HHsearch alignment for GI: 254780595 and conserved domain: PRK13304

>PRK13304 L-aspartate dehydrogenase; Reviewed.
Probab=96.71  E-value=0.0062  Score=36.26  Aligned_cols=68  Identities=18%  Similarity=0.180  Sum_probs=44.6

Q ss_pred             CEEEEECCCHHHHHHHHHHHHC--CCEEEEE-ECCHHHHHHHHHCCCEEEECCCCCCCHHHHHHHCCCCEEEEEECCC
Q ss_conf             9399988888899999999988--9889999-6794463455644982898067864023465411563278761244
Q gi|254780595|r    1 MHLMIFGAGYTGKFIADAALKV--GVYTCGT-TRSVSNLLTLKHKGISPFLFADQKINNLLREKLYFTTHIVQCIKPS   75 (289)
Q Consensus         1 MkIlI~GaG~iG~~l~~~L~~~--g~~V~~~-~r~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~   75 (289)
T Consensus         2 ~rVgiIG~GaIG~~Va~~l~~g~~~~~L~~V~~r~~~~a~~~a~~~~~~~~-------~~ld~l~~~~DlVVE~A~~~   72 (265)
T PRK13304          2 LKIGIVGCGAIANLITKAIDSGRINAELLAFYDRNLEKAENLAEKTGAPAC-------LSIDELVKDVDLVVECASQK   72 (265)
T ss_pred             CEEEEECCCHHHHHHHHHHHCCCCCEEEEEEECCCHHHHHHHHHCCCCCCC-------CCHHHHHHCCCEEEECCCHH
T ss_conf             499998657899999999867998649999978987898877641599712-------79899833899999898989