HHsearch alignment for GI: 254780595 and conserved domain: PRK12769

>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed.
Probab=95.51  E-value=0.15  Score=28.34  Aligned_cols=73  Identities=21%  Similarity=0.108  Sum_probs=48.3

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCCEEEEEECCH---------------------HHHHHHHHCCCEEEECCCCCCCHHHHH
Q ss_conf             39998888889999999998898899996794---------------------463455644982898067864023465
Q gi|254780595|r    2 HLMIFGAGYTGKFIADAALKVGVYTCGTTRSV---------------------SNLLTLKHKGISPFLFADQKINNLLRE   60 (289)
Q Consensus         2 kIlI~GaG~iG~~l~~~L~~~g~~V~~~~r~~---------------------~~~~~l~~~~~~~~~~~~~~~~~~~~~   60 (289)
T Consensus       329 kVAIIGsGPAGLsaA~~Lar~G~~VTVFE~~~~~GGlL~yGIP~fRLpk~vv~~ei~~l~~lGV~f~~n~~VGkDitl~e  408 (654)
T PRK12769        329 RVAIIGAGPAGLACADVLTRNGVAVTVYDRHPEIGGLLTFGIPAFKLDKSLLARRREIFSAMGIHFELNCEVGKDISLES  408 (654)
T ss_pred             EEEEECCCHHHHHHHHHHHHCCCEEEEECCCCCCCCEEEECCCCCCCCHHHHHHHHHHHHHCCCEEECCCEECCCCCHHH
T ss_conf             89998977899999999997697579952577788667524862227789999999999826988983717687658999


Q ss_pred             HHCCCCEEEEEECC
Q ss_conf             41156327876124
Q gi|254780595|r   61 KLYFTTHIVQCIKP   74 (289)
Q Consensus        61 ~~~~~~~v~~~~~~   74 (289)
T Consensus       409 L~~~yDAVfla~Ga  422 (654)
T PRK12769        409 LLEDYDAVFVGVGT  422 (654)
T ss_pred             HHHCCCEEEEECCC
T ss_conf             97369989995178