HHsearch alignment for GI: 254780595 and conserved domain: PRK07097

>PRK07097 gluconate 5-dehydrogenase; Provisional.
Probab=98.52  E-value=1.9e-06  Score=56.30  Aligned_cols=200  Identities=16%  Similarity=0.081  Sum_probs=108.6

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHH----HHHHCCC--EEEECCCCCCCH---H---HHHHHCCCCEE
Q ss_conf             3999888-88899999999988988999967944634----5564498--289806786402---3---46541156327
Q gi|254780595|r    2 HLMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLL----TLKHKGI--SPFLFADQKINN---L---LREKLYFTTHI   68 (289)
Q Consensus         2 kIlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~----~l~~~~~--~~~~~~~~~~~~---~---~~~~~~~~~~v   68 (289)
T Consensus        12 ~alVTG~s~GIG~aiA~~la~~Ga~Vii~~~~~~~~~~~~~~~~~~g~~~~~~~~Dvt~~~~v~~~~~~~~~~~g~iDiL   91 (265)
T PRK07097         12 IALITGASYGIGFAIAKAYAEAGATIVFNDIKQELVDKGLAAYRELGIEAHGYVCDVTDEDGIQAMVAQIEKEVGVIDIL   91 (265)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHCCCCCEE
T ss_conf             89995857689999999999869999999599899999999999549917999932899999999999999982999899


Q ss_pred             EEEECCCCCC---CEEECCC----CCHH----------HHHH--HCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCHHH
Q ss_conf             8761244433---1000122----1013----------4432--012334333320102576212345321123431134
Q gi|254780595|r   69 VQCIKPSSEG---DPCIISM----SKDF----------YKFM--PHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVA  129 (289)
Q Consensus        69 ~~~~~~~~~~---~~~~~~~----~~~~----------~~~~--~~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~y~  129 (289)
T Consensus        92 VnNAG~~~~~~~~~~~~e~~~~~~~vNl~g~~~~~~~~~~~m~~~~~G~IVnisS~~~~~---~--------~~~~~~Y~  160 (265)
T PRK07097         92 VNNAGIIRRIPMLEMSAEDFRQVIDIDLNAPFIVSKAVLPSMIKKGHGKIINICSMMSEL---G--------RETVSAYA  160 (265)
T ss_pred             EECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEEECHHHCC---C--------CCCCHHHH
T ss_conf             989989999882659999999999986072899999999989980897599990521156---7--------88866899


Q ss_pred             HHHHHHHHHHHHCCC---CCCCCCCCCCCCCCCCCCCCHHHHHH-CCCCCC----CCCCCCEE-CCHHHHHHHHHHHHHH
Q ss_conf             554455554320012---34567642034777789850344431-134543----22211000-1024777799999995
Q gi|254780595|r  130 TQRFNAEKEWLAITK---KLNIKLAVLRLSGIYGPKRNPFIKIR-QKNSLR----LVKKNQVF-NRIRVEDVARCVIFLM  200 (289)
Q Consensus       130 ~~k~~~E~~~~~~~~---~~~~~~~ilR~~~iyGp~r~~~~~~~-~g~~~~----~~~~~~~~-~~ihv~Dva~~i~~l~  200 (289)
T Consensus       161 asKaav~~ltr~lA~e~a~~gIrVN~V~PG~i~T~~~~~~~~~~~~~~~~~~~~~~~~-~~P~~R~g~p~dia~~v~FL~  239 (265)
T PRK07097        161 AAKGGLKMLTKNIASEYGEANIQCNGIGPGYIATPQTAPLRERQADGSRHPFDQFIIA-KTPAARWGTPEDLAGPAVFLA  239 (265)
T ss_pred             HHHHHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCCHHHHHHHHHHHHHHHHHHHHH-CCCCCCCCCHHHHHHHHHHHH
T ss_conf             9999999999999999702495999996588988630456653101112159999984-799889788999999999994


Q ss_pred             CCC----CCCCEECCCC
Q ss_conf             135----5786162684
Q gi|254780595|r  201 THH----LGGIFNLSDD  213 (289)
Q Consensus       201 ~~~----~~~iyni~~~  213 (289)
T Consensus       240 Sd~s~~iTGq~i~VDGG  256 (265)
T PRK07097        240 SDASNFVNGHILYVDGG  256 (265)
T ss_pred             CCHHCCCCCCEEEECCC
T ss_conf             84424835875997908