HHsearch alignment for GI: 254780595 and conserved domain: PRK12831

>PRK12831 putative oxidoreductase; Provisional.
Probab=93.20  E-value=0.61  Score=24.90  Aligned_cols=31  Identities=19%  Similarity=0.140  Sum_probs=28.5

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCCEEEEEECC
Q ss_conf             3999888888999999999889889999679
Q gi|254780595|r    2 HLMIFGAGYTGKFIADAALKVGVYTCGTTRS   32 (289)
Q Consensus         2 kIlI~GaG~iG~~l~~~L~~~g~~V~~~~r~   32 (289)
T Consensus       142 kVAVIGsGPAGLsaA~~La~~G~~VtVfE~~  172 (464)
T PRK12831        142 KVAVIGSGPAGLTCAGDLAKKGYDVTIFEAL  172 (464)
T ss_pred             EEEEECCCHHHHHHHHHHHHCCCCEEEECCC
T ss_conf             8999897689999999999769917998278