HHsearch alignment for GI: 254780595 and conserved domain: PRK07063

>PRK07063 short chain dehydrogenase; Provisional.
Probab=98.15  E-value=1.5e-05  Score=51.19  Aligned_cols=200  Identities=14%  Similarity=0.049  Sum_probs=105.3

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHH----HH-HCCC--EEEECCCCCCCHHHH-------HHHCCCC
Q ss_conf             3999888-888999999999889889999679446345----56-4498--289806786402346-------5411563
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLT----LK-HKGI--SPFLFADQKINNLLR-------EKLYFTT   66 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~----l~-~~~~--~~~~~~~~~~~~~~~-------~~~~~~~   66 (289)
T Consensus         9 valVTGa~~GIG~aiA~~~a~~Ga~V~i~~~~~~~~~~~~~~l~~~~g~~~~~~~~Dvt~~-~~v~~~v~~~~~~~G~iD   87 (259)
T PRK07063          9 VALVTGAAQGIGAAIARAFVREGAAVALADLDAALAERAAAAIARQTGARVLALPADVTRA-ASVRAAVARAEAAFGPLD   87 (259)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHCCCEEEEEECCCCCH-HHHHHHHHHHHHHHCCCC
T ss_conf             8999587878999999999987998999979878999999999885099189998368999-999999999999819988


Q ss_pred             EEEEEECCCCCCCE------EEC-CCCCHH-------HHHHH-----CCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCH
Q ss_conf             27876124443310------001-221013-------44320-----123343333201025762123453211234311
Q gi|254780595|r   67 HIVQCIKPSSEGDP------CII-SMSKDF-------YKFMP-----HVKWIGYLSSTSIYGNREGQWVDEHSFVHPISC  127 (289)
Q Consensus        67 ~v~~~~~~~~~~~~------~~~-~~~~~~-------~~~~~-----~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~  127 (289)
T Consensus        88 iLVNNAG~~~~~~~~~~~~e~w~~~~~vNl~g~f~~~~~~~p~m~~~~~G~IVnisS~~~~~---~--------~~~~~~  156 (259)
T PRK07063         88 VLVNNAGINVFADPLAMTDEDWRRCFAVDLDGAWNCCRAVLPGMVERGRGSIVNIASTHAFK---I--------IPGCFP  156 (259)
T ss_pred             EEEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCC---C--------CCCCHH
T ss_conf             99989977899990449999999999875288999999999999986996699987766567---7--------999667


Q ss_pred             HHHHHHHHHHHHHHCCC---CCCCCCCCCCCCCCCCCCC-CHHHHHHC--CCCCCCCCCCCEE-CCHHHHHHHHHHHHHH
Q ss_conf             34554455554320012---3456764203477778985-03444311--3454322211000-1024777799999995
Q gi|254780595|r  128 VATQRFNAEKEWLAITK---KLNIKLAVLRLSGIYGPKR-NPFIKIRQ--KNSLRLVKKNQVF-NRIRVEDVARCVIFLM  200 (289)
Q Consensus       128 y~~~k~~~E~~~~~~~~---~~~~~~~ilR~~~iyGp~r-~~~~~~~~--g~~~~~~~~~~~~-~~ihv~Dva~~i~~l~  200 (289)
T Consensus       157 Y~asKaav~~lTr~lA~e~a~~gIrVNaI~PG~i~T~~~~~~~~~~~~~~~~~~~~~-~~~Pl~R~g~peeiA~~v~FLa  235 (259)
T PRK07063        157 YPVAKHGLLGLTRALGIEYAARNVRVNAIAPGYIETQLTEDWWNAQPDPAAARAETL-ALQPMKRIGRPEEVAMTAVFLA  235 (259)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHCEEEEEEEECCCCCHHHHHHHHCCCCHHHHHHHHH-HCCCCCCCCCHHHHHHHHHHHH
T ss_conf             999999999999999999714192999897677987768988752799899999998-2799999778999999999995


Q ss_pred             CCC----CCCCEECCCCC
Q ss_conf             135----57861626843
Q gi|254780595|r  201 THH----LGGIFNLSDDE  214 (289)
Q Consensus       201 ~~~----~~~iyni~~~~  214 (289)
T Consensus       236 Sd~as~iTG~~i~VDGG~  253 (259)
T PRK07063        236 SDEAPFINATCITIDGGR  253 (259)
T ss_pred             CCHHCCCCCCEEEECCCH
T ss_conf             865258248718988196