HHsearch alignment for GI: 254780595 and conserved domain: PRK08415

>PRK08415 enoyl-(acyl carrier protein) reductase; Provisional.
Probab=97.92  E-value=0.00069  Score=41.69  Aligned_cols=197  Identities=14%  Similarity=0.116  Sum_probs=99.0

Q ss_pred             EEEEECC-C--HHHHHHHHHHHHCCCEEEEEECCHH---HHHHHHHC-CCE-EEECCCCCCCH------HHHHHHCCCCE
Q ss_conf             3999888-8--8899999999988988999967944---63455644-982-89806786402------34654115632
Q gi|254780595|r    2 HLMIFGA-G--YTGKFIADAALKVGVYTCGTTRSVS---NLLTLKHK-GIS-PFLFADQKINN------LLREKLYFTTH   67 (289)
Q Consensus         2 kIlI~Ga-G--~iG~~l~~~L~~~g~~V~~~~r~~~---~~~~l~~~-~~~-~~~~~~~~~~~------~~~~~~~~~~~   67 (289)
T Consensus         7 ~alITGaag~~GIG~aiA~~la~~GA~V~i~~~~~~~~~~~~~l~~~~g~~~~~~~Dvs~~~~v~~~~~~i~~~~G~iDi   86 (274)
T PRK08415          7 KGLIVGVANNKSIAYGIAKACFEQGAELAFTYLNDALKKRVEPIAQELGSPYVYELDVSKEEHFKSLAESIKKDLGEIDF   86 (274)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHCCCCE
T ss_conf             79998999983799999999998699999984887899999999986299769990289999999999999998589888


Q ss_pred             EEEEECCCC--CC-----CEEECCCC----CHH----------HHHHHCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCC
Q ss_conf             787612444--33-----10001221----013----------4432012334333320102576212345321123431
Q gi|254780595|r   68 IVQCIKPSS--EG-----DPCIISMS----KDF----------YKFMPHVKWIGYLSSTSIYGNREGQWVDEHSFVHPIS  126 (289)
Q Consensus        68 v~~~~~~~~--~~-----~~~~~~~~----~~~----------~~~~~~~~~~i~~SS~~VYg~~~g~~i~E~~~~~P~~  126 (289)
T Consensus        87 lVnnag~~~~~~~~~~~~d~~~~~~~~~~~~n~~~~~~~~~~~~~~m~~~GsIi~iss~~~~---~~--------~p~~~  155 (274)
T PRK08415         87 IVHSVAFAPKEALEGSFLETSKEAFDIAMEISVYSLIELTRALLPLLNDGGSVLTLSYLGGV---KY--------VPHYN  155 (274)
T ss_pred             EEECCCCCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCC---CC--------CCCCH
T ss_conf             85335557643346873338999999999999999999999999874307987642202465---66--------66300


Q ss_pred             HHHHHHHHHHHHHHHCCCC---CCCCCCCCCCCCCCCCCCC---HHHHHHCCCCCCCCCCCCEECCHHHHHHHHHHHHHH
Q ss_conf             1345544555543200123---4567642034777789850---344431134543222110001024777799999995
Q gi|254780595|r  127 CVATQRFNAEKEWLAITKK---LNIKLAVLRLSGIYGPKRN---PFIKIRQKNSLRLVKKNQVFNRIRVEDVARCVIFLM  200 (289)
Q Consensus       127 ~y~~~k~~~E~~~~~~~~~---~~~~~~ilR~~~iyGp~r~---~~~~~~~g~~~~~~~~~~~~~~ihv~Dva~~i~~l~  200 (289)
T Consensus       156 ~y~asKaal~~ltk~lA~Ela~~gIRVN~IaPG~i~T~~~~~~~~~~~~~~~~~~~~Pl~----R~g~pediA~av~FLa  231 (274)
T PRK08415        156 VMGVAKAALESSVRYLAVDLGKKGIRVNAISAGPIKTLAASGIGDFRMILKWNEINAPLK----KNVSIEEVGNSAMYLL  231 (274)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCCCCCCCHHHHHHHHHHCCCCC----CCCCHHHHHHHHHHHH
T ss_conf             367778999999999999983549699998768777610013888999998787489978----9969999999999995


Q ss_pred             CCCC----CCCEECCCC
Q ss_conf             1355----786162684
Q gi|254780595|r  201 THHL----GGIFNLSDD  213 (289)
Q Consensus       201 ~~~~----~~iyni~~~  213 (289)
T Consensus       232 Sd~ss~iTG~~i~VDGG  248 (274)
T PRK08415        232 SDLASGVTGEIHYVDAG  248 (274)
T ss_pred             CCHHCCCCCCEEEECCC
T ss_conf             84535736871577879