HHsearch alignment for GI: 254780595 and conserved domain: PRK07102

>PRK07102 short chain dehydrogenase; Provisional.
Probab=99.03  E-value=2.1e-09  Score=73.19  Aligned_cols=185  Identities=11%  Similarity=0.103  Sum_probs=103.5

Q ss_pred             CE-EEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHH----CC---CEEEECCCCCCC---HHHHHHHCCCCEE
Q ss_conf             93-999888-888999999999889889999679446345564----49---828980678640---2346541156327
Q gi|254780595|r    1 MH-LMIFGA-GYTGKFIADAALKVGVYTCGTTRSVSNLLTLKH----KG---ISPFLFADQKIN---NLLREKLYFTTHI   68 (289)
Q Consensus         1 Mk-IlI~Ga-G~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~~----~~---~~~~~~~~~~~~---~~~~~~~~~~~~v   68 (289)
T Consensus         1 MK~vlITGassGIG~a~A~~la~~G~~v~l~~R~~~~l~~~~~~l~~~~~~~~~~~~~D~~~~~~~~~~~~~~~~~~d~~   80 (243)
T PRK07102          1 MKKILIIGATSDIARACARRYAAAGARLYLAARDTERLERIAADLEARGAVAVATHELDILDTARHAAFLDNLPALPDTV   80 (243)
T ss_pred             CCEEEEECCCHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHHHHHHCCEE
T ss_conf             99799915745999999999998799899998988999999999985358628998434036999999999987537979


Q ss_pred             EEEECCCCCC---CEEE----CCCCCHHHH-------H---H--HCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCHHH
Q ss_conf             8761244433---1000----122101344-------3---2--012334333320102576212345321123431134
Q gi|254780595|r   69 VQCIKPSSEG---DPCI----ISMSKDFYK-------F---M--PHVKWIGYLSSTSIYGNREGQWVDEHSFVHPISCVA  129 (289)
Q Consensus        69 ~~~~~~~~~~---~~~~----~~~~~~~~~-------~---~--~~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~~y~  129 (289)
T Consensus        81 v~~aG~~~~~~~~~~~~~~~~~~~~vN~~g~~~l~~~~~~~m~~~~~G~Iv~isS~ag~~---g~------p--~~~~Y~  149 (243)
T PRK07102         81 LIAVGTLGDQAACEADPALALREFRTNFEGPIALLTLLANRFEARGSGTIVGISSVAGDR---GR------A--SNYVYG  149 (243)
T ss_pred             EEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEEECHHHCC---CC------C--CCCHHH
T ss_conf             997303678730239999999999999899999999999998872397499982566477---89------9--982699


Q ss_pred             HHHHHHHHHHHHC---CCCCCCCCCCCCCCCCCCCCCCHHHHHHCCCCCCCCCCCCEECCHHHHHHHHHHHHHHCCCCCC
Q ss_conf             5544555543200---1234567642034777789850344431134543222110001024777799999995135578
Q gi|254780595|r  130 TQRFNAEKEWLAI---TKKLNIKLAVLRLSGIYGPKRNPFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLMTHHLGG  206 (289)
Q Consensus       130 ~~k~~~E~~~~~~---~~~~~~~~~ilR~~~iyGp~r~~~~~~~~g~~~~~~~~~~~~~~ihv~Dva~~i~~l~~~~~~~  206 (289)
T Consensus       150 aSKaal~~~~~sL~~El~~~gI~V~~v~PG~v~----T~m~~---~~~--~--~~~~--~~~pe~vA~~i~~ai~~~k~~  216 (243)
T PRK07102        150 SAKAALTAFLSGLRNRLFKSGVHVLTVKPGFVD----TPMTA---GLK--L--PGPL--TAQPEEVAKDIFRAIEKGKDV  216 (243)
T ss_pred             HHHHHHHHHHHHHHHHHHCCCEEEEEEEECCCC----CCCCC---CCC--C--CCCC--CCCHHHHHHHHHHHHHCCCCE
T ss_conf             999999999999999850209199999718896----75666---899--9--8877--699999999999999769989


Q ss_pred             CEE
Q ss_conf             616
Q gi|254780595|r  207 IFN  209 (289)
Q Consensus       207 iyn  209 (289)
T Consensus       217 i~~  219 (243)
T PRK07102        217 LYT  219 (243)
T ss_pred             EEC
T ss_conf             985