HHsearch alignment for GI: 254780595 and conserved domain: PRK09126

>PRK09126 hypothetical protein; Provisional.
Probab=93.14  E-value=0.16  Score=28.24  Aligned_cols=31  Identities=23%  Similarity=0.293  Sum_probs=28.9

Q ss_pred             EEEECCCHHHHHHHHHHHHCCCEEEEEECCH
Q ss_conf             9998888889999999998898899996794
Q gi|254780595|r    3 LMIFGAGYTGKFIADAALKVGVYTCGTTRSV   33 (289)
Q Consensus         3 IlI~GaG~iG~~l~~~L~~~g~~V~~~~r~~   33 (289)
T Consensus         6 V~IvGaGp~Gl~lA~~La~~G~~v~viE~~~   36 (392)
T PRK09126          6 ILVVGAGPAGLSFARSLAGSGLKVTLIERQP   36 (392)
T ss_pred             EEEECCCHHHHHHHHHHHHCCCCEEEEECCC
T ss_conf             9999925899999999986899899990898