HHsearch alignment for GI: 254780595 and conserved domain: PRK07060

>PRK07060 short chain dehydrogenase; Provisional.
Probab=98.74  E-value=3.6e-07  Score=60.45  Aligned_cols=193  Identities=16%  Similarity=0.110  Sum_probs=108.4

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHC-CCEEEECCCCCCC--HHHHHHHCCCCEEEEEECCCCC
Q ss_conf             3999888-8889999999998898899996794463455644-9828980678640--2346541156327876124443
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHK-GISPFLFADQKIN--NLLREKLYFTTHIVQCIKPSSE   77 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~~~-~~~~~~~~~~~~~--~~~~~~~~~~~~v~~~~~~~~~   77 (289)
T Consensus        11 ~~lVTG~~~GIG~aia~~la~~Ga~V~~~~r~~~~~~~~~~~~~~~~~~~Dv~~~~~v~~~~~~~g~iDilVnnAG~~~~   90 (245)
T PRK07060         11 SVLVTGASSGIGRACAVALAARGARVVAAARNQADLDRLAGETGCEPLRLDVGDDAAIRAALAGAGAFDGLVNCAGIASL   90 (245)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHCCEEEEEECCCHHHHHHHHHHCCCCCEEEECCCCCCC
T ss_conf             89994777689999999999879999999799899999998639879998079999999999965999899989887999


Q ss_pred             CC---EEECC----CCCH----------HHHHH-H--CCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHH
Q ss_conf             31---00012----2101----------34432-0--1233433332010257621234532112343113455445555
Q gi|254780595|r   78 GD---PCIIS----MSKD----------FYKFM-P--HVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVATQRFNAEK  137 (289)
Q Consensus        78 ~~---~~~~~----~~~~----------~~~~~-~--~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~y~~~k~~~E~  137 (289)
T Consensus        91 ~~~~~~~~e~~~~~~~vNl~~~~~~~k~~~~~m~~~~~~G~IInisS~~~~~---~--------~~~~~~Y~asKaav~~  159 (245)
T PRK07060         91 ESAIDMTAAGFDRVMAVNARGALLVARHVARAMIRAGRGGSIVNVSSQAALV---G--------LPDHLAYCASKAALDA  159 (245)
T ss_pred             CCCHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCC---C--------CCCCHHHHHHHHHHHH
T ss_conf             9901399999999999970999999999999999808980799986643257---8--------9974789999999999


Q ss_pred             HHHHCCCC---CCCCCCCCCCCCCCCCCC-C------HHHHHHCCCCCCCCCCCCEECCHHHHHHHHHHHHHHCCCC---
Q ss_conf             43200123---456764203477778985-0------3444311345432221100010247777999999951355---
Q gi|254780595|r  138 EWLAITKK---LNIKLAVLRLSGIYGPKR-N------PFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHL---  204 (289)
Q Consensus       138 ~~~~~~~~---~~~~~~ilR~~~iyGp~r-~------~~~~~~~g~~~~~~~~~~~~~~ihv~Dva~~i~~l~~~~~---  204 (289)
T Consensus       160 ltkslA~el~~~gIRVN~I~PG~i~T~~~~~~~~~~~~~~~~~~~~p--l------~R~g~peeiA~~v~fL~S~~ss~i  231 (245)
T PRK07060        160 ATRVLCVELGPHGIRVNSVNPTVTLTPMAEFAWSDPQKSEPMLAAIP--L------GRFAEVDDVAAPILFLLSDAASMV  231 (245)
T ss_pred             HHHHHHHHHHHCCEEEEEEEECCCCCHHHHHHCCCHHHHHHHHHCCC--C------CCCCCHHHHHHHHHHHHCCHHCCC
T ss_conf             99999999610192999997698987667642489999999995599--9------997889999999999958642581


Q ss_pred             -CCCEECCCC
Q ss_conf             -786162684
Q gi|254780595|r  205 -GGIFNLSDD  213 (289)
Q Consensus       205 -~~iyni~~~  213 (289)
T Consensus       232 TG~~i~VDGG  241 (245)
T PRK07060        232 SGVSLPVDGG  241 (245)
T ss_pred             CCCEEEECCC
T ss_conf             4842886956