555476-----------


Q ss_pred             CCCCCCHHHHHHHHHHHHHHHCCCC---CCCCCCCCCCCCCCCCC-CCHH-----HHHHCCCCCCCCCCCCEECCHHHHH
Q ss_conf             1234311345544555543200123---45676420347777898-5034-----4431134543222110001024777
Q gi|254780595|r  121 FVHPISCVATQRFNAEKEWLAITKK---LNIKLAVLRLSGIYGPK-RNPF-----IKIRQKNSLRLVKKNQVFNRIRVED  191 (289)
Q Consensus       121 ~~~P~~~y~~~k~~~E~~~~~~~~~---~~~~~~ilR~~~iyGp~-r~~~-----~~~~~g~~~~~~~~~~~~~~ihv~D  191 (289)
T Consensus       159 ~~~~~~~Y~asKaav~~ltr~lA~ela~~gIrVN~IaPG~i~T~~~~~~~~~e~~~~~~~~~P------~~--R~g~ped  230 (258)
T PRK06949        159 VLPQIGLYCMSKAAVVHMTRAMALEWGRHGINVNAICPGYIDTEINHHHWETEQGQKLVSMLP------RK--RVGKPED  230 (258)
T ss_pred             CCCCCHHHHHHHHHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCCHHCCCHHHHHHHHHCCC------CC--CCCCHHH
T ss_conf             899838999999999999999999962219799999657888700010057599999996499------99--9829999


Q ss_pred             HHHHHHHHHCCCC----CCCEEC
Q ss_conf             7999999951355----786162
Q gi|254780595|r  192 VARCVIFLMTHHL----GGIFNL  210 (289)
Q Consensus       192 va~~i~~l~~~~~----~~iyni  210 (289)
T Consensus       231 ia~~v~fL~S~~s~~iTGq~i~V  253 (258)
T PRK06949        231 LDGLLLLLAADESQFINGAIISA  253 (258)
T ss_pred             HHHHHHHHHCCHHCCCCCCEEEE
T ss_conf             99999998387316736874784