HHsearch alignment for GI: 254780595 and conserved domain: PRK13581

>PRK13581 D-3-phosphoglycerate dehydrogenase; Provisional.
Probab=94.74  E-value=0.23  Score=27.25  Aligned_cols=65  Identities=20%  Similarity=0.158  Sum_probs=41.4

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHCCCEEEECCCCCCCHHHHHHHCCCCEEEEEECCCC
Q ss_conf             399988888899999999988988999967944634556449828980678640234654115632787612444
Q gi|254780595|r    2 HLMIFGAGYTGKFIADAALKVGVYTCGTTRSVSNLLTLKHKGISPFLFADQKINNLLREKLYFTTHIVQCIKPSS   76 (289)
Q Consensus         2 kIlI~GaG~iG~~l~~~L~~~g~~V~~~~r~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~   76 (289)
T Consensus       140 tlGIiG~G~IG~~vA~~~~~fgm~Vi~yDP~~~~-~~~~~~gv~~~---------~l~ell~~sD~IslH~Plt~  204 (524)
T PRK13581        140 TLGVIGLGRIGSEVAKRAKAFGMKVIAYDPYISP-ERAAQLGVELV---------ELDELLARADFITLHTPLTP  204 (524)
T ss_pred             EEEEECCCHHHHHHHHHHHHCCCEEEEECCCCCH-HHHHHCCCEEE---------EHHHHHHHCCEEEECCCCCH
T ss_conf             8999776757899999998549747887776446-67987196686---------08997310889999367861